[
  {
    "path": ".gitignore",
    "content": "*.slurm"
  },
  {
    "path": "README.md",
    "content": "<div align=center>\n<img src=\"./docs/parafoldlogo.png\" width=\"400\" >\n</div>\n\n# ParaFold\n\nAuthor: Bozitao Zhong - zbztzhz@gmail.com\n\n:bookmark_tabs: Please cite our [paper](https://arxiv.org/abs/2111.06340) if you used ParaFold (ParallelFold) in you research. \n\n## Overview\n\nRecent change: **ParaFold now supports AlphaFold 2.3.1**\n\nThis project is a modified version of DeepMind's [AlphaFold2](https://github.com/deepmind/alphafold) to achieve high-throughput protein structure prediction. \n\nWe have these following modifications to the original AlphaFold pipeline:\n\n- Divide **CPU part** (MSA and template searching) and **GPU part** (prediction model)\n\n\n\n## How to install \n\nWe recommend to install AlphaFold locally, and not using **docker**.\n\n```bash\n# clone this repo\ngit clone https://github.com/Zuricho/ParallelFold.git\n\n# Create a miniconda environment for ParaFold/AlphaFold\n# Recommend you to use python 3.8, version < 3.7 have missing packages, python versions newer than 3.8 were not tested\nconda create -n parafold python=3.8\n\npip install py3dmol\n# openmm 7.7 is recommended (original alphafold using 7.5.1, but it is not supported now)\nconda install -c conda-forge openmm=7.7 pdbfixer\n\n# use pip3 to install most of packages\npip3 install -r requirements.txt\n\n# install cuda and cudnn\n# cudatoolkit 11.3.1 matches cudnn 8.2.1\nconda install cudatoolkit=11.3 cudnn\n\n# downgrade jaxlib to the correct version, matches with cuda and cudnn version\npip3 install --upgrade --no-cache-dir jax==0.3.25 jaxlib==0.3.25+cuda11.cudnn82 -f https://storage.googleapis.com/jax-releases/jax_cuda_releases.html\n\n# install packages for multiple sequence alignment\nconda install -c bioconda hmmer=3.3.2 hhsuite=3.3.0 kalign2=2.04\n\nchmod +x run_alphafold.sh\n```\n\n## Download the sequence database\n\nYou can use the [downloading script from AlphaFold repo](https://github.com/google-deepmind/alphafold/blob/main/scripts/download_all_data.sh). \nThe `data` directory should have the following directory structure. Some old versions of AlphaFold might have older database versions, you should update them (reference to AlphaFold repo)\n\n```text\n$DOWNLOAD_DIR/                             # Total: ~ 2.62 TB (download: 556 GB)\n    bfd/                                   # ~ 1.8 TB (download: 271.6 GB)\n        # 6 files.\n    mgnify/                                # ~ 120 GB (download: 67 GB)\n        mgy_clusters_2022_05.fa\n    params/                                # ~ 5.3 GB (download: 5.3 GB)\n        # 5 CASP14 models,\n        # 5 pTM models,\n        # 5 AlphaFold-Multimer models,\n        # LICENSE,\n        # = 16 files.\n    pdb70/                                 # ~ 56 GB (download: 19.5 GB)\n        # 9 files.\n    pdb_mmcif/                             # ~ 238 GB (download: 43 GB)\n        mmcif_files/\n            # About 199,000 .cif files.\n        obsolete.dat\n    pdb_seqres/                            # ~ 0.2 GB (download: 0.2 GB)\n        pdb_seqres.txt\n    small_bfd/                             # ~ 17 GB (download: 9.6 GB)\n        bfd-first_non_consensus_sequences.fasta\n    uniref30/                              # ~ 206 GB (download: 52.5 GB)\n        # 7 files.\n    uniprot/                               # ~ 105 GB (download: 53 GB)\n        uniprot.fasta\n    uniref90/                              # ~ 67 GB (download: 34 GB)\n        uniref90.fasta\n```\n\n\n## Some detail information of modified files\n\n- `run_alphafold.py`: modified version of original `run_alphafold.py`, it has multiple additional functions like skipping featuring steps when exists `feature.pkl` in output folder\n- `run_alphafold.sh`: bash script to run `run_alphafold.py`\n\n\n\n## How to run\n\n### Run features\n\nRun on CPUs to get features:\n\n```bash\n./run_alphafold.sh \\\n-d data \\\n-o output \\\n-p monomer_ptm \\\n-i input/GA98.fasta \\\n-t 1800-01-01 \\\n-m model_1 \\\n-f\n\n```\n\n`-f` means only run the featurization step, result in a `feature.pkl` file, and skip the following steps.\n\n>  8 CPUs is enough, according to my test, more CPUs won't help with speed\n\nFeaturing step will output the `feature.pkl`  and MSA folder in your output folder: `./output/[FASTA_NAME]/`\n\nPS: Here we put input files in an `input` folder to organize files in a better way.\n\n\n\n### Run monomer prediction\n\nAfter the feature step, you can run `run_alphafold.sh` using GPU:\n\n```bash\n./run_alphafold.sh \\\n-d data \\\n-o output \\\n-m model_1,model_2,model_3,model_4,model_5 \\\n-p monomer_ptm \\\n-i input/GA98.fasta \\\n-t 1800-01-01 \n\n```\n\nIf you have successfully output `feature.pkl`, you can have a very fast featuring step\n\n\n\n### Run multimer prediction\n\n```bash\n./run_alphafold.sh \\\n-d data \\\n-o output \\\n-m model_1_multimer,model_2_multimer,model_3_multimer,model_4_multimer,model_5_multimer \\\n-p multimer \\\n-i input/GA98.fasta \\\n-t 1800-01-01 \n\n```\n\n\n\n## What is this for\n\nParallelFold can help you accelerate AlphaFold when you want to predict multiple sequences. After dividing the CPU part and GPU part, users can finish feature step by multiple processors. Using ParaFold, you can run AlphaFold 2~3 times faster than DeepMind's procedure. \n\n**If you have any question, please raise issues**\n\n\n\n\n\n\n\n"
  },
  {
    "path": "alphafold/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"An implementation of the inference pipeline of AlphaFold v2.0.\"\"\"\n"
  },
  {
    "path": "alphafold/common/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Common data types and constants used within Alphafold.\"\"\"\n"
  },
  {
    "path": "alphafold/common/confidence.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Functions for processing confidence metrics.\"\"\"\n\nfrom typing import Dict, Optional, Tuple\nimport numpy as np\nimport scipy.special\n\n\ndef compute_plddt(logits: np.ndarray) -> np.ndarray:\n  \"\"\"Computes per-residue pLDDT from logits.\n\n  Args:\n    logits: [num_res, num_bins] output from the PredictedLDDTHead.\n\n  Returns:\n    plddt: [num_res] per-residue pLDDT.\n  \"\"\"\n  num_bins = logits.shape[-1]\n  bin_width = 1.0 / num_bins\n  bin_centers = np.arange(start=0.5 * bin_width, stop=1.0, step=bin_width)\n  probs = scipy.special.softmax(logits, axis=-1)\n  predicted_lddt_ca = np.sum(probs * bin_centers[None, :], axis=-1)\n  return predicted_lddt_ca * 100\n\n\ndef _calculate_bin_centers(breaks: np.ndarray):\n  \"\"\"Gets the bin centers from the bin edges.\n\n  Args:\n    breaks: [num_bins - 1] the error bin edges.\n\n  Returns:\n    bin_centers: [num_bins] the error bin centers.\n  \"\"\"\n  step = (breaks[1] - breaks[0])\n\n  # Add half-step to get the center\n  bin_centers = breaks + step / 2\n  # Add a catch-all bin at the end.\n  bin_centers = np.concatenate([bin_centers, [bin_centers[-1] + step]],\n                               axis=0)\n  return bin_centers\n\n\ndef _calculate_expected_aligned_error(\n    alignment_confidence_breaks: np.ndarray,\n    aligned_distance_error_probs: np.ndarray) -> Tuple[np.ndarray, np.ndarray]:\n  \"\"\"Calculates expected aligned distance errors for every pair of residues.\n\n  Args:\n    alignment_confidence_breaks: [num_bins - 1] the error bin edges.\n    aligned_distance_error_probs: [num_res, num_res, num_bins] the predicted\n      probs for each error bin, for each pair of residues.\n\n  Returns:\n    predicted_aligned_error: [num_res, num_res] the expected aligned distance\n      error for each pair of residues.\n    max_predicted_aligned_error: The maximum predicted error possible.\n  \"\"\"\n  bin_centers = _calculate_bin_centers(alignment_confidence_breaks)\n\n  # Tuple of expected aligned distance error and max possible error.\n  return (np.sum(aligned_distance_error_probs * bin_centers, axis=-1),\n          np.asarray(bin_centers[-1]))\n\n\ndef compute_predicted_aligned_error(\n    logits: np.ndarray,\n    breaks: np.ndarray) -> Dict[str, np.ndarray]:\n  \"\"\"Computes aligned confidence metrics from logits.\n\n  Args:\n    logits: [num_res, num_res, num_bins] the logits output from\n      PredictedAlignedErrorHead.\n    breaks: [num_bins - 1] the error bin edges.\n\n  Returns:\n    aligned_confidence_probs: [num_res, num_res, num_bins] the predicted\n      aligned error probabilities over bins for each residue pair.\n    predicted_aligned_error: [num_res, num_res] the expected aligned distance\n      error for each pair of residues.\n    max_predicted_aligned_error: The maximum predicted error possible.\n  \"\"\"\n  aligned_confidence_probs = scipy.special.softmax(\n      logits,\n      axis=-1)\n  predicted_aligned_error, max_predicted_aligned_error = (\n      _calculate_expected_aligned_error(\n          alignment_confidence_breaks=breaks,\n          aligned_distance_error_probs=aligned_confidence_probs))\n  return {\n      'aligned_confidence_probs': aligned_confidence_probs,\n      'predicted_aligned_error': predicted_aligned_error,\n      'max_predicted_aligned_error': max_predicted_aligned_error,\n  }\n\n\ndef predicted_tm_score(\n    logits: np.ndarray,\n    breaks: np.ndarray,\n    residue_weights: Optional[np.ndarray] = None,\n    asym_id: Optional[np.ndarray] = None,\n    interface: bool = False) -> np.ndarray:\n  \"\"\"Computes predicted TM alignment or predicted interface TM alignment score.\n\n  Args:\n    logits: [num_res, num_res, num_bins] the logits output from\n      PredictedAlignedErrorHead.\n    breaks: [num_bins] the error bins.\n    residue_weights: [num_res] the per residue weights to use for the\n      expectation.\n    asym_id: [num_res] the asymmetric unit ID - the chain ID. Only needed for\n      ipTM calculation, i.e. when interface=True.\n    interface: If True, interface predicted TM score is computed.\n\n  Returns:\n    ptm_score: The predicted TM alignment or the predicted iTM score.\n  \"\"\"\n\n  # residue_weights has to be in [0, 1], but can be floating-point, i.e. the\n  # exp. resolved head's probability.\n  if residue_weights is None:\n    residue_weights = np.ones(logits.shape[0])\n\n  bin_centers = _calculate_bin_centers(breaks)\n\n  num_res = int(np.sum(residue_weights))\n  # Clip num_res to avoid negative/undefined d0.\n  clipped_num_res = max(num_res, 19)\n\n  # Compute d_0(num_res) as defined by TM-score, eqn. (5) in Yang & Skolnick\n  # \"Scoring function for automated assessment of protein structure template\n  # quality\", 2004: http://zhanglab.ccmb.med.umich.edu/papers/2004_3.pdf\n  d0 = 1.24 * (clipped_num_res - 15) ** (1./3) - 1.8\n\n  # Convert logits to probs.\n  probs = scipy.special.softmax(logits, axis=-1)\n\n  # TM-Score term for every bin.\n  tm_per_bin = 1. / (1 + np.square(bin_centers) / np.square(d0))\n  # E_distances tm(distance).\n  predicted_tm_term = np.sum(probs * tm_per_bin, axis=-1)\n\n  pair_mask = np.ones(shape=(num_res, num_res), dtype=bool)\n  if interface:\n    pair_mask *= asym_id[:, None] != asym_id[None, :]\n\n  predicted_tm_term *= pair_mask\n\n  pair_residue_weights = pair_mask * (\n      residue_weights[None, :] * residue_weights[:, None])\n  normed_residue_mask = pair_residue_weights / (1e-8 + np.sum(\n      pair_residue_weights, axis=-1, keepdims=True))\n  per_alignment = np.sum(predicted_tm_term * normed_residue_mask, axis=-1)\n  return np.asarray(per_alignment[(per_alignment * residue_weights).argmax()])\n"
  },
  {
    "path": "alphafold/common/protein.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Protein data type.\"\"\"\nimport dataclasses\nimport io\nfrom typing import Any, Mapping, Optional\nfrom alphafold.common import residue_constants\nfrom Bio.PDB import PDBParser\nimport numpy as np\n\nFeatureDict = Mapping[str, np.ndarray]\nModelOutput = Mapping[str, Any]  # Is a nested dict.\n\n# Complete sequence of chain IDs supported by the PDB format.\nPDB_CHAIN_IDS = 'ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789'\nPDB_MAX_CHAINS = len(PDB_CHAIN_IDS)  # := 62.\n\n\n@dataclasses.dataclass(frozen=True)\nclass Protein:\n  \"\"\"Protein structure representation.\"\"\"\n\n  # Cartesian coordinates of atoms in angstroms. The atom types correspond to\n  # residue_constants.atom_types, i.e. the first three are N, CA, CB.\n  atom_positions: np.ndarray  # [num_res, num_atom_type, 3]\n\n  # Amino-acid type for each residue represented as an integer between 0 and\n  # 20, where 20 is 'X'.\n  aatype: np.ndarray  # [num_res]\n\n  # Binary float mask to indicate presence of a particular atom. 1.0 if an atom\n  # is present and 0.0 if not. This should be used for loss masking.\n  atom_mask: np.ndarray  # [num_res, num_atom_type]\n\n  # Residue index as used in PDB. It is not necessarily continuous or 0-indexed.\n  residue_index: np.ndarray  # [num_res]\n\n  # 0-indexed number corresponding to the chain in the protein that this residue\n  # belongs to.\n  chain_index: np.ndarray  # [num_res]\n\n  # B-factors, or temperature factors, of each residue (in sq. angstroms units),\n  # representing the displacement of the residue from its ground truth mean\n  # value.\n  b_factors: np.ndarray  # [num_res, num_atom_type]\n\n  def __post_init__(self):\n    if len(np.unique(self.chain_index)) > PDB_MAX_CHAINS:\n      raise ValueError(\n          f'Cannot build an instance with more than {PDB_MAX_CHAINS} chains '\n          'because these cannot be written to PDB format.')\n\n\ndef from_pdb_string(pdb_str: str, chain_id: Optional[str] = None) -> Protein:\n  \"\"\"Takes a PDB string and constructs a Protein object.\n\n  WARNING: All non-standard residue types will be converted into UNK. All\n    non-standard atoms will be ignored.\n\n  Args:\n    pdb_str: The contents of the pdb file\n    chain_id: If chain_id is specified (e.g. A), then only that chain\n      is parsed. Otherwise all chains are parsed.\n\n  Returns:\n    A new `Protein` parsed from the pdb contents.\n  \"\"\"\n  pdb_fh = io.StringIO(pdb_str)\n  parser = PDBParser(QUIET=True)\n  structure = parser.get_structure('none', pdb_fh)\n  models = list(structure.get_models())\n  if len(models) != 1:\n    raise ValueError(\n        f'Only single model PDBs are supported. Found {len(models)} models.')\n  model = models[0]\n\n  atom_positions = []\n  aatype = []\n  atom_mask = []\n  residue_index = []\n  chain_ids = []\n  b_factors = []\n\n  for chain in model:\n    if chain_id is not None and chain.id != chain_id:\n      continue\n    for res in chain:\n      if res.id[2] != ' ':\n        raise ValueError(\n            f'PDB contains an insertion code at chain {chain.id} and residue '\n            f'index {res.id[1]}. These are not supported.')\n      res_shortname = residue_constants.restype_3to1.get(res.resname, 'X')\n      restype_idx = residue_constants.restype_order.get(\n          res_shortname, residue_constants.restype_num)\n      pos = np.zeros((residue_constants.atom_type_num, 3))\n      mask = np.zeros((residue_constants.atom_type_num,))\n      res_b_factors = np.zeros((residue_constants.atom_type_num,))\n      for atom in res:\n        if atom.name not in residue_constants.atom_types:\n          continue\n        pos[residue_constants.atom_order[atom.name]] = atom.coord\n        mask[residue_constants.atom_order[atom.name]] = 1.\n        res_b_factors[residue_constants.atom_order[atom.name]] = atom.bfactor\n      if np.sum(mask) < 0.5:\n        # If no known atom positions are reported for the residue then skip it.\n        continue\n      aatype.append(restype_idx)\n      atom_positions.append(pos)\n      atom_mask.append(mask)\n      residue_index.append(res.id[1])\n      chain_ids.append(chain.id)\n      b_factors.append(res_b_factors)\n\n  # Chain IDs are usually characters so map these to ints.\n  unique_chain_ids = np.unique(chain_ids)\n  chain_id_mapping = {cid: n for n, cid in enumerate(unique_chain_ids)}\n  chain_index = np.array([chain_id_mapping[cid] for cid in chain_ids])\n\n  return Protein(\n      atom_positions=np.array(atom_positions),\n      atom_mask=np.array(atom_mask),\n      aatype=np.array(aatype),\n      residue_index=np.array(residue_index),\n      chain_index=chain_index,\n      b_factors=np.array(b_factors))\n\n\ndef _chain_end(atom_index, end_resname, chain_name, residue_index) -> str:\n  chain_end = 'TER'\n  return (f'{chain_end:<6}{atom_index:>5}      {end_resname:>3} '\n          f'{chain_name:>1}{residue_index:>4}')\n\n\ndef to_pdb(prot: Protein) -> str:\n  \"\"\"Converts a `Protein` instance to a PDB string.\n\n  Args:\n    prot: The protein to convert to PDB.\n\n  Returns:\n    PDB string.\n  \"\"\"\n  restypes = residue_constants.restypes + ['X']\n  res_1to3 = lambda r: residue_constants.restype_1to3.get(restypes[r], 'UNK')\n  atom_types = residue_constants.atom_types\n\n  pdb_lines = []\n\n  atom_mask = prot.atom_mask\n  aatype = prot.aatype\n  atom_positions = prot.atom_positions\n  residue_index = prot.residue_index.astype(np.int32)\n  chain_index = prot.chain_index.astype(np.int32)\n  b_factors = prot.b_factors\n\n  if np.any(aatype > residue_constants.restype_num):\n    raise ValueError('Invalid aatypes.')\n\n  # Construct a mapping from chain integer indices to chain ID strings.\n  chain_ids = {}\n  for i in np.unique(chain_index):  # np.unique gives sorted output.\n    if i >= PDB_MAX_CHAINS:\n      raise ValueError(\n          f'The PDB format supports at most {PDB_MAX_CHAINS} chains.')\n    chain_ids[i] = PDB_CHAIN_IDS[i]\n\n  pdb_lines.append('MODEL     1')\n  atom_index = 1\n  last_chain_index = chain_index[0]\n  # Add all atom sites.\n  for i in range(aatype.shape[0]):\n    # Close the previous chain if in a multichain PDB.\n    if last_chain_index != chain_index[i]:\n      pdb_lines.append(_chain_end(\n          atom_index, res_1to3(aatype[i - 1]), chain_ids[chain_index[i - 1]],\n          residue_index[i - 1]))\n      last_chain_index = chain_index[i]\n      atom_index += 1  # Atom index increases at the TER symbol.\n\n    res_name_3 = res_1to3(aatype[i])\n    for atom_name, pos, mask, b_factor in zip(\n        atom_types, atom_positions[i], atom_mask[i], b_factors[i]):\n      if mask < 0.5:\n        continue\n\n      record_type = 'ATOM'\n      name = atom_name if len(atom_name) == 4 else f' {atom_name}'\n      alt_loc = ''\n      insertion_code = ''\n      occupancy = 1.00\n      element = atom_name[0]  # Protein supports only C, N, O, S, this works.\n      charge = ''\n      # PDB is a columnar format, every space matters here!\n      atom_line = (f'{record_type:<6}{atom_index:>5} {name:<4}{alt_loc:>1}'\n                   f'{res_name_3:>3} {chain_ids[chain_index[i]]:>1}'\n                   f'{residue_index[i]:>4}{insertion_code:>1}   '\n                   f'{pos[0]:>8.3f}{pos[1]:>8.3f}{pos[2]:>8.3f}'\n                   f'{occupancy:>6.2f}{b_factor:>6.2f}          '\n                   f'{element:>2}{charge:>2}')\n      pdb_lines.append(atom_line)\n      atom_index += 1\n\n  # Close the final chain.\n  pdb_lines.append(_chain_end(atom_index, res_1to3(aatype[-1]),\n                              chain_ids[chain_index[-1]], residue_index[-1]))\n  pdb_lines.append('ENDMDL')\n  pdb_lines.append('END')\n\n  # Pad all lines to 80 characters.\n  pdb_lines = [line.ljust(80) for line in pdb_lines]\n  return '\\n'.join(pdb_lines) + '\\n'  # Add terminating newline.\n\n\ndef ideal_atom_mask(prot: Protein) -> np.ndarray:\n  \"\"\"Computes an ideal atom mask.\n\n  `Protein.atom_mask` typically is defined according to the atoms that are\n  reported in the PDB. This function computes a mask according to heavy atoms\n  that should be present in the given sequence of amino acids.\n\n  Args:\n    prot: `Protein` whose fields are `numpy.ndarray` objects.\n\n  Returns:\n    An ideal atom mask.\n  \"\"\"\n  return residue_constants.STANDARD_ATOM_MASK[prot.aatype]\n\n\ndef from_prediction(\n    features: FeatureDict,\n    result: ModelOutput,\n    b_factors: Optional[np.ndarray] = None,\n    remove_leading_feature_dimension: bool = True) -> Protein:\n  \"\"\"Assembles a protein from a prediction.\n\n  Args:\n    features: Dictionary holding model inputs.\n    result: Dictionary holding model outputs.\n    b_factors: (Optional) B-factors to use for the protein.\n    remove_leading_feature_dimension: Whether to remove the leading dimension\n      of the `features` values.\n\n  Returns:\n    A protein instance.\n  \"\"\"\n  fold_output = result['structure_module']\n\n  def _maybe_remove_leading_dim(arr: np.ndarray) -> np.ndarray:\n    return arr[0] if remove_leading_feature_dimension else arr\n\n  if 'asym_id' in features:\n    chain_index = _maybe_remove_leading_dim(features['asym_id'])\n  else:\n    chain_index = np.zeros_like(_maybe_remove_leading_dim(features['aatype']))\n\n  if b_factors is None:\n    b_factors = np.zeros_like(fold_output['final_atom_mask'])\n\n  return Protein(\n      aatype=_maybe_remove_leading_dim(features['aatype']),\n      atom_positions=fold_output['final_atom_positions'],\n      atom_mask=fold_output['final_atom_mask'],\n      residue_index=_maybe_remove_leading_dim(features['residue_index']) + 1,\n      chain_index=chain_index,\n      b_factors=b_factors)\n"
  },
  {
    "path": "alphafold/common/protein_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for protein.\"\"\"\n\nimport os\n\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.common import protein\nfrom alphafold.common import residue_constants\nimport numpy as np\n# Internal import (7716).\n\nTEST_DATA_DIR = 'alphafold/common/testdata/'\n\n\nclass ProteinTest(parameterized.TestCase):\n\n  def _check_shapes(self, prot, num_res):\n    \"\"\"Check that the processed shapes are correct.\"\"\"\n    num_atoms = residue_constants.atom_type_num\n    self.assertEqual((num_res, num_atoms, 3), prot.atom_positions.shape)\n    self.assertEqual((num_res,), prot.aatype.shape)\n    self.assertEqual((num_res, num_atoms), prot.atom_mask.shape)\n    self.assertEqual((num_res,), prot.residue_index.shape)\n    self.assertEqual((num_res,), prot.chain_index.shape)\n    self.assertEqual((num_res, num_atoms), prot.b_factors.shape)\n\n  @parameterized.named_parameters(\n      dict(testcase_name='chain_A',\n           pdb_file='2rbg.pdb', chain_id='A', num_res=282, num_chains=1),\n      dict(testcase_name='chain_B',\n           pdb_file='2rbg.pdb', chain_id='B', num_res=282, num_chains=1),\n      dict(testcase_name='multichain',\n           pdb_file='2rbg.pdb', chain_id=None, num_res=564, num_chains=2))\n  def test_from_pdb_str(self, pdb_file, chain_id, num_res, num_chains):\n    pdb_file = os.path.join(absltest.get_default_test_srcdir(), TEST_DATA_DIR,\n                            pdb_file)\n    with open(pdb_file) as f:\n      pdb_string = f.read()\n    prot = protein.from_pdb_string(pdb_string, chain_id)\n    self._check_shapes(prot, num_res)\n    self.assertGreaterEqual(prot.aatype.min(), 0)\n    # Allow equal since unknown restypes have index equal to restype_num.\n    self.assertLessEqual(prot.aatype.max(), residue_constants.restype_num)\n    self.assertLen(np.unique(prot.chain_index), num_chains)\n\n  def test_to_pdb(self):\n    with open(\n        os.path.join(absltest.get_default_test_srcdir(), TEST_DATA_DIR,\n                     '2rbg.pdb')) as f:\n      pdb_string = f.read()\n    prot = protein.from_pdb_string(pdb_string)\n    pdb_string_reconstr = protein.to_pdb(prot)\n\n    for line in pdb_string_reconstr.splitlines():\n      self.assertLen(line, 80)\n\n    prot_reconstr = protein.from_pdb_string(pdb_string_reconstr)\n\n    np.testing.assert_array_equal(prot_reconstr.aatype, prot.aatype)\n    np.testing.assert_array_almost_equal(\n        prot_reconstr.atom_positions, prot.atom_positions)\n    np.testing.assert_array_almost_equal(\n        prot_reconstr.atom_mask, prot.atom_mask)\n    np.testing.assert_array_equal(\n        prot_reconstr.residue_index, prot.residue_index)\n    np.testing.assert_array_equal(\n        prot_reconstr.chain_index, prot.chain_index)\n    np.testing.assert_array_almost_equal(\n        prot_reconstr.b_factors, prot.b_factors)\n\n  def test_ideal_atom_mask(self):\n    with open(\n        os.path.join(absltest.get_default_test_srcdir(), TEST_DATA_DIR,\n                     '2rbg.pdb')) as f:\n      pdb_string = f.read()\n    prot = protein.from_pdb_string(pdb_string)\n    ideal_mask = protein.ideal_atom_mask(prot)\n    non_ideal_residues = set([102] + list(range(127, 286)))\n    for i, (res, atom_mask) in enumerate(\n        zip(prot.residue_index, prot.atom_mask)):\n      if res in non_ideal_residues:\n        self.assertFalse(np.all(atom_mask == ideal_mask[i]), msg=f'{res}')\n      else:\n        self.assertTrue(np.all(atom_mask == ideal_mask[i]), msg=f'{res}')\n\n  def test_too_many_chains(self):\n    num_res = protein.PDB_MAX_CHAINS + 1\n    num_atom_type = residue_constants.atom_type_num\n    with self.assertRaises(ValueError):\n      _ = protein.Protein(\n          atom_positions=np.random.random([num_res, num_atom_type, 3]),\n          aatype=np.random.randint(0, 21, [num_res]),\n          atom_mask=np.random.randint(0, 2, [num_res]).astype(np.float32),\n          residue_index=np.arange(1, num_res+1),\n          chain_index=np.arange(num_res),\n          b_factors=np.random.uniform(1, 100, [num_res]))\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/common/residue_constants.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Constants used in AlphaFold.\"\"\"\n\nimport collections\nimport functools\nimport os\nfrom typing import List, Mapping, Tuple\n\nimport numpy as np\nimport tree\n\n# Internal import (35fd).\n\n\n# Distance from one CA to next CA [trans configuration: omega = 180].\nca_ca = 3.80209737096\n\n# Format: The list for each AA type contains chi1, chi2, chi3, chi4 in\n# this order (or a relevant subset from chi1 onwards). ALA and GLY don't have\n# chi angles so their chi angle lists are empty.\nchi_angles_atoms = {\n    'ALA': [],\n    # Chi5 in arginine is always 0 +- 5 degrees, so ignore it.\n    'ARG': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD'],\n            ['CB', 'CG', 'CD', 'NE'], ['CG', 'CD', 'NE', 'CZ']],\n    'ASN': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'OD1']],\n    'ASP': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'OD1']],\n    'CYS': [['N', 'CA', 'CB', 'SG']],\n    'GLN': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD'],\n            ['CB', 'CG', 'CD', 'OE1']],\n    'GLU': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD'],\n            ['CB', 'CG', 'CD', 'OE1']],\n    'GLY': [],\n    'HIS': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'ND1']],\n    'ILE': [['N', 'CA', 'CB', 'CG1'], ['CA', 'CB', 'CG1', 'CD1']],\n    'LEU': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD1']],\n    'LYS': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD'],\n            ['CB', 'CG', 'CD', 'CE'], ['CG', 'CD', 'CE', 'NZ']],\n    'MET': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'SD'],\n            ['CB', 'CG', 'SD', 'CE']],\n    'PHE': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD1']],\n    'PRO': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD']],\n    'SER': [['N', 'CA', 'CB', 'OG']],\n    'THR': [['N', 'CA', 'CB', 'OG1']],\n    'TRP': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD1']],\n    'TYR': [['N', 'CA', 'CB', 'CG'], ['CA', 'CB', 'CG', 'CD1']],\n    'VAL': [['N', 'CA', 'CB', 'CG1']],\n}\n\n# If chi angles given in fixed-length array, this matrix determines how to mask\n# them for each AA type. The order is as per restype_order (see below).\nchi_angles_mask = [\n    [0.0, 0.0, 0.0, 0.0],  # ALA\n    [1.0, 1.0, 1.0, 1.0],  # ARG\n    [1.0, 1.0, 0.0, 0.0],  # ASN\n    [1.0, 1.0, 0.0, 0.0],  # ASP\n    [1.0, 0.0, 0.0, 0.0],  # CYS\n    [1.0, 1.0, 1.0, 0.0],  # GLN\n    [1.0, 1.0, 1.0, 0.0],  # GLU\n    [0.0, 0.0, 0.0, 0.0],  # GLY\n    [1.0, 1.0, 0.0, 0.0],  # HIS\n    [1.0, 1.0, 0.0, 0.0],  # ILE\n    [1.0, 1.0, 0.0, 0.0],  # LEU\n    [1.0, 1.0, 1.0, 1.0],  # LYS\n    [1.0, 1.0, 1.0, 0.0],  # MET\n    [1.0, 1.0, 0.0, 0.0],  # PHE\n    [1.0, 1.0, 0.0, 0.0],  # PRO\n    [1.0, 0.0, 0.0, 0.0],  # SER\n    [1.0, 0.0, 0.0, 0.0],  # THR\n    [1.0, 1.0, 0.0, 0.0],  # TRP\n    [1.0, 1.0, 0.0, 0.0],  # TYR\n    [1.0, 0.0, 0.0, 0.0],  # VAL\n]\n\n# The following chi angles are pi periodic: they can be rotated by a multiple\n# of pi without affecting the structure.\nchi_pi_periodic = [\n    [0.0, 0.0, 0.0, 0.0],  # ALA\n    [0.0, 0.0, 0.0, 0.0],  # ARG\n    [0.0, 0.0, 0.0, 0.0],  # ASN\n    [0.0, 1.0, 0.0, 0.0],  # ASP\n    [0.0, 0.0, 0.0, 0.0],  # CYS\n    [0.0, 0.0, 0.0, 0.0],  # GLN\n    [0.0, 0.0, 1.0, 0.0],  # GLU\n    [0.0, 0.0, 0.0, 0.0],  # GLY\n    [0.0, 0.0, 0.0, 0.0],  # HIS\n    [0.0, 0.0, 0.0, 0.0],  # ILE\n    [0.0, 0.0, 0.0, 0.0],  # LEU\n    [0.0, 0.0, 0.0, 0.0],  # LYS\n    [0.0, 0.0, 0.0, 0.0],  # MET\n    [0.0, 1.0, 0.0, 0.0],  # PHE\n    [0.0, 0.0, 0.0, 0.0],  # PRO\n    [0.0, 0.0, 0.0, 0.0],  # SER\n    [0.0, 0.0, 0.0, 0.0],  # THR\n    [0.0, 0.0, 0.0, 0.0],  # TRP\n    [0.0, 1.0, 0.0, 0.0],  # TYR\n    [0.0, 0.0, 0.0, 0.0],  # VAL\n    [0.0, 0.0, 0.0, 0.0],  # UNK\n]\n\n# Atoms positions relative to the 8 rigid groups, defined by the pre-omega, phi,\n# psi and chi angles:\n# 0: 'backbone group',\n# 1: 'pre-omega-group', (empty)\n# 2: 'phi-group', (currently empty, because it defines only hydrogens)\n# 3: 'psi-group',\n# 4,5,6,7: 'chi1,2,3,4-group'\n# The atom positions are relative to the axis-end-atom of the corresponding\n# rotation axis. The x-axis is in direction of the rotation axis, and the y-axis\n# is defined such that the dihedral-angle-defining atom (the last entry in\n# chi_angles_atoms above) is in the xy-plane (with a positive y-coordinate).\n# format: [atomname, group_idx, rel_position]\nrigid_group_atom_positions = {\n    'ALA': [\n        ['N', 0, (-0.525, 1.363, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.526, -0.000, -0.000)],\n        ['CB', 0, (-0.529, -0.774, -1.205)],\n        ['O', 3, (0.627, 1.062, 0.000)],\n    ],\n    'ARG': [\n        ['N', 0, (-0.524, 1.362, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.525, -0.000, -0.000)],\n        ['CB', 0, (-0.524, -0.778, -1.209)],\n        ['O', 3, (0.626, 1.062, 0.000)],\n        ['CG', 4, (0.616, 1.390, -0.000)],\n        ['CD', 5, (0.564, 1.414, 0.000)],\n        ['NE', 6, (0.539, 1.357, -0.000)],\n        ['NH1', 7, (0.206, 2.301, 0.000)],\n        ['NH2', 7, (2.078, 0.978, -0.000)],\n        ['CZ', 7, (0.758, 1.093, -0.000)],\n    ],\n    'ASN': [\n        ['N', 0, (-0.536, 1.357, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.526, -0.000, -0.000)],\n        ['CB', 0, (-0.531, -0.787, -1.200)],\n        ['O', 3, (0.625, 1.062, 0.000)],\n        ['CG', 4, (0.584, 1.399, 0.000)],\n        ['ND2', 5, (0.593, -1.188, 0.001)],\n        ['OD1', 5, (0.633, 1.059, 0.000)],\n    ],\n    'ASP': [\n        ['N', 0, (-0.525, 1.362, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.527, 0.000, -0.000)],\n        ['CB', 0, (-0.526, -0.778, -1.208)],\n        ['O', 3, (0.626, 1.062, -0.000)],\n        ['CG', 4, (0.593, 1.398, -0.000)],\n        ['OD1', 5, (0.610, 1.091, 0.000)],\n        ['OD2', 5, (0.592, -1.101, -0.003)],\n    ],\n    'CYS': [\n        ['N', 0, (-0.522, 1.362, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.524, 0.000, 0.000)],\n        ['CB', 0, (-0.519, -0.773, -1.212)],\n        ['O', 3, (0.625, 1.062, -0.000)],\n        ['SG', 4, (0.728, 1.653, 0.000)],\n    ],\n    'GLN': [\n        ['N', 0, (-0.526, 1.361, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.526, 0.000, 0.000)],\n        ['CB', 0, (-0.525, -0.779, -1.207)],\n        ['O', 3, (0.626, 1.062, -0.000)],\n        ['CG', 4, (0.615, 1.393, 0.000)],\n        ['CD', 5, (0.587, 1.399, -0.000)],\n        ['NE2', 6, (0.593, -1.189, -0.001)],\n        ['OE1', 6, (0.634, 1.060, 0.000)],\n    ],\n    'GLU': [\n        ['N', 0, (-0.528, 1.361, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.526, -0.000, -0.000)],\n        ['CB', 0, (-0.526, -0.781, -1.207)],\n        ['O', 3, (0.626, 1.062, 0.000)],\n        ['CG', 4, (0.615, 1.392, 0.000)],\n        ['CD', 5, (0.600, 1.397, 0.000)],\n        ['OE1', 6, (0.607, 1.095, -0.000)],\n        ['OE2', 6, (0.589, -1.104, -0.001)],\n    ],\n    'GLY': [\n        ['N', 0, (-0.572, 1.337, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.517, -0.000, -0.000)],\n        ['O', 3, (0.626, 1.062, -0.000)],\n    ],\n    'HIS': [\n        ['N', 0, (-0.527, 1.360, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.525, 0.000, 0.000)],\n        ['CB', 0, (-0.525, -0.778, -1.208)],\n        ['O', 3, (0.625, 1.063, 0.000)],\n        ['CG', 4, (0.600, 1.370, -0.000)],\n        ['CD2', 5, (0.889, -1.021, 0.003)],\n        ['ND1', 5, (0.744, 1.160, -0.000)],\n        ['CE1', 5, (2.030, 0.851, 0.002)],\n        ['NE2', 5, (2.145, -0.466, 0.004)],\n    ],\n    'ILE': [\n        ['N', 0, (-0.493, 1.373, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.527, -0.000, -0.000)],\n        ['CB', 0, (-0.536, -0.793, -1.213)],\n        ['O', 3, (0.627, 1.062, -0.000)],\n        ['CG1', 4, (0.534, 1.437, -0.000)],\n        ['CG2', 4, (0.540, -0.785, -1.199)],\n        ['CD1', 5, (0.619, 1.391, 0.000)],\n    ],\n    'LEU': [\n        ['N', 0, (-0.520, 1.363, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.525, -0.000, -0.000)],\n        ['CB', 0, (-0.522, -0.773, -1.214)],\n        ['O', 3, (0.625, 1.063, -0.000)],\n        ['CG', 4, (0.678, 1.371, 0.000)],\n        ['CD1', 5, (0.530, 1.430, -0.000)],\n        ['CD2', 5, (0.535, -0.774, 1.200)],\n    ],\n    'LYS': [\n        ['N', 0, (-0.526, 1.362, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.526, 0.000, 0.000)],\n        ['CB', 0, (-0.524, -0.778, -1.208)],\n        ['O', 3, (0.626, 1.062, -0.000)],\n        ['CG', 4, (0.619, 1.390, 0.000)],\n        ['CD', 5, (0.559, 1.417, 0.000)],\n        ['CE', 6, (0.560, 1.416, 0.000)],\n        ['NZ', 7, (0.554, 1.387, 0.000)],\n    ],\n    'MET': [\n        ['N', 0, (-0.521, 1.364, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.525, 0.000, 0.000)],\n        ['CB', 0, (-0.523, -0.776, -1.210)],\n        ['O', 3, (0.625, 1.062, -0.000)],\n        ['CG', 4, (0.613, 1.391, -0.000)],\n        ['SD', 5, (0.703, 1.695, 0.000)],\n        ['CE', 6, (0.320, 1.786, -0.000)],\n    ],\n    'PHE': [\n        ['N', 0, (-0.518, 1.363, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.524, 0.000, -0.000)],\n        ['CB', 0, (-0.525, -0.776, -1.212)],\n        ['O', 3, (0.626, 1.062, -0.000)],\n        ['CG', 4, (0.607, 1.377, 0.000)],\n        ['CD1', 5, (0.709, 1.195, -0.000)],\n        ['CD2', 5, (0.706, -1.196, 0.000)],\n        ['CE1', 5, (2.102, 1.198, -0.000)],\n        ['CE2', 5, (2.098, -1.201, -0.000)],\n        ['CZ', 5, (2.794, -0.003, -0.001)],\n    ],\n    'PRO': [\n        ['N', 0, (-0.566, 1.351, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.527, -0.000, 0.000)],\n        ['CB', 0, (-0.546, -0.611, -1.293)],\n        ['O', 3, (0.621, 1.066, 0.000)],\n        ['CG', 4, (0.382, 1.445, 0.0)],\n        # ['CD', 5, (0.427, 1.440, 0.0)],\n        ['CD', 5, (0.477, 1.424, 0.0)],  # manually made angle 2 degrees larger\n    ],\n    'SER': [\n        ['N', 0, (-0.529, 1.360, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.525, -0.000, -0.000)],\n        ['CB', 0, (-0.518, -0.777, -1.211)],\n        ['O', 3, (0.626, 1.062, -0.000)],\n        ['OG', 4, (0.503, 1.325, 0.000)],\n    ],\n    'THR': [\n        ['N', 0, (-0.517, 1.364, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.526, 0.000, -0.000)],\n        ['CB', 0, (-0.516, -0.793, -1.215)],\n        ['O', 3, (0.626, 1.062, 0.000)],\n        ['CG2', 4, (0.550, -0.718, -1.228)],\n        ['OG1', 4, (0.472, 1.353, 0.000)],\n    ],\n    'TRP': [\n        ['N', 0, (-0.521, 1.363, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.525, -0.000, 0.000)],\n        ['CB', 0, (-0.523, -0.776, -1.212)],\n        ['O', 3, (0.627, 1.062, 0.000)],\n        ['CG', 4, (0.609, 1.370, -0.000)],\n        ['CD1', 5, (0.824, 1.091, 0.000)],\n        ['CD2', 5, (0.854, -1.148, -0.005)],\n        ['CE2', 5, (2.186, -0.678, -0.007)],\n        ['CE3', 5, (0.622, -2.530, -0.007)],\n        ['NE1', 5, (2.140, 0.690, -0.004)],\n        ['CH2', 5, (3.028, -2.890, -0.013)],\n        ['CZ2', 5, (3.283, -1.543, -0.011)],\n        ['CZ3', 5, (1.715, -3.389, -0.011)],\n    ],\n    'TYR': [\n        ['N', 0, (-0.522, 1.362, 0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.524, -0.000, -0.000)],\n        ['CB', 0, (-0.522, -0.776, -1.213)],\n        ['O', 3, (0.627, 1.062, -0.000)],\n        ['CG', 4, (0.607, 1.382, -0.000)],\n        ['CD1', 5, (0.716, 1.195, -0.000)],\n        ['CD2', 5, (0.713, -1.194, -0.001)],\n        ['CE1', 5, (2.107, 1.200, -0.002)],\n        ['CE2', 5, (2.104, -1.201, -0.003)],\n        ['OH', 5, (4.168, -0.002, -0.005)],\n        ['CZ', 5, (2.791, -0.001, -0.003)],\n    ],\n    'VAL': [\n        ['N', 0, (-0.494, 1.373, -0.000)],\n        ['CA', 0, (0.000, 0.000, 0.000)],\n        ['C', 0, (1.527, -0.000, -0.000)],\n        ['CB', 0, (-0.533, -0.795, -1.213)],\n        ['O', 3, (0.627, 1.062, -0.000)],\n        ['CG1', 4, (0.540, 1.429, -0.000)],\n        ['CG2', 4, (0.533, -0.776, 1.203)],\n    ],\n}\n\n# A list of atoms (excluding hydrogen) for each AA type. PDB naming convention.\nresidue_atoms = {\n    'ALA': ['C', 'CA', 'CB', 'N', 'O'],\n    'ARG': ['C', 'CA', 'CB', 'CG', 'CD', 'CZ', 'N', 'NE', 'O', 'NH1', 'NH2'],\n    'ASP': ['C', 'CA', 'CB', 'CG', 'N', 'O', 'OD1', 'OD2'],\n    'ASN': ['C', 'CA', 'CB', 'CG', 'N', 'ND2', 'O', 'OD1'],\n    'CYS': ['C', 'CA', 'CB', 'N', 'O', 'SG'],\n    'GLU': ['C', 'CA', 'CB', 'CG', 'CD', 'N', 'O', 'OE1', 'OE2'],\n    'GLN': ['C', 'CA', 'CB', 'CG', 'CD', 'N', 'NE2', 'O', 'OE1'],\n    'GLY': ['C', 'CA', 'N', 'O'],\n    'HIS': ['C', 'CA', 'CB', 'CG', 'CD2', 'CE1', 'N', 'ND1', 'NE2', 'O'],\n    'ILE': ['C', 'CA', 'CB', 'CG1', 'CG2', 'CD1', 'N', 'O'],\n    'LEU': ['C', 'CA', 'CB', 'CG', 'CD1', 'CD2', 'N', 'O'],\n    'LYS': ['C', 'CA', 'CB', 'CG', 'CD', 'CE', 'N', 'NZ', 'O'],\n    'MET': ['C', 'CA', 'CB', 'CG', 'CE', 'N', 'O', 'SD'],\n    'PHE': ['C', 'CA', 'CB', 'CG', 'CD1', 'CD2', 'CE1', 'CE2', 'CZ', 'N', 'O'],\n    'PRO': ['C', 'CA', 'CB', 'CG', 'CD', 'N', 'O'],\n    'SER': ['C', 'CA', 'CB', 'N', 'O', 'OG'],\n    'THR': ['C', 'CA', 'CB', 'CG2', 'N', 'O', 'OG1'],\n    'TRP': ['C', 'CA', 'CB', 'CG', 'CD1', 'CD2', 'CE2', 'CE3', 'CZ2', 'CZ3',\n            'CH2', 'N', 'NE1', 'O'],\n    'TYR': ['C', 'CA', 'CB', 'CG', 'CD1', 'CD2', 'CE1', 'CE2', 'CZ', 'N', 'O',\n            'OH'],\n    'VAL': ['C', 'CA', 'CB', 'CG1', 'CG2', 'N', 'O']\n}\n\n# Naming swaps for ambiguous atom names.\n# Due to symmetries in the amino acids the naming of atoms is ambiguous in\n# 4 of the 20 amino acids.\n# (The LDDT paper lists 7 amino acids as ambiguous, but the naming ambiguities\n# in LEU, VAL and ARG can be resolved by using the 3d constellations of\n# the 'ambiguous' atoms and their neighbours)\nresidue_atom_renaming_swaps = {\n    'ASP': {'OD1': 'OD2'},\n    'GLU': {'OE1': 'OE2'},\n    'PHE': {'CD1': 'CD2', 'CE1': 'CE2'},\n    'TYR': {'CD1': 'CD2', 'CE1': 'CE2'},\n}\n\n# Van der Waals radii [Angstroem] of the atoms (from Wikipedia)\nvan_der_waals_radius = {\n    'C': 1.7,\n    'N': 1.55,\n    'O': 1.52,\n    'S': 1.8,\n}\n\nBond = collections.namedtuple(\n    'Bond', ['atom1_name', 'atom2_name', 'length', 'stddev'])\nBondAngle = collections.namedtuple(\n    'BondAngle',\n    ['atom1_name', 'atom2_name', 'atom3name', 'angle_rad', 'stddev'])\n\n\n@functools.lru_cache(maxsize=None)\ndef load_stereo_chemical_props() -> Tuple[Mapping[str, List[Bond]],\n                                          Mapping[str, List[Bond]],\n                                          Mapping[str, List[BondAngle]]]:\n  \"\"\"Load stereo_chemical_props.txt into a nice structure.\n\n  Load literature values for bond lengths and bond angles and translate\n  bond angles into the length of the opposite edge of the triangle\n  (\"residue_virtual_bonds\").\n\n  Returns:\n    residue_bonds: Dict that maps resname -> list of Bond tuples.\n    residue_virtual_bonds: Dict that maps resname -> list of Bond tuples.\n    residue_bond_angles: Dict that maps resname -> list of BondAngle tuples.\n  \"\"\"\n  stereo_chemical_props_path = os.path.join(\n      os.path.dirname(os.path.abspath(__file__)), 'stereo_chemical_props.txt'\n  )\n  with open(stereo_chemical_props_path, 'rt') as f:\n    stereo_chemical_props = f.read()\n  lines_iter = iter(stereo_chemical_props.splitlines())\n  # Load bond lengths.\n  residue_bonds = {}\n  next(lines_iter)  # Skip header line.\n  for line in lines_iter:\n    if line.strip() == '-':\n      break\n    bond, resname, length, stddev = line.split()\n    atom1, atom2 = bond.split('-')\n    if resname not in residue_bonds:\n      residue_bonds[resname] = []\n    residue_bonds[resname].append(\n        Bond(atom1, atom2, float(length), float(stddev)))\n  residue_bonds['UNK'] = []\n\n  # Load bond angles.\n  residue_bond_angles = {}\n  next(lines_iter)  # Skip empty line.\n  next(lines_iter)  # Skip header line.\n  for line in lines_iter:\n    if line.strip() == '-':\n      break\n    bond, resname, angle_degree, stddev_degree = line.split()\n    atom1, atom2, atom3 = bond.split('-')\n    if resname not in residue_bond_angles:\n      residue_bond_angles[resname] = []\n    residue_bond_angles[resname].append(\n        BondAngle(atom1, atom2, atom3,\n                  float(angle_degree) / 180. * np.pi,\n                  float(stddev_degree) / 180. * np.pi))\n  residue_bond_angles['UNK'] = []\n\n  def make_bond_key(atom1_name, atom2_name):\n    \"\"\"Unique key to lookup bonds.\"\"\"\n    return '-'.join(sorted([atom1_name, atom2_name]))\n\n  # Translate bond angles into distances (\"virtual bonds\").\n  residue_virtual_bonds = {}\n  for resname, bond_angles in residue_bond_angles.items():\n    # Create a fast lookup dict for bond lengths.\n    bond_cache = {}\n    for b in residue_bonds[resname]:\n      bond_cache[make_bond_key(b.atom1_name, b.atom2_name)] = b\n    residue_virtual_bonds[resname] = []\n    for ba in bond_angles:\n      bond1 = bond_cache[make_bond_key(ba.atom1_name, ba.atom2_name)]\n      bond2 = bond_cache[make_bond_key(ba.atom2_name, ba.atom3name)]\n\n      # Compute distance between atom1 and atom3 using the law of cosines\n      # c^2 = a^2 + b^2 - 2ab*cos(gamma).\n      gamma = ba.angle_rad\n      length = np.sqrt(bond1.length**2 + bond2.length**2\n                       - 2 * bond1.length * bond2.length * np.cos(gamma))\n\n      # Propagation of uncertainty assuming uncorrelated errors.\n      dl_outer = 0.5 / length\n      dl_dgamma = (2 * bond1.length * bond2.length * np.sin(gamma)) * dl_outer\n      dl_db1 = (2 * bond1.length - 2 * bond2.length * np.cos(gamma)) * dl_outer\n      dl_db2 = (2 * bond2.length - 2 * bond1.length * np.cos(gamma)) * dl_outer\n      stddev = np.sqrt((dl_dgamma * ba.stddev)**2 +\n                       (dl_db1 * bond1.stddev)**2 +\n                       (dl_db2 * bond2.stddev)**2)\n      residue_virtual_bonds[resname].append(\n          Bond(ba.atom1_name, ba.atom3name, length, stddev))\n\n  return (residue_bonds,\n          residue_virtual_bonds,\n          residue_bond_angles)\n\n\n# Between-residue bond lengths for general bonds (first element) and for Proline\n# (second element).\nbetween_res_bond_length_c_n = [1.329, 1.341]\nbetween_res_bond_length_stddev_c_n = [0.014, 0.016]\n\n# Between-residue cos_angles.\nbetween_res_cos_angles_c_n_ca = [-0.5203, 0.0353]  # degrees: 121.352 +- 2.315\nbetween_res_cos_angles_ca_c_n = [-0.4473, 0.0311]  # degrees: 116.568 +- 1.995\n\n# This mapping is used when we need to store atom data in a format that requires\n# fixed atom data size for every residue (e.g. a numpy array).\natom_types = [\n    'N', 'CA', 'C', 'CB', 'O', 'CG', 'CG1', 'CG2', 'OG', 'OG1', 'SG', 'CD',\n    'CD1', 'CD2', 'ND1', 'ND2', 'OD1', 'OD2', 'SD', 'CE', 'CE1', 'CE2', 'CE3',\n    'NE', 'NE1', 'NE2', 'OE1', 'OE2', 'CH2', 'NH1', 'NH2', 'OH', 'CZ', 'CZ2',\n    'CZ3', 'NZ', 'OXT'\n]\natom_order = {atom_type: i for i, atom_type in enumerate(atom_types)}\natom_type_num = len(atom_types)  # := 37.\n\n# A compact atom encoding with 14 columns\n# pylint: disable=line-too-long\n# pylint: disable=bad-whitespace\nrestype_name_to_atom14_names = {\n    'ALA': ['N', 'CA', 'C', 'O', 'CB', '',    '',    '',    '',    '',    '',    '',    '',    ''],\n    'ARG': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD',  'NE',  'CZ',  'NH1', 'NH2', '',    '',    ''],\n    'ASN': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'OD1', 'ND2', '',    '',    '',    '',    '',    ''],\n    'ASP': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'OD1', 'OD2', '',    '',    '',    '',    '',    ''],\n    'CYS': ['N', 'CA', 'C', 'O', 'CB', 'SG',  '',    '',    '',    '',    '',    '',    '',    ''],\n    'GLN': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD',  'OE1', 'NE2', '',    '',    '',    '',    ''],\n    'GLU': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD',  'OE1', 'OE2', '',    '',    '',    '',    ''],\n    'GLY': ['N', 'CA', 'C', 'O', '',   '',    '',    '',    '',    '',    '',    '',    '',    ''],\n    'HIS': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'ND1', 'CD2', 'CE1', 'NE2', '',    '',    '',    ''],\n    'ILE': ['N', 'CA', 'C', 'O', 'CB', 'CG1', 'CG2', 'CD1', '',    '',    '',    '',    '',    ''],\n    'LEU': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD1', 'CD2', '',    '',    '',    '',    '',    ''],\n    'LYS': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD',  'CE',  'NZ',  '',    '',    '',    '',    ''],\n    'MET': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'SD',  'CE',  '',    '',    '',    '',    '',    ''],\n    'PHE': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD1', 'CD2', 'CE1', 'CE2', 'CZ',  '',    '',    ''],\n    'PRO': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD',  '',    '',    '',    '',    '',    '',    ''],\n    'SER': ['N', 'CA', 'C', 'O', 'CB', 'OG',  '',    '',    '',    '',    '',    '',    '',    ''],\n    'THR': ['N', 'CA', 'C', 'O', 'CB', 'OG1', 'CG2', '',    '',    '',    '',    '',    '',    ''],\n    'TRP': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD1', 'CD2', 'NE1', 'CE2', 'CE3', 'CZ2', 'CZ3', 'CH2'],\n    'TYR': ['N', 'CA', 'C', 'O', 'CB', 'CG',  'CD1', 'CD2', 'CE1', 'CE2', 'CZ',  'OH',  '',    ''],\n    'VAL': ['N', 'CA', 'C', 'O', 'CB', 'CG1', 'CG2', '',    '',    '',    '',    '',    '',    ''],\n    'UNK': ['',  '',   '',  '',  '',   '',    '',    '',    '',    '',    '',    '',    '',    ''],\n\n}\n# pylint: enable=line-too-long\n# pylint: enable=bad-whitespace\n\n\n# This is the standard residue order when coding AA type as a number.\n# Reproduce it by taking 3-letter AA codes and sorting them alphabetically.\nrestypes = [\n    'A', 'R', 'N', 'D', 'C', 'Q', 'E', 'G', 'H', 'I', 'L', 'K', 'M', 'F', 'P',\n    'S', 'T', 'W', 'Y', 'V'\n]\nrestype_order = {restype: i for i, restype in enumerate(restypes)}\nrestype_num = len(restypes)  # := 20.\nunk_restype_index = restype_num  # Catch-all index for unknown restypes.\n\nrestypes_with_x = restypes + ['X']\nrestype_order_with_x = {restype: i for i, restype in enumerate(restypes_with_x)}\n\n\ndef sequence_to_onehot(\n    sequence: str,\n    mapping: Mapping[str, int],\n    map_unknown_to_x: bool = False) -> np.ndarray:\n  \"\"\"Maps the given sequence into a one-hot encoded matrix.\n\n  Args:\n    sequence: An amino acid sequence.\n    mapping: A dictionary mapping amino acids to integers.\n    map_unknown_to_x: If True, any amino acid that is not in the mapping will be\n      mapped to the unknown amino acid 'X'. If the mapping doesn't contain\n      amino acid 'X', an error will be thrown. If False, any amino acid not in\n      the mapping will throw an error.\n\n  Returns:\n    A numpy array of shape (seq_len, num_unique_aas) with one-hot encoding of\n    the sequence.\n\n  Raises:\n    ValueError: If the mapping doesn't contain values from 0 to\n      num_unique_aas - 1 without any gaps.\n  \"\"\"\n  num_entries = max(mapping.values()) + 1\n\n  if sorted(set(mapping.values())) != list(range(num_entries)):\n    raise ValueError('The mapping must have values from 0 to num_unique_aas-1 '\n                     'without any gaps. Got: %s' % sorted(mapping.values()))\n\n  one_hot_arr = np.zeros((len(sequence), num_entries), dtype=np.int32)\n\n  for aa_index, aa_type in enumerate(sequence):\n    if map_unknown_to_x:\n      if aa_type.isalpha() and aa_type.isupper():\n        aa_id = mapping.get(aa_type, mapping['X'])\n      else:\n        raise ValueError(f'Invalid character in the sequence: {aa_type}')\n    else:\n      aa_id = mapping[aa_type]\n    one_hot_arr[aa_index, aa_id] = 1\n\n  return one_hot_arr\n\n\nrestype_1to3 = {\n    'A': 'ALA',\n    'R': 'ARG',\n    'N': 'ASN',\n    'D': 'ASP',\n    'C': 'CYS',\n    'Q': 'GLN',\n    'E': 'GLU',\n    'G': 'GLY',\n    'H': 'HIS',\n    'I': 'ILE',\n    'L': 'LEU',\n    'K': 'LYS',\n    'M': 'MET',\n    'F': 'PHE',\n    'P': 'PRO',\n    'S': 'SER',\n    'T': 'THR',\n    'W': 'TRP',\n    'Y': 'TYR',\n    'V': 'VAL',\n}\n\n\n# NB: restype_3to1 differs from Bio.PDB.protein_letters_3to1 by being a simple\n# 1-to-1 mapping of 3 letter names to one letter names. The latter contains\n# many more, and less common, three letter names as keys and maps many of these\n# to the same one letter name (including 'X' and 'U' which we don't use here).\nrestype_3to1 = {v: k for k, v in restype_1to3.items()}\n\n# Define a restype name for all unknown residues.\nunk_restype = 'UNK'\n\nresnames = [restype_1to3[r] for r in restypes] + [unk_restype]\nresname_to_idx = {resname: i for i, resname in enumerate(resnames)}\n\n\n# The mapping here uses hhblits convention, so that B is mapped to D, J and O\n# are mapped to X, U is mapped to C, and Z is mapped to E. Other than that the\n# remaining 20 amino acids are kept in alphabetical order.\n# There are 2 non-amino acid codes, X (representing any amino acid) and\n# \"-\" representing a missing amino acid in an alignment.  The id for these\n# codes is put at the end (20 and 21) so that they can easily be ignored if\n# desired.\nHHBLITS_AA_TO_ID = {\n    'A': 0,\n    'B': 2,\n    'C': 1,\n    'D': 2,\n    'E': 3,\n    'F': 4,\n    'G': 5,\n    'H': 6,\n    'I': 7,\n    'J': 20,\n    'K': 8,\n    'L': 9,\n    'M': 10,\n    'N': 11,\n    'O': 20,\n    'P': 12,\n    'Q': 13,\n    'R': 14,\n    'S': 15,\n    'T': 16,\n    'U': 1,\n    'V': 17,\n    'W': 18,\n    'X': 20,\n    'Y': 19,\n    'Z': 3,\n    '-': 21,\n}\n\n# Partial inversion of HHBLITS_AA_TO_ID.\nID_TO_HHBLITS_AA = {\n    0: 'A',\n    1: 'C',  # Also U.\n    2: 'D',  # Also B.\n    3: 'E',  # Also Z.\n    4: 'F',\n    5: 'G',\n    6: 'H',\n    7: 'I',\n    8: 'K',\n    9: 'L',\n    10: 'M',\n    11: 'N',\n    12: 'P',\n    13: 'Q',\n    14: 'R',\n    15: 'S',\n    16: 'T',\n    17: 'V',\n    18: 'W',\n    19: 'Y',\n    20: 'X',  # Includes J and O.\n    21: '-',\n}\n\nrestypes_with_x_and_gap = restypes + ['X', '-']\nMAP_HHBLITS_AATYPE_TO_OUR_AATYPE = tuple(\n    restypes_with_x_and_gap.index(ID_TO_HHBLITS_AA[i])\n    for i in range(len(restypes_with_x_and_gap)))\n\n\ndef _make_standard_atom_mask() -> np.ndarray:\n  \"\"\"Returns [num_res_types, num_atom_types] mask array.\"\"\"\n  # +1 to account for unknown (all 0s).\n  mask = np.zeros([restype_num + 1, atom_type_num], dtype=np.int32)\n  for restype, restype_letter in enumerate(restypes):\n    restype_name = restype_1to3[restype_letter]\n    atom_names = residue_atoms[restype_name]\n    for atom_name in atom_names:\n      atom_type = atom_order[atom_name]\n      mask[restype, atom_type] = 1\n  return mask\n\n\nSTANDARD_ATOM_MASK = _make_standard_atom_mask()\n\n\n# A one hot representation for the first and second atoms defining the axis\n# of rotation for each chi-angle in each residue.\ndef chi_angle_atom(atom_index: int) -> np.ndarray:\n  \"\"\"Define chi-angle rigid groups via one-hot representations.\"\"\"\n  chi_angles_index = {}\n  one_hots = []\n\n  for k, v in chi_angles_atoms.items():\n    indices = [atom_types.index(s[atom_index]) for s in v]\n    indices.extend([-1]*(4-len(indices)))\n    chi_angles_index[k] = indices\n\n  for r in restypes:\n    res3 = restype_1to3[r]\n    one_hot = np.eye(atom_type_num)[chi_angles_index[res3]]\n    one_hots.append(one_hot)\n\n  one_hots.append(np.zeros([4, atom_type_num]))  # Add zeros for residue `X`.\n  one_hot = np.stack(one_hots, axis=0)\n  one_hot = np.transpose(one_hot, [0, 2, 1])\n\n  return one_hot\n\nchi_atom_1_one_hot = chi_angle_atom(1)\nchi_atom_2_one_hot = chi_angle_atom(2)\n\n# An array like chi_angles_atoms but using indices rather than names.\nchi_angles_atom_indices = [chi_angles_atoms[restype_1to3[r]] for r in restypes]\nchi_angles_atom_indices = tree.map_structure(\n    lambda atom_name: atom_order[atom_name], chi_angles_atom_indices)\nchi_angles_atom_indices = np.array([\n    chi_atoms + ([[0, 0, 0, 0]] * (4 - len(chi_atoms)))\n    for chi_atoms in chi_angles_atom_indices])\n\n# Mapping from (res_name, atom_name) pairs to the atom's chi group index\n# and atom index within that group.\nchi_groups_for_atom = collections.defaultdict(list)\nfor res_name, chi_angle_atoms_for_res in chi_angles_atoms.items():\n  for chi_group_i, chi_group in enumerate(chi_angle_atoms_for_res):\n    for atom_i, atom in enumerate(chi_group):\n      chi_groups_for_atom[(res_name, atom)].append((chi_group_i, atom_i))\nchi_groups_for_atom = dict(chi_groups_for_atom)\n\n\ndef _make_rigid_transformation_4x4(ex, ey, translation):\n  \"\"\"Create a rigid 4x4 transformation matrix from two axes and transl.\"\"\"\n  # Normalize ex.\n  ex_normalized = ex / np.linalg.norm(ex)\n\n  # make ey perpendicular to ex\n  ey_normalized = ey - np.dot(ey, ex_normalized) * ex_normalized\n  ey_normalized /= np.linalg.norm(ey_normalized)\n\n  # compute ez as cross product\n  eznorm = np.cross(ex_normalized, ey_normalized)\n  m = np.stack([ex_normalized, ey_normalized, eznorm, translation]).transpose()\n  m = np.concatenate([m, [[0., 0., 0., 1.]]], axis=0)\n  return m\n\n\n# create an array with (restype, atomtype) --> rigid_group_idx\n# and an array with (restype, atomtype, coord) for the atom positions\n# and compute affine transformation matrices (4,4) from one rigid group to the\n# previous group\nrestype_atom37_to_rigid_group = np.zeros([21, 37], dtype=int)\nrestype_atom37_mask = np.zeros([21, 37], dtype=np.float32)\nrestype_atom37_rigid_group_positions = np.zeros([21, 37, 3], dtype=np.float32)\nrestype_atom14_to_rigid_group = np.zeros([21, 14], dtype=int)\nrestype_atom14_mask = np.zeros([21, 14], dtype=np.float32)\nrestype_atom14_rigid_group_positions = np.zeros([21, 14, 3], dtype=np.float32)\nrestype_rigid_group_default_frame = np.zeros([21, 8, 4, 4], dtype=np.float32)\n\n\ndef _make_rigid_group_constants():\n  \"\"\"Fill the arrays above.\"\"\"\n  for restype, restype_letter in enumerate(restypes):\n    resname = restype_1to3[restype_letter]\n    for atomname, group_idx, atom_position in rigid_group_atom_positions[\n        resname]:\n      atomtype = atom_order[atomname]\n      restype_atom37_to_rigid_group[restype, atomtype] = group_idx\n      restype_atom37_mask[restype, atomtype] = 1\n      restype_atom37_rigid_group_positions[restype, atomtype, :] = atom_position\n\n      atom14idx = restype_name_to_atom14_names[resname].index(atomname)\n      restype_atom14_to_rigid_group[restype, atom14idx] = group_idx\n      restype_atom14_mask[restype, atom14idx] = 1\n      restype_atom14_rigid_group_positions[restype,\n                                           atom14idx, :] = atom_position\n\n  for restype, restype_letter in enumerate(restypes):\n    resname = restype_1to3[restype_letter]\n    atom_positions = {name: np.array(pos) for name, _, pos\n                      in rigid_group_atom_positions[resname]}\n\n    # backbone to backbone is the identity transform\n    restype_rigid_group_default_frame[restype, 0, :, :] = np.eye(4)\n\n    # pre-omega-frame to backbone (currently dummy identity matrix)\n    restype_rigid_group_default_frame[restype, 1, :, :] = np.eye(4)\n\n    # phi-frame to backbone\n    mat = _make_rigid_transformation_4x4(\n        ex=atom_positions['N'] - atom_positions['CA'],\n        ey=np.array([1., 0., 0.]),\n        translation=atom_positions['N'])\n    restype_rigid_group_default_frame[restype, 2, :, :] = mat\n\n    # psi-frame to backbone\n    mat = _make_rigid_transformation_4x4(\n        ex=atom_positions['C'] - atom_positions['CA'],\n        ey=atom_positions['CA'] - atom_positions['N'],\n        translation=atom_positions['C'])\n    restype_rigid_group_default_frame[restype, 3, :, :] = mat\n\n    # chi1-frame to backbone\n    if chi_angles_mask[restype][0]:\n      base_atom_names = chi_angles_atoms[resname][0]\n      base_atom_positions = [atom_positions[name] for name in base_atom_names]\n      mat = _make_rigid_transformation_4x4(\n          ex=base_atom_positions[2] - base_atom_positions[1],\n          ey=base_atom_positions[0] - base_atom_positions[1],\n          translation=base_atom_positions[2])\n      restype_rigid_group_default_frame[restype, 4, :, :] = mat\n\n    # chi2-frame to chi1-frame\n    # chi3-frame to chi2-frame\n    # chi4-frame to chi3-frame\n    # luckily all rotation axes for the next frame start at (0,0,0) of the\n    # previous frame\n    for chi_idx in range(1, 4):\n      if chi_angles_mask[restype][chi_idx]:\n        axis_end_atom_name = chi_angles_atoms[resname][chi_idx][2]\n        axis_end_atom_position = atom_positions[axis_end_atom_name]\n        mat = _make_rigid_transformation_4x4(\n            ex=axis_end_atom_position,\n            ey=np.array([-1., 0., 0.]),\n            translation=axis_end_atom_position)\n        restype_rigid_group_default_frame[restype, 4 + chi_idx, :, :] = mat\n\n\n_make_rigid_group_constants()\n\n\ndef make_atom14_dists_bounds(overlap_tolerance=1.5,\n                             bond_length_tolerance_factor=15):\n  \"\"\"compute upper and lower bounds for bonds to assess violations.\"\"\"\n  restype_atom14_bond_lower_bound = np.zeros([21, 14, 14], np.float32)\n  restype_atom14_bond_upper_bound = np.zeros([21, 14, 14], np.float32)\n  restype_atom14_bond_stddev = np.zeros([21, 14, 14], np.float32)\n  residue_bonds, residue_virtual_bonds, _ = load_stereo_chemical_props()\n  for restype, restype_letter in enumerate(restypes):\n    resname = restype_1to3[restype_letter]\n    atom_list = restype_name_to_atom14_names[resname]\n\n    # create lower and upper bounds for clashes\n    for atom1_idx, atom1_name in enumerate(atom_list):\n      if not atom1_name:\n        continue\n      atom1_radius = van_der_waals_radius[atom1_name[0]]\n      for atom2_idx, atom2_name in enumerate(atom_list):\n        if (not atom2_name) or atom1_idx == atom2_idx:\n          continue\n        atom2_radius = van_der_waals_radius[atom2_name[0]]\n        lower = atom1_radius + atom2_radius - overlap_tolerance\n        upper = 1e10\n        restype_atom14_bond_lower_bound[restype, atom1_idx, atom2_idx] = lower\n        restype_atom14_bond_lower_bound[restype, atom2_idx, atom1_idx] = lower\n        restype_atom14_bond_upper_bound[restype, atom1_idx, atom2_idx] = upper\n        restype_atom14_bond_upper_bound[restype, atom2_idx, atom1_idx] = upper\n\n    # overwrite lower and upper bounds for bonds and angles\n    for b in residue_bonds[resname] + residue_virtual_bonds[resname]:\n      atom1_idx = atom_list.index(b.atom1_name)\n      atom2_idx = atom_list.index(b.atom2_name)\n      lower = b.length - bond_length_tolerance_factor * b.stddev\n      upper = b.length + bond_length_tolerance_factor * b.stddev\n      restype_atom14_bond_lower_bound[restype, atom1_idx, atom2_idx] = lower\n      restype_atom14_bond_lower_bound[restype, atom2_idx, atom1_idx] = lower\n      restype_atom14_bond_upper_bound[restype, atom1_idx, atom2_idx] = upper\n      restype_atom14_bond_upper_bound[restype, atom2_idx, atom1_idx] = upper\n      restype_atom14_bond_stddev[restype, atom1_idx, atom2_idx] = b.stddev\n      restype_atom14_bond_stddev[restype, atom2_idx, atom1_idx] = b.stddev\n  return {'lower_bound': restype_atom14_bond_lower_bound,  # shape (21,14,14)\n          'upper_bound': restype_atom14_bond_upper_bound,  # shape (21,14,14)\n          'stddev': restype_atom14_bond_stddev,  # shape (21,14,14)\n         }\n"
  },
  {
    "path": "alphafold/common/residue_constants_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Test that residue_constants generates correct values.\"\"\"\n\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.common import residue_constants\nimport numpy as np\n\n\nclass ResidueConstantsTest(parameterized.TestCase):\n\n  @parameterized.parameters(\n      ('ALA', 0),\n      ('CYS', 1),\n      ('HIS', 2),\n      ('MET', 3),\n      ('LYS', 4),\n      ('ARG', 4),\n  )\n  def testChiAnglesAtoms(self, residue_name, chi_num):\n    chi_angles_atoms = residue_constants.chi_angles_atoms[residue_name]\n    self.assertLen(chi_angles_atoms, chi_num)\n    for chi_angle_atoms in chi_angles_atoms:\n      self.assertLen(chi_angle_atoms, 4)\n\n  def testChiGroupsForAtom(self):\n    for k, chi_groups in residue_constants.chi_groups_for_atom.items():\n      res_name, atom_name = k\n      for chi_group_i, atom_i in chi_groups:\n        self.assertEqual(\n            atom_name,\n            residue_constants.chi_angles_atoms[res_name][chi_group_i][atom_i])\n\n  @parameterized.parameters(\n      ('ALA', 5), ('ARG', 11), ('ASN', 8), ('ASP', 8), ('CYS', 6), ('GLN', 9),\n      ('GLU', 9), ('GLY', 4), ('HIS', 10), ('ILE', 8), ('LEU', 8), ('LYS', 9),\n      ('MET', 8), ('PHE', 11), ('PRO', 7), ('SER', 6), ('THR', 7), ('TRP', 14),\n      ('TYR', 12), ('VAL', 7)\n  )\n  def testResidueAtoms(self, atom_name, num_residue_atoms):\n    residue_atoms = residue_constants.residue_atoms[atom_name]\n    self.assertLen(residue_atoms, num_residue_atoms)\n\n  def testStandardAtomMask(self):\n    with self.subTest('Check shape'):\n      self.assertEqual(residue_constants.STANDARD_ATOM_MASK.shape, (21, 37,))\n\n    with self.subTest('Check values'):\n      str_to_row = lambda s: [c == '1' for c in s]  # More clear/concise.\n      np.testing.assert_array_equal(\n          residue_constants.STANDARD_ATOM_MASK,\n          np.array([\n              # NB This was defined by c+p but looks sane.\n              str_to_row('11111                                '),  # ALA\n              str_to_row('111111     1           1     11 1    '),  # ARG\n              str_to_row('111111         11                    '),  # ASP\n              str_to_row('111111          11                   '),  # ASN\n              str_to_row('11111     1                          '),  # CYS\n              str_to_row('111111     1             11          '),  # GLU\n              str_to_row('111111     1              11         '),  # GLN\n              str_to_row('111 1                                '),  # GLY\n              str_to_row('111111       11     1    1           '),  # HIS\n              str_to_row('11111 11    1                        '),  # ILE\n              str_to_row('111111      11                       '),  # LEU\n              str_to_row('111111     1       1               1 '),  # LYS\n              str_to_row('111111            11                 '),  # MET\n              str_to_row('111111      11      11          1    '),  # PHE\n              str_to_row('111111     1                         '),  # PRO\n              str_to_row('11111   1                            '),  # SER\n              str_to_row('11111  1 1                           '),  # THR\n              str_to_row('111111      11       11 1   1    11  '),  # TRP\n              str_to_row('111111      11      11         11    '),  # TYR\n              str_to_row('11111 11                             '),  # VAL\n              str_to_row('                                     '),  # UNK\n          ]))\n\n    with self.subTest('Check row totals'):\n      # Check each row has the right number of atoms.\n      for row, restype in enumerate(residue_constants.restypes):  # A, R, ...\n        long_restype = residue_constants.restype_1to3[restype]  # ALA, ARG, ...\n        atoms_names = residue_constants.residue_atoms[\n            long_restype]  # ['C', 'CA', 'CB', 'N', 'O'], ...\n        self.assertLen(atoms_names,\n                       residue_constants.STANDARD_ATOM_MASK[row, :].sum(),\n                       long_restype)\n\n  def testAtomTypes(self):\n    self.assertEqual(residue_constants.atom_type_num, 37)\n\n    self.assertEqual(residue_constants.atom_types[0], 'N')\n    self.assertEqual(residue_constants.atom_types[1], 'CA')\n    self.assertEqual(residue_constants.atom_types[2], 'C')\n    self.assertEqual(residue_constants.atom_types[3], 'CB')\n    self.assertEqual(residue_constants.atom_types[4], 'O')\n\n    self.assertEqual(residue_constants.atom_order['N'], 0)\n    self.assertEqual(residue_constants.atom_order['CA'], 1)\n    self.assertEqual(residue_constants.atom_order['C'], 2)\n    self.assertEqual(residue_constants.atom_order['CB'], 3)\n    self.assertEqual(residue_constants.atom_order['O'], 4)\n    self.assertEqual(residue_constants.atom_type_num, 37)\n\n  def testRestypes(self):\n    three_letter_restypes = [\n        residue_constants.restype_1to3[r] for r  in residue_constants.restypes]\n    for restype, exp_restype in zip(\n        three_letter_restypes, sorted(residue_constants.restype_1to3.values())):\n      self.assertEqual(restype, exp_restype)\n    self.assertEqual(residue_constants.restype_num, 20)\n\n  def testSequenceToOneHotHHBlits(self):\n    one_hot = residue_constants.sequence_to_onehot(\n        'ABCDEFGHIJKLMNOPQRSTUVWXYZ-', residue_constants.HHBLITS_AA_TO_ID)\n    exp_one_hot = np.array(\n        [[1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0],\n         [0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0],\n         [0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0],\n         [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1]])\n    np.testing.assert_array_equal(one_hot, exp_one_hot)\n\n  def testSequenceToOneHotStandard(self):\n    one_hot = residue_constants.sequence_to_onehot(\n        'ARNDCQEGHILKMFPSTWYV', residue_constants.restype_order)\n    np.testing.assert_array_equal(one_hot, np.eye(20))\n\n  def testSequenceToOneHotUnknownMapping(self):\n    seq = 'ABCDEFGHIJKLMNOPQRSTUVWXYZ'\n    expected_out = np.zeros([26, 21])\n    for row, position in enumerate(\n        [0, 20, 4, 3, 6, 13, 7, 8, 9, 20, 11, 10, 12, 2, 20, 14, 5, 1, 15, 16,\n         20, 19, 17, 20, 18, 20]):\n      expected_out[row, position] = 1\n    aa_types = residue_constants.sequence_to_onehot(\n        sequence=seq,\n        mapping=residue_constants.restype_order_with_x,\n        map_unknown_to_x=True)\n    self.assertTrue((aa_types == expected_out).all())\n\n  @parameterized.named_parameters(\n      ('lowercase', 'aaa'),  # Insertions in A3M.\n      ('gaps', '---'),  # Gaps in A3M.\n      ('dots', '...'),  # Gaps in A3M.\n      ('metadata', '>TEST'),  # FASTA metadata line.\n  )\n  def testSequenceToOneHotUnknownMappingError(self, seq):\n    with self.assertRaises(ValueError):\n      residue_constants.sequence_to_onehot(\n          sequence=seq,\n          mapping=residue_constants.restype_order_with_x,\n          map_unknown_to_x=True)\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/common/stereo_chemical_props.txt",
    "content": "Bond\t\t\tResidue\t\tMean\t\tStdDev\nCA-CB\t\t\tALA\t\t1.520\t\t0.021\nN-CA\t\t\tALA\t\t1.459\t\t0.020\nCA-C\t\t\tALA\t\t1.525\t\t0.026\nC-O\t\t\tALA\t\t1.229\t\t0.019\nCA-CB\t\t\tARG\t\t1.535\t\t0.022\nCB-CG\t\t\tARG\t\t1.521\t\t0.027\nCG-CD\t\t\tARG\t\t1.515\t\t0.025\nCD-NE\t\t\tARG\t\t1.460\t\t0.017\nNE-CZ\t\t\tARG\t\t1.326\t\t0.013\nCZ-NH1\t\t\tARG\t\t1.326\t\t0.013\nCZ-NH2\t\t\tARG\t\t1.326\t\t0.013\nN-CA\t\t\tARG\t\t1.459\t\t0.020\nCA-C\t\t\tARG\t\t1.525\t\t0.026\nC-O\t\t\tARG\t\t1.229\t\t0.019\nCA-CB\t\t\tASN\t\t1.527\t\t0.026\nCB-CG\t\t\tASN\t\t1.506\t\t0.023\nCG-OD1\t\t\tASN\t\t1.235\t\t0.022\nCG-ND2\t\t\tASN\t\t1.324\t\t0.025\nN-CA\t\t\tASN\t\t1.459\t\t0.020\nCA-C\t\t\tASN\t\t1.525\t\t0.026\nC-O\t\t\tASN\t\t1.229\t\t0.019\nCA-CB\t\t\tASP\t\t1.535\t\t0.022\nCB-CG\t\t\tASP\t\t1.513\t\t0.021\nCG-OD1\t\t\tASP\t\t1.249\t\t0.023\nCG-OD2\t\t\tASP\t\t1.249\t\t0.023\nN-CA\t\t\tASP\t\t1.459\t\t0.020\nCA-C\t\t\tASP\t\t1.525\t\t0.026\nC-O\t\t\tASP\t\t1.229\t\t0.019\nCA-CB\t\t\tCYS\t\t1.526\t\t0.013\nCB-SG\t\t\tCYS\t\t1.812\t\t0.016\nN-CA\t\t\tCYS\t\t1.459\t\t0.020\nCA-C\t\t\tCYS\t\t1.525\t\t0.026\nC-O\t\t\tCYS\t\t1.229\t\t0.019\nCA-CB\t\t\tGLU\t\t1.535\t\t0.022\nCB-CG\t\t\tGLU\t\t1.517\t\t0.019\nCG-CD\t\t\tGLU\t\t1.515\t\t0.015\nCD-OE1\t\t\tGLU\t\t1.252\t\t0.011\nCD-OE2\t\t\tGLU\t\t1.252\t\t0.011\nN-CA\t\t\tGLU\t\t1.459\t\t0.020\nCA-C\t\t\tGLU\t\t1.525\t\t0.026\nC-O\t\t\tGLU\t\t1.229\t\t0.019\nCA-CB\t\t\tGLN\t\t1.535\t\t0.022\nCB-CG\t\t\tGLN\t\t1.521\t\t0.027\nCG-CD\t\t\tGLN\t\t1.506\t\t0.023\nCD-OE1\t\t\tGLN\t\t1.235\t\t0.022\nCD-NE2\t\t\tGLN\t\t1.324\t\t0.025\nN-CA\t\t\tGLN\t\t1.459\t\t0.020\nCA-C\t\t\tGLN\t\t1.525\t\t0.026\nC-O\t\t\tGLN\t\t1.229\t\t0.019\nN-CA\t\t\tGLY\t\t1.456\t\t0.015\nCA-C\t\t\tGLY\t\t1.514\t\t0.016\nC-O\t\t\tGLY\t\t1.232\t\t0.016\nCA-CB\t\t\tHIS\t\t1.535\t\t0.022\nCB-CG\t\t\tHIS\t\t1.492\t\t0.016\nCG-ND1\t\t\tHIS\t\t1.369\t\t0.015\nCG-CD2\t\t\tHIS\t\t1.353\t\t0.017\nND1-CE1\t\t\tHIS\t\t1.343\t\t0.025\nCD2-NE2\t\t\tHIS\t\t1.415\t\t0.021\nCE1-NE2\t\t\tHIS\t\t1.322\t\t0.023\nN-CA\t\t\tHIS\t\t1.459\t\t0.020\nCA-C\t\t\tHIS\t\t1.525\t\t0.026\nC-O\t\t\tHIS\t\t1.229\t\t0.019\nCA-CB\t\t\tILE\t\t1.544\t\t0.023\nCB-CG1\t\t\tILE\t\t1.536\t\t0.028\nCB-CG2\t\t\tILE\t\t1.524\t\t0.031\nCG1-CD1\t\t\tILE\t\t1.500\t\t0.069\nN-CA\t\t\tILE\t\t1.459\t\t0.020\nCA-C\t\t\tILE\t\t1.525\t\t0.026\nC-O\t\t\tILE\t\t1.229\t\t0.019\nCA-CB\t\t\tLEU\t\t1.533\t\t0.023\nCB-CG\t\t\tLEU\t\t1.521\t\t0.029\nCG-CD1\t\t\tLEU\t\t1.514\t\t0.037\nCG-CD2\t\t\tLEU\t\t1.514\t\t0.037\nN-CA\t\t\tLEU\t\t1.459\t\t0.020\nCA-C\t\t\tLEU\t\t1.525\t\t0.026\nC-O\t\t\tLEU\t\t1.229\t\t0.019\nCA-CB\t\t\tLYS\t\t1.535\t\t0.022\nCB-CG\t\t\tLYS\t\t1.521\t\t0.027\nCG-CD\t\t\tLYS\t\t1.520\t\t0.034\nCD-CE\t\t\tLYS\t\t1.508\t\t0.025\nCE-NZ\t\t\tLYS\t\t1.486\t\t0.025\nN-CA\t\t\tLYS\t\t1.459\t\t0.020\nCA-C\t\t\tLYS\t\t1.525\t\t0.026\nC-O\t\t\tLYS\t\t1.229\t\t0.019\nCA-CB\t\t\tMET\t\t1.535\t\t0.022\nCB-CG\t\t\tMET\t\t1.509\t\t0.032\nCG-SD\t\t\tMET\t\t1.807\t\t0.026\nSD-CE\t\t\tMET\t\t1.774\t\t0.056\nN-CA\t\t\tMET\t\t1.459\t\t0.020\nCA-C\t\t\tMET\t\t1.525\t\t0.026\nC-O\t\t\tMET\t\t1.229\t\t0.019\nCA-CB\t\t\tPHE\t\t1.535\t\t0.022\nCB-CG\t\t\tPHE\t\t1.509\t\t0.017\nCG-CD1\t\t\tPHE\t\t1.383\t\t0.015\nCG-CD2\t\t\tPHE\t\t1.383\t\t0.015\nCD1-CE1\t\t\tPHE\t\t1.388\t\t0.020\nCD2-CE2\t\t\tPHE\t\t1.388\t\t0.020\nCE1-CZ\t\t\tPHE\t\t1.369\t\t0.019\nCE2-CZ\t\t\tPHE\t\t1.369\t\t0.019\nN-CA\t\t\tPHE\t\t1.459\t\t0.020\nCA-C\t\t\tPHE\t\t1.525\t\t0.026\nC-O\t\t\tPHE\t\t1.229\t\t0.019\nCA-CB\t\t\tPRO\t\t1.531\t\t0.020\nCB-CG\t\t\tPRO\t\t1.495\t\t0.050\nCG-CD\t\t\tPRO\t\t1.502\t\t0.033\nCD-N\t\t\tPRO\t\t1.474\t\t0.014\nN-CA\t\t\tPRO\t\t1.468\t\t0.017\nCA-C\t\t\tPRO\t\t1.524\t\t0.020\nC-O\t\t\tPRO\t\t1.228\t\t0.020\nCA-CB\t\t\tSER\t\t1.525\t\t0.015\nCB-OG\t\t\tSER\t\t1.418\t\t0.013\nN-CA\t\t\tSER\t\t1.459\t\t0.020\nCA-C\t\t\tSER\t\t1.525\t\t0.026\nC-O\t\t\tSER\t\t1.229\t\t0.019\nCA-CB\t\t\tTHR\t\t1.529\t\t0.026\nCB-OG1\t\t\tTHR\t\t1.428\t\t0.020\nCB-CG2\t\t\tTHR\t\t1.519\t\t0.033\nN-CA\t\t\tTHR\t\t1.459\t\t0.020\nCA-C\t\t\tTHR\t\t1.525\t\t0.026\nC-O\t\t\tTHR\t\t1.229\t\t0.019\nCA-CB\t\t\tTRP\t\t1.535\t\t0.022\nCB-CG\t\t\tTRP\t\t1.498\t\t0.018\nCG-CD1\t\t\tTRP\t\t1.363\t\t0.014\nCG-CD2\t\t\tTRP\t\t1.432\t\t0.017\nCD1-NE1\t\t\tTRP\t\t1.375\t\t0.017\nNE1-CE2\t\t\tTRP\t\t1.371\t\t0.013\nCD2-CE2\t\t\tTRP\t\t1.409\t\t0.012\nCD2-CE3\t\t\tTRP\t\t1.399\t\t0.015\nCE2-CZ2\t\t\tTRP\t\t1.393\t\t0.017\nCE3-CZ3\t\t\tTRP\t\t1.380\t\t0.017\nCZ2-CH2\t\t\tTRP\t\t1.369\t\t0.019\nCZ3-CH2\t\t\tTRP\t\t1.396\t\t0.016\nN-CA\t\t\tTRP\t\t1.459\t\t0.020\nCA-C\t\t\tTRP\t\t1.525\t\t0.026\nC-O\t\t\tTRP\t\t1.229\t\t0.019\nCA-CB\t\t\tTYR\t\t1.535\t\t0.022\nCB-CG\t\t\tTYR\t\t1.512\t\t0.015\nCG-CD1\t\t\tTYR\t\t1.387\t\t0.013\nCG-CD2\t\t\tTYR\t\t1.387\t\t0.013\nCD1-CE1\t\t\tTYR\t\t1.389\t\t0.015\nCD2-CE2\t\t\tTYR\t\t1.389\t\t0.015\nCE1-CZ\t\t\tTYR\t\t1.381\t\t0.013\nCE2-CZ\t\t\tTYR\t\t1.381\t\t0.013\nCZ-OH\t\t\tTYR\t\t1.374\t\t0.017\nN-CA\t\t\tTYR\t\t1.459\t\t0.020\nCA-C\t\t\tTYR\t\t1.525\t\t0.026\nC-O\t\t\tTYR\t\t1.229\t\t0.019\nCA-CB\t\t\tVAL\t\t1.543\t\t0.021\nCB-CG1\t\t\tVAL\t\t1.524\t\t0.021\nCB-CG2\t\t\tVAL\t\t1.524\t\t0.021\nN-CA\t\t\tVAL\t\t1.459\t\t0.020\nCA-C\t\t\tVAL\t\t1.525\t\t0.026\nC-O\t\t\tVAL\t\t1.229\t\t0.019\n-\n\nAngle\t\t\tResidue\t\tMean\t\tStdDev\nN-CA-CB\t\t\tALA\t\t110.1\t\t1.4\nCB-CA-C\t\t\tALA\t\t110.1\t\t1.5\nN-CA-C\t\t\tALA\t\t111.0\t\t2.7\nCA-C-O\t\t\tALA\t\t120.1\t\t2.1\nN-CA-CB\t\t\tARG\t\t110.6\t\t1.8\nCB-CA-C\t\t\tARG\t\t110.4\t\t2.0\nCA-CB-CG\t\tARG\t\t113.4\t\t2.2\nCB-CG-CD\t\tARG\t\t111.6\t\t2.6\nCG-CD-NE\t\tARG\t\t111.8\t\t2.1\nCD-NE-CZ\t\tARG\t\t123.6\t\t1.4\nNE-CZ-NH1\t\tARG\t\t120.3\t\t0.5\nNE-CZ-NH2\t\tARG\t\t120.3\t\t0.5\nNH1-CZ-NH2\t\tARG\t\t119.4\t\t1.1\nN-CA-C\t\t\tARG\t\t111.0\t\t2.7\nCA-C-O\t\t\tARG\t\t120.1\t\t2.1\nN-CA-CB\t\t\tASN\t\t110.6\t\t1.8\nCB-CA-C\t\t\tASN\t\t110.4\t\t2.0\nCA-CB-CG\t\tASN\t\t113.4\t\t2.2\nCB-CG-ND2\t\tASN\t\t116.7\t\t2.4\nCB-CG-OD1\t\tASN\t\t121.6\t\t2.0\nND2-CG-OD1\t\tASN\t\t121.9\t\t2.3\nN-CA-C\t\t\tASN\t\t111.0\t\t2.7\nCA-C-O\t\t\tASN\t\t120.1\t\t2.1\nN-CA-CB\t\t\tASP\t\t110.6\t\t1.8\nCB-CA-C\t\t\tASP\t\t110.4\t\t2.0\nCA-CB-CG\t\tASP\t\t113.4\t\t2.2\nCB-CG-OD1\t\tASP\t\t118.3\t\t0.9\nCB-CG-OD2\t\tASP\t\t118.3\t\t0.9\nOD1-CG-OD2\t\tASP\t\t123.3\t\t1.9\nN-CA-C\t\t\tASP\t\t111.0\t\t2.7\nCA-C-O\t\t\tASP\t\t120.1\t\t2.1\nN-CA-CB\t\t\tCYS\t\t110.8\t\t1.5\nCB-CA-C\t\t\tCYS\t\t111.5\t\t1.2\nCA-CB-SG\t\tCYS\t\t114.2\t\t1.1\nN-CA-C\t\t\tCYS\t\t111.0\t\t2.7\nCA-C-O\t\t\tCYS\t\t120.1\t\t2.1\nN-CA-CB\t\t\tGLU\t\t110.6\t\t1.8\nCB-CA-C\t\t\tGLU\t\t110.4\t\t2.0\nCA-CB-CG\t\tGLU\t\t113.4\t\t2.2\nCB-CG-CD\t\tGLU\t\t114.2\t\t2.7\nCG-CD-OE1\t\tGLU\t\t118.3\t\t2.0\nCG-CD-OE2\t\tGLU\t\t118.3\t\t2.0\nOE1-CD-OE2\t\tGLU\t\t123.3\t\t1.2\nN-CA-C\t\t\tGLU\t\t111.0\t\t2.7\nCA-C-O\t\t\tGLU\t\t120.1\t\t2.1\nN-CA-CB\t\t\tGLN\t\t110.6\t\t1.8\nCB-CA-C\t\t\tGLN\t\t110.4\t\t2.0\nCA-CB-CG\t\tGLN\t\t113.4\t\t2.2\nCB-CG-CD\t\tGLN\t\t111.6\t\t2.6\nCG-CD-OE1\t\tGLN\t\t121.6\t\t2.0\nCG-CD-NE2\t\tGLN\t\t116.7\t\t2.4\nOE1-CD-NE2\t\tGLN\t\t121.9\t\t2.3\nN-CA-C\t\t\tGLN\t\t111.0\t\t2.7\nCA-C-O\t\t\tGLN\t\t120.1\t\t2.1\nN-CA-C\t\t\tGLY\t\t113.1\t\t2.5\nCA-C-O\t\t\tGLY\t\t120.6\t\t1.8\nN-CA-CB\t\t\tHIS\t\t110.6\t\t1.8\nCB-CA-C\t\t\tHIS\t\t110.4\t\t2.0\nCA-CB-CG\t\tHIS\t\t113.6\t\t1.7\nCB-CG-ND1\t\tHIS\t\t123.2\t\t2.5\nCB-CG-CD2\t\tHIS\t\t130.8\t\t3.1\nCG-ND1-CE1\t\tHIS\t\t108.2\t\t1.4\nND1-CE1-NE2\t\tHIS\t\t109.9\t\t2.2\nCE1-NE2-CD2\t\tHIS\t\t106.6\t\t2.5\nNE2-CD2-CG\t\tHIS\t\t109.2\t\t1.9\nCD2-CG-ND1\t\tHIS\t\t106.0\t\t1.4\nN-CA-C\t\t\tHIS\t\t111.0\t\t2.7\nCA-C-O\t\t\tHIS\t\t120.1\t\t2.1\nN-CA-CB\t\t\tILE\t\t110.8\t\t2.3\nCB-CA-C\t\t\tILE\t\t111.6\t\t2.0\nCA-CB-CG1\t\tILE\t\t111.0\t\t1.9\nCB-CG1-CD1\t\tILE\t\t113.9\t\t2.8\nCA-CB-CG2\t\tILE\t\t110.9\t\t2.0\nCG1-CB-CG2\t\tILE\t\t111.4\t\t2.2\nN-CA-C\t\t\tILE\t\t111.0\t\t2.7\nCA-C-O\t\t\tILE\t\t120.1\t\t2.1\nN-CA-CB\t\t\tLEU\t\t110.4\t\t2.0\nCB-CA-C\t\t\tLEU\t\t110.2\t\t1.9\nCA-CB-CG\t\tLEU\t\t115.3\t\t2.3\nCB-CG-CD1\t\tLEU\t\t111.0\t\t1.7\nCB-CG-CD2\t\tLEU\t\t111.0\t\t1.7\nCD1-CG-CD2\t\tLEU\t\t110.5\t\t3.0\nN-CA-C\t\t\tLEU\t\t111.0\t\t2.7\nCA-C-O\t\t\tLEU\t\t120.1\t\t2.1\nN-CA-CB\t\t\tLYS\t\t110.6\t\t1.8\nCB-CA-C\t\t\tLYS\t\t110.4\t\t2.0\nCA-CB-CG\t\tLYS\t\t113.4\t\t2.2\nCB-CG-CD\t\tLYS\t\t111.6\t\t2.6\nCG-CD-CE\t\tLYS\t\t111.9\t\t3.0\nCD-CE-NZ\t\tLYS\t\t111.7\t\t2.3\nN-CA-C\t\t\tLYS\t\t111.0\t\t2.7\nCA-C-O\t\t\tLYS\t\t120.1\t\t2.1\nN-CA-CB\t\t\tMET\t\t110.6\t\t1.8\nCB-CA-C\t\t\tMET\t\t110.4\t\t2.0\nCA-CB-CG\t\tMET\t\t113.3\t\t1.7\nCB-CG-SD\t\tMET\t\t112.4\t\t3.0\nCG-SD-CE\t\tMET\t\t100.2\t\t1.6\nN-CA-C\t\t\tMET\t\t111.0\t\t2.7\nCA-C-O\t\t\tMET\t\t120.1\t\t2.1\nN-CA-CB\t\t\tPHE\t\t110.6\t\t1.8\nCB-CA-C\t\t\tPHE\t\t110.4\t\t2.0\nCA-CB-CG\t\tPHE\t\t113.9\t\t2.4\nCB-CG-CD1\t\tPHE\t\t120.8\t\t0.7\nCB-CG-CD2\t\tPHE\t\t120.8\t\t0.7\nCD1-CG-CD2\t\tPHE\t\t118.3\t\t1.3\nCG-CD1-CE1\t\tPHE\t\t120.8\t\t1.1\nCG-CD2-CE2\t\tPHE\t\t120.8\t\t1.1\nCD1-CE1-CZ\t\tPHE\t\t120.1\t\t1.2\nCD2-CE2-CZ\t\tPHE\t\t120.1\t\t1.2\nCE1-CZ-CE2\t\tPHE\t\t120.0\t\t1.8\nN-CA-C\t\t\tPHE\t\t111.0\t\t2.7\nCA-C-O\t\t\tPHE\t\t120.1\t\t2.1\nN-CA-CB\t\t\tPRO\t\t103.3\t\t1.2\nCB-CA-C\t\t\tPRO\t\t111.7\t\t2.1\nCA-CB-CG\t\tPRO\t\t104.8\t\t1.9\nCB-CG-CD\t\tPRO\t\t106.5\t\t3.9\nCG-CD-N\t\t\tPRO\t\t103.2\t\t1.5\nCA-N-CD\t\t\tPRO\t\t111.7\t\t1.4\nN-CA-C\t\t\tPRO\t\t112.1\t\t2.6\nCA-C-O\t\t\tPRO\t\t120.2\t\t2.4\nN-CA-CB\t\t\tSER\t\t110.5\t\t1.5\nCB-CA-C\t\t\tSER\t\t110.1\t\t1.9\nCA-CB-OG\t\tSER\t\t111.2\t\t2.7\nN-CA-C\t\t\tSER\t\t111.0\t\t2.7\nCA-C-O\t\t\tSER\t\t120.1\t\t2.1\nN-CA-CB\t\t\tTHR\t\t110.3\t\t1.9\nCB-CA-C\t\t\tTHR\t\t111.6\t\t2.7\nCA-CB-OG1\t\tTHR\t\t109.0\t\t2.1\nCA-CB-CG2\t\tTHR\t\t112.4\t\t1.4\nOG1-CB-CG2\t\tTHR\t\t110.0\t\t2.3\nN-CA-C\t\t\tTHR\t\t111.0\t\t2.7\nCA-C-O\t\t\tTHR\t\t120.1\t\t2.1\nN-CA-CB\t\t\tTRP\t\t110.6\t\t1.8\nCB-CA-C\t\t\tTRP\t\t110.4\t\t2.0\nCA-CB-CG\t\tTRP\t\t113.7\t\t1.9\nCB-CG-CD1\t\tTRP\t\t127.0\t\t1.3\nCB-CG-CD2\t\tTRP\t\t126.6\t\t1.3\nCD1-CG-CD2\t\tTRP\t\t106.3\t\t0.8\nCG-CD1-NE1\t\tTRP\t\t110.1\t\t1.0\nCD1-NE1-CE2\t\tTRP\t\t109.0\t\t0.9\nNE1-CE2-CD2\t\tTRP\t\t107.3\t\t1.0\nCE2-CD2-CG\t\tTRP\t\t107.3\t\t0.8\nCG-CD2-CE3\t\tTRP\t\t133.9\t\t0.9\nNE1-CE2-CZ2\t\tTRP\t\t130.4\t\t1.1\nCE3-CD2-CE2\t\tTRP\t\t118.7\t\t1.2\nCD2-CE2-CZ2\t\tTRP\t\t122.3\t\t1.2\nCE2-CZ2-CH2\t\tTRP\t\t117.4\t\t1.0\nCZ2-CH2-CZ3\t\tTRP\t\t121.6\t\t1.2\nCH2-CZ3-CE3\t\tTRP\t\t121.2\t\t1.1\nCZ3-CE3-CD2\t\tTRP\t\t118.8\t\t1.3\nN-CA-C\t\t\tTRP\t\t111.0\t\t2.7\nCA-C-O\t\t\tTRP\t\t120.1\t\t2.1\nN-CA-CB\t\t\tTYR\t\t110.6\t\t1.8\nCB-CA-C\t\t\tTYR\t\t110.4\t\t2.0\nCA-CB-CG\t\tTYR\t\t113.4\t\t1.9\nCB-CG-CD1\t\tTYR\t\t121.0\t\t0.6\nCB-CG-CD2\t\tTYR\t\t121.0\t\t0.6\nCD1-CG-CD2\t\tTYR\t\t117.9\t\t1.1\nCG-CD1-CE1\t\tTYR\t\t121.3\t\t0.8\nCG-CD2-CE2\t\tTYR\t\t121.3\t\t0.8\nCD1-CE1-CZ\t\tTYR\t\t119.8\t\t0.9\nCD2-CE2-CZ\t\tTYR\t\t119.8\t\t0.9\nCE1-CZ-CE2\t\tTYR\t\t119.8\t\t1.6\nCE1-CZ-OH\t\tTYR\t\t120.1\t\t2.7\nCE2-CZ-OH\t\tTYR\t\t120.1\t\t2.7\nN-CA-C\t\t\tTYR\t\t111.0\t\t2.7\nCA-C-O\t\t\tTYR\t\t120.1\t\t2.1\nN-CA-CB\t\t\tVAL\t\t111.5\t\t2.2\nCB-CA-C\t\t\tVAL\t\t111.4\t\t1.9\nCA-CB-CG1\t\tVAL\t\t110.9\t\t1.5\nCA-CB-CG2\t\tVAL\t\t110.9\t\t1.5\nCG1-CB-CG2\t\tVAL\t\t110.9\t\t1.6\nN-CA-C\t\t\tVAL\t\t111.0\t\t2.7\nCA-C-O\t\t\tVAL\t\t120.1\t\t2.1\n-\n\nNon-bonded distance     Minimum Dist    Tolerance\nC-C                     3.4             1.5\nC-N                     3.25            1.5\nC-S                     3.5             1.5\nC-O                     3.22            1.5\nN-N                     3.1             1.5\nN-S                     3.35            1.5\nN-O                     3.07            1.5\nO-S                     3.32            1.5\nO-O                     3.04            1.5\nS-S                     2.03            1.0\n-\n"
  },
  {
    "path": "alphafold/common/testdata/2rbg.pdb",
    "content": "HEADER    STRUCTURAL GENOMICS, UNKNOWN FUNCTION   19-SEP-07   2RBG              \nTITLE     CRYSTAL STRUCTURE OF HYPOTHETICAL PROTEIN(ST0493) FROM                \nTITLE    2 SULFOLOBUS TOKODAII                                                  \nCOMPND    MOL_ID: 1;                                                            \nCOMPND   2 MOLECULE: PUTATIVE UNCHARACTERIZED PROTEIN ST0493;                   \nCOMPND   3 CHAIN: A, B;                                                         \nCOMPND   4 ENGINEERED: YES                                                      \nSOURCE    MOL_ID: 1;                                                            \nSOURCE   2 ORGANISM_SCIENTIFIC: SULFOLOBUS TOKODAII;                            \nSOURCE   3 ORGANISM_TAXID: 111955;                                              \nSOURCE   4 STRAIN: STRAIN 7;                                                    \nSOURCE   5 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 \nSOURCE   6 EXPRESSION_SYSTEM_TAXID: 562;                                        \nSOURCE   7 EXPRESSION_SYSTEM_STRAIN: ROSETTA834(DE3);                           \nSOURCE   8 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              \nSOURCE   9 EXPRESSION_SYSTEM_PLASMID: PET-21A                                   \nKEYWDS    HYPOTHETICAL PROTEIN, STRUCTURAL GENOMICS, UNKNOWN FUNCTION,          \nKEYWDS   2 NPPSFA, NATIONAL PROJECT ON PROTEIN STRUCTURAL AND                   \nKEYWDS   3 FUNCTIONAL ANALYSES, RIKEN STRUCTURAL GENOMICS/PROTEOMICS            \nKEYWDS   4 INITIATIVE, RSGI                                                     \nEXPDTA    X-RAY DIFFRACTION                                                     \nAUTHOR    J.JEYAKANTHAN,S.KURAMITSU,S.YOKOYAMA,RIKEN STRUCTURAL                 \nAUTHOR   2 GENOMICS/PROTEOMICS INITIATIVE (RSGI)                                \nREVDAT   2   24-FEB-09 2RBG    1       VERSN                                    \nREVDAT   1   30-SEP-08 2RBG    0                                                \nJRNL        AUTH   J.JEYAKANTHAN,S.KURAMITSU,S.YOKOYAMA                         \nJRNL        TITL   CRYSTAL STRUCTURE OF HYPOTHETICAL PROTEIN(ST0493)            \nJRNL        TITL 2 FROM SULFOLOBUS TOKODAII                                     \nJRNL        REF    TO BE PUBLISHED                                              \nJRNL        REFN                                                                \nREMARK   1                                                                      \nREMARK   2                                                                      \nREMARK   2 RESOLUTION.    1.75 ANGSTROMS.                                       \nREMARK   3                                                                      \nREMARK   3 REFINEMENT.                                                          \nREMARK   3   PROGRAM     : CNS 1.1                                              \nREMARK   3   AUTHORS     : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-              \nREMARK   3               : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,             \nREMARK   3               : READ,RICE,SIMONSON,WARREN                            \nREMARK   3                                                                      \nREMARK   3  REFINEMENT TARGET : ENGH & HUBER                                    \nREMARK   3                                                                      \nREMARK   3  DATA USED IN REFINEMENT.                                            \nREMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 1.75                           \nREMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 33.49                          \nREMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          \nREMARK   3   DATA CUTOFF HIGH         (ABS(F)) : 2067291.840                    \nREMARK   3   DATA CUTOFF LOW          (ABS(F)) : 0.0000                         \nREMARK   3   COMPLETENESS (WORKING+TEST)   (%) : 99.3                           \nREMARK   3   NUMBER OF REFLECTIONS             : 25029                          \nREMARK   3                                                                      \nREMARK   3  FIT TO DATA USED IN REFINEMENT.                                     \nREMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      \nREMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          \nREMARK   3   R VALUE            (WORKING SET) : 0.173                           \nREMARK   3   FREE R VALUE                     : 0.196                           \nREMARK   3   FREE R VALUE TEST SET SIZE   (%) : 4.900                           \nREMARK   3   FREE R VALUE TEST SET COUNT      : 1216                            \nREMARK   3   ESTIMATED ERROR OF FREE R VALUE  : 0.006                           \nREMARK   3                                                                      \nREMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  \nREMARK   3   TOTAL NUMBER OF BINS USED           : 8                            \nREMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 1.75                         \nREMARK   3   BIN RESOLUTION RANGE LOW        (A) : 1.83                         \nREMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 96.80                        \nREMARK   3   REFLECTIONS IN BIN    (WORKING SET) : 2906                         \nREMARK   3   BIN R VALUE           (WORKING SET) : 0.1980                       \nREMARK   3   BIN FREE R VALUE                    : 0.2420                       \nREMARK   3   BIN FREE R VALUE TEST SET SIZE  (%) : 5.10                         \nREMARK   3   BIN FREE R VALUE TEST SET COUNT     : 156                          \nREMARK   3   ESTIMATED ERROR OF BIN FREE R VALUE : 0.019                        \nREMARK   3                                                                      \nREMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    \nREMARK   3   PROTEIN ATOMS            : 2060                                    \nREMARK   3   NUCLEIC ACID ATOMS       : 0                                       \nREMARK   3   HETEROGEN ATOMS          : 5                                       \nREMARK   3   SOLVENT ATOMS            : 316                                     \nREMARK   3                                                                      \nREMARK   3  B VALUES.                                                           \nREMARK   3   FROM WILSON PLOT           (A**2) : 13.30                          \nREMARK   3   MEAN B VALUE      (OVERALL, A**2) : 16.90                          \nREMARK   3   OVERALL ANISOTROPIC B VALUE.                                       \nREMARK   3    B11 (A**2) : 2.81000                                              \nREMARK   3    B22 (A**2) : -1.00000                                             \nREMARK   3    B33 (A**2) : -1.81000                                             \nREMARK   3    B12 (A**2) : 0.00000                                              \nREMARK   3    B13 (A**2) : -1.31000                                             \nREMARK   3    B23 (A**2) : 0.00000                                              \nREMARK   3                                                                      \nREMARK   3  ESTIMATED COORDINATE ERROR.                                         \nREMARK   3   ESD FROM LUZZATI PLOT        (A) : 0.16                            \nREMARK   3   ESD FROM SIGMAA              (A) : 0.06                            \nREMARK   3   LOW RESOLUTION CUTOFF        (A) : 5.00                            \nREMARK   3                                                                      \nREMARK   3  CROSS-VALIDATED ESTIMATED COORDINATE ERROR.                         \nREMARK   3   ESD FROM C-V LUZZATI PLOT    (A) : 0.19                            \nREMARK   3   ESD FROM C-V SIGMAA          (A) : 0.14                            \nREMARK   3                                                                      \nREMARK   3  RMS DEVIATIONS FROM IDEAL VALUES.                                   \nREMARK   3   BOND LENGTHS                 (A) : 0.005                           \nREMARK   3   BOND ANGLES            (DEGREES) : 1.10                            \nREMARK   3   DIHEDRAL ANGLES        (DEGREES) : 22.00                           \nREMARK   3   IMPROPER ANGLES        (DEGREES) : 0.70                            \nREMARK   3                                                                      \nREMARK   3  ISOTROPIC THERMAL MODEL : RESTRAINED                                \nREMARK   3                                                                      \nREMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.    RMS    SIGMA                \nREMARK   3   MAIN-CHAIN BOND              (A**2) : NULL  ; NULL                 \nREMARK   3   MAIN-CHAIN ANGLE             (A**2) : NULL  ; NULL                 \nREMARK   3   SIDE-CHAIN BOND              (A**2) : NULL  ; NULL                 \nREMARK   3   SIDE-CHAIN ANGLE             (A**2) : NULL  ; NULL                 \nREMARK   3                                                                      \nREMARK   3  BULK SOLVENT MODELING.                                              \nREMARK   3   METHOD USED : FLAT MODEL                                           \nREMARK   3   KSOL        : 0.37                                                 \nREMARK   3   BSOL        : 51.20                                                \nREMARK   3                                                                      \nREMARK   3  NCS MODEL : NULL                                                    \nREMARK   3                                                                      \nREMARK   3  NCS RESTRAINTS.                         RMS   SIGMA/WEIGHT          \nREMARK   3   GROUP  1  POSITIONAL            (A) : NULL  ; NULL                 \nREMARK   3   GROUP  1  B-FACTOR           (A**2) : NULL  ; NULL                 \nREMARK   3                                                                      \nREMARK   3  PARAMETER FILE  1  : PROTEIN_REP.PARAM                              \nREMARK   3  PARAMETER FILE  2  : LIGAND.PARAM                                   \nREMARK   3  PARAMETER FILE  3  : ION.PARAM                                      \nREMARK   3  PARAMETER FILE  5  : WATER_REP.PARAM                                \nREMARK   3  PARAMETER FILE  6  : NULL                                           \nREMARK   3  TOPOLOGY FILE  1   : PROTEIN.TOP                                    \nREMARK   3  TOPOLOGY FILE  2   : LIGAND.TOP                                     \nREMARK   3  TOPOLOGY FILE  3   : ION.TOP                                        \nREMARK   3  TOPOLOGY FILE  5   : WATER_PROTIN.TOP                               \nREMARK   3  TOPOLOGY FILE  6   : NULL                                           \nREMARK   3                                                                      \nREMARK   3  OTHER REFINEMENT REMARKS: NULL                                      \nREMARK   4                                                                      \nREMARK   4 2RBG COMPLIES WITH FORMAT V. 3.15, 01-DEC-08                         \nREMARK 100                                                                      \nREMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBJ ON 27-SEP-07.                  \nREMARK 100 THE RCSB ID CODE IS RCSB044658.                                      \nREMARK 200                                                                      \nREMARK 200 EXPERIMENTAL DETAILS                                                 \nREMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  \nREMARK 200  DATE OF DATA COLLECTION        : 16-JUN-07                          \nREMARK 200  TEMPERATURE           (KELVIN) : 100                                \nREMARK 200  PH                             : 7.5                                \nREMARK 200  NUMBER OF CRYSTALS USED        : 1                                  \nREMARK 200                                                                      \nREMARK 200  SYNCHROTRON              (Y/N) : Y                                  \nREMARK 200  RADIATION SOURCE               : SPRING-8                           \nREMARK 200  BEAMLINE                       : BL26B2                             \nREMARK 200  X-RAY GENERATOR MODEL          : NULL                               \nREMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  \nREMARK 200  WAVELENGTH OR RANGE        (A) : 0.97899, 0.9, 0.97931              \nREMARK 200  MONOCHROMATOR                  : SI-1 1 1 DOUBLE CRYSTAL            \nREMARK 200                                   MONOCHROMATOR                      \nREMARK 200  OPTICS                         : RH COATED BENT-CYRINDRICAL         \nREMARK 200                                   MIRROR                             \nREMARK 200                                                                      \nREMARK 200  DETECTOR TYPE                  : CCD                                \nREMARK 200  DETECTOR MANUFACTURER          : MARMOSAIC 225 MM CCD               \nREMARK 200  INTENSITY-INTEGRATION SOFTWARE : HKL-2000                           \nREMARK 200  DATA SCALING SOFTWARE          : SCALEPACK                          \nREMARK 200                                                                      \nREMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 25105                              \nREMARK 200  RESOLUTION RANGE HIGH      (A) : 1.750                              \nREMARK 200  RESOLUTION RANGE LOW       (A) : 50.000                             \nREMARK 200  REJECTION CRITERIA  (SIGMA(I)) : NULL                               \nREMARK 200                                                                      \nREMARK 200 OVERALL.                                                             \nREMARK 200  COMPLETENESS FOR RANGE     (%) : 99.6                               \nREMARK 200  DATA REDUNDANCY                : NULL                               \nREMARK 200  R MERGE                    (I) : 0.05900                            \nREMARK 200  R SYM                      (I) : 0.06300                            \nREMARK 200  <I/SIGMA(I)> FOR THE DATA SET  : NULL                               \nREMARK 200                                                                      \nREMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     \nREMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 1.75                     \nREMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : 1.81                     \nREMARK 200  COMPLETENESS FOR SHELL     (%) : 96.9                               \nREMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               \nREMARK 200  R MERGE FOR SHELL          (I) : 0.14300                            \nREMARK 200  R SYM FOR SHELL            (I) : 0.13300                            \nREMARK 200  <I/SIGMA(I)> FOR SHELL         : NULL                               \nREMARK 200                                                                      \nREMARK 200 DIFFRACTION PROTOCOL: MAD                                            \nREMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MAD                          \nREMARK 200 SOFTWARE USED: SOLVE                                                 \nREMARK 200 STARTING MODEL: NULL                                                 \nREMARK 200                                                                      \nREMARK 200 REMARK: NULL                                                         \nREMARK 280                                                                      \nREMARK 280 CRYSTAL                                                              \nREMARK 280 SOLVENT CONTENT, VS   (%): 41.69                                     \nREMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 2.11                     \nREMARK 280                                                                      \nREMARK 280 CRYSTALLIZATION CONDITIONS: 30% PEG 4K, 0.2M AMMONIUM SULFATE,       \nREMARK 280  PH 7.5, MICROBATCH, TEMPERATURE 293K                                \nREMARK 290                                                                      \nREMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            \nREMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 1 21 1                         \nREMARK 290                                                                      \nREMARK 290      SYMOP   SYMMETRY                                                \nREMARK 290     NNNMMM   OPERATOR                                                \nREMARK 290       1555   X,Y,Z                                                   \nREMARK 290       2555   -X,Y+1/2,-Z                                             \nREMARK 290                                                                      \nREMARK 290     WHERE NNN -> OPERATOR NUMBER                                     \nREMARK 290           MMM -> TRANSLATION VECTOR                                  \nREMARK 290                                                                      \nREMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            \nREMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             \nREMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                \nREMARK 290 RELATED MOLECULES.                                                   \nREMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            \nREMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            \nREMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            \nREMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000        0.00000            \nREMARK 290   SMTRY2   2  0.000000  1.000000  0.000000       32.59200            \nREMARK 290   SMTRY3   2  0.000000  0.000000 -1.000000        0.00000            \nREMARK 290                                                                      \nREMARK 290 REMARK: NULL                                                         \nREMARK 300                                                                      \nREMARK 300 BIOMOLECULE: 1, 2, 3                                                 \nREMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                \nREMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  \nREMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               \nREMARK 300 BURIED SURFACE AREA.                                                 \nREMARK 350                                                                      \nREMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           \nREMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                \nREMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          \nREMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          \nREMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               \nREMARK 350                                                                      \nREMARK 350 BIOMOLECULE: 1                                                       \nREMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DIMERIC                           \nREMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B                                  \nREMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            \nREMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            \nREMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            \nREMARK 350                                                                      \nREMARK 350 BIOMOLECULE: 2                                                       \nREMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: MONOMERIC                  \nREMARK 350 SOFTWARE USED: PISA                                                  \nREMARK 350 APPLY THE FOLLOWING TO CHAINS: A                                     \nREMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            \nREMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            \nREMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            \nREMARK 350                                                                      \nREMARK 350 BIOMOLECULE: 3                                                       \nREMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: MONOMERIC                  \nREMARK 350 SOFTWARE USED: PISA                                                  \nREMARK 350 APPLY THE FOLLOWING TO CHAINS: B                                     \nREMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            \nREMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            \nREMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            \nREMARK 465                                                                      \nREMARK 465 MISSING RESIDUES                                                     \nREMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       \nREMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               \nREMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                \nREMARK 465                                                                      \nREMARK 465   M RES C SSSEQI                                                     \nREMARK 465     MSE A     1                                                      \nREMARK 465     PRO A     2                                                      \nREMARK 465     MSE B     1                                                      \nREMARK 465     PRO B     2                                                      \nREMARK 500                                                                      \nREMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         \nREMARK 500 SUBTOPIC: TORSION ANGLES                                             \nREMARK 500                                                                      \nREMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            \nREMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               \nREMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             \nREMARK 500                                                                      \nREMARK 500 STANDARD TABLE:                                                      \nREMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    \nREMARK 500                                                                      \nREMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           \nREMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            \nREMARK 500                                                                      \nREMARK 500  M RES CSSEQI        PSI       PHI                                   \nREMARK 500    PHE A 121       76.88   -102.11                                   \nREMARK 500    CYS A 122      -73.41   -165.90                                   \nREMARK 500    CYS B 122      -70.28   -161.68                                   \nREMARK 500                                                                      \nREMARK 500 REMARK: NULL                                                         \nREMARK 800                                                                      \nREMARK 800 SITE                                                                 \nREMARK 800 SITE_IDENTIFIER: AC1                                                 \nREMARK 800 EVIDENCE_CODE: SOFTWARE                                              \nREMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE SO4 B 127                 \nREMARK 900                                                                      \nREMARK 900 RELATED ENTRIES                                                      \nREMARK 900 RELATED ID: STO001000493.1   RELATED DB: TARGETDB                    \nDBREF  2RBG A    1   126  UNP    Q975B5   Q975B5_SULTO     1    126             \nDBREF  2RBG B    1   126  UNP    Q975B5   Q975B5_SULTO     1    126             \nSEQRES   1 A  126  MSE PRO TYR LYS ASN ILE LEU THR LEU ILE SER VAL ASN          \nSEQRES   2 A  126  ASN ASP ASN PHE GLU ASN TYR PHE ARG LYS ILE PHE LEU          \nSEQRES   3 A  126  ASP VAL ARG SER SER GLY SER LYS LYS THR THR ILE ASN          \nSEQRES   4 A  126  VAL PHE THR GLU ILE GLN TYR GLN GLU LEU VAL THR LEU          \nSEQRES   5 A  126  ILE ARG GLU ALA LEU LEU GLU ASN ILE ASP ILE GLY TYR          \nSEQRES   6 A  126  GLU LEU PHE LEU TRP LYS LYS ASN GLU VAL ASP ILE PHE          \nSEQRES   7 A  126  LEU LYS ASN LEU GLU LYS SER GLU VAL ASP GLY LEU LEU          \nSEQRES   8 A  126  VAL TYR CYS ASP ASP GLU ASN LYS VAL PHE MSE SER LYS          \nSEQRES   9 A  126  ILE VAL ASP ASN LEU PRO THR ALA ILE LYS ARG ASN LEU          \nSEQRES  10 A  126  ILE LYS ASP PHE CYS ARG LYS LEU SER                          \nSEQRES   1 B  126  MSE PRO TYR LYS ASN ILE LEU THR LEU ILE SER VAL ASN          \nSEQRES   2 B  126  ASN ASP ASN PHE GLU ASN TYR PHE ARG LYS ILE PHE LEU          \nSEQRES   3 B  126  ASP VAL ARG SER SER GLY SER LYS LYS THR THR ILE ASN          \nSEQRES   4 B  126  VAL PHE THR GLU ILE GLN TYR GLN GLU LEU VAL THR LEU          \nSEQRES   5 B  126  ILE ARG GLU ALA LEU LEU GLU ASN ILE ASP ILE GLY TYR          \nSEQRES   6 B  126  GLU LEU PHE LEU TRP LYS LYS ASN GLU VAL ASP ILE PHE          \nSEQRES   7 B  126  LEU LYS ASN LEU GLU LYS SER GLU VAL ASP GLY LEU LEU          \nSEQRES   8 B  126  VAL TYR CYS ASP ASP GLU ASN LYS VAL PHE MSE SER LYS          \nSEQRES   9 B  126  ILE VAL ASP ASN LEU PRO THR ALA ILE LYS ARG ASN LEU          \nSEQRES  10 B  126  ILE LYS ASP PHE CYS ARG LYS LEU SER                          \nMODRES 2RBG MSE A  102  MET  SELENOMETHIONINE                                   \nMODRES 2RBG MSE B  102  MET  SELENOMETHIONINE                                   \nHET    MSE  A 102       8                                                       \nHET    MSE  B 102       8                                                       \nHET    SO4  B 127       5                                                       \nHETNAM     MSE SELENOMETHIONINE                                                 \nHETNAM     SO4 SULFATE ION                                                      \nFORMUL   1  MSE    2(C5 H11 N O2 SE)                                            \nFORMUL   3  SO4    O4 S 2-                                                      \nFORMUL   4  HOH   *316(H2 O)                                                    \nHELIX    1   1 ASN A   13  ASP A   15  5                                   3    \nHELIX    2   2 ASN A   16  GLY A   32  1                                  17    \nHELIX    3   3 GLN A   45  ILE A   53  1                                   9    \nHELIX    4   4 ILE A   53  ASN A   60  1                                   8    \nHELIX    5   5 LYS A   71  ASN A   73  5                                   3    \nHELIX    6   6 GLU A   74  GLU A   83  1                                  10    \nHELIX    7   7 ASN A   98  ASN A  108  1                                  11    \nHELIX    8   8 PRO A  110  ARG A  115  1                                   6    \nHELIX    9   9 ASN B   13  ASP B   15  5                                   3    \nHELIX   10  10 ASN B   16  GLY B   32  1                                  17    \nHELIX   11  11 GLN B   45  ILE B   53  1                                   9    \nHELIX   12  12 ILE B   53  GLU B   59  1                                   7    \nHELIX   13  13 LYS B   71  ASN B   73  5                                   3    \nHELIX   14  14 GLU B   74  LEU B   82  1                                   9    \nHELIX   15  15 GLU B   83  SER B   85  5                                   3    \nHELIX   16  16 ASN B   98  ASN B  108  1                                  11    \nHELIX   17  17 PRO B  110  ASN B  116  1                                   7    \nSHEET    1   A 5 GLY A  64  TRP A  70  0                                        \nSHEET    2   A 5 LYS A  35  PHE A  41  1  N  VAL A  40   O  PHE A  68           \nSHEET    3   A 5 ILE A   6  SER A  11  1  N  THR A   8   O  ASN A  39           \nSHEET    4   A 5 GLY A  89  CYS A  94  1  O  GLY A  89   N  LEU A   7           \nSHEET    5   A 5 LEU A 117  PHE A 121  1  O  ILE A 118   N  LEU A  90           \nSHEET    1   B 5 GLY B  64  TRP B  70  0                                        \nSHEET    2   B 5 LYS B  35  PHE B  41  1  N  VAL B  40   O  TRP B  70           \nSHEET    3   B 5 ILE B   6  SER B  11  1  N  THR B   8   O  ASN B  39           \nSHEET    4   B 5 GLY B  89  CYS B  94  1  O  GLY B  89   N  LEU B   7           \nSHEET    5   B 5 LEU B 117  PHE B 121  1  O  ILE B 118   N  LEU B  90           \nSSBOND   1 CYS A   94    CYS A  122                          1555   1555  2.03  \nSSBOND   2 CYS B   94    CYS B  122                          1555   1555  2.03  \nLINK         C   PHE A 101                 N   MSE A 102     1555   1555  1.33  \nLINK         C   MSE A 102                 N   SER A 103     1555   1555  1.33  \nLINK         C   PHE B 101                 N   MSE B 102     1555   1555  1.33  \nLINK         C   MSE B 102                 N   SER B 103     1555   1555  1.33  \nSITE     1 AC1  5 GLU B  18  ARG B  22  GLU B  55  HOH B 217                    \nSITE     2 AC1  5 HOH B 234                                                     \nCRYST1   39.444   65.184   49.604  90.00  98.19  90.00 P 1 21 1      4          \nORIGX1      1.000000  0.000000  0.000000        0.00000                         \nORIGX2      0.000000  1.000000  0.000000        0.00000                         \nORIGX3      0.000000  0.000000  1.000000        0.00000                         \nSCALE1      0.025352  0.000000  0.003650        0.00000                         \nSCALE2      0.000000  0.015341  0.000000        0.00000                         \nSCALE3      0.000000  0.000000  0.020368        0.00000                         \nATOM      1  N   TYR A   3      33.471   9.062  24.101  1.00 24.34           N  \nATOM      2  CA  TYR A   3      32.068   8.798  23.671  1.00 22.76           C  \nATOM      3  C   TYR A   3      31.421  10.059  23.108  1.00 22.12           C  \nATOM      4  O   TYR A   3      31.551  11.144  23.678  1.00 23.86           O  \nATOM      5  CB  TYR A   3      31.252   8.265  24.852  1.00 22.59           C  \nATOM      6  CG  TYR A   3      31.720   6.909  25.338  1.00 23.54           C  \nATOM      7  CD1 TYR A   3      32.254   6.746  26.616  1.00 23.82           C  \nATOM      8  CD2 TYR A   3      31.647   5.792  24.508  1.00 23.93           C  \nATOM      9  CE1 TYR A   3      32.705   5.500  27.055  1.00 25.31           C  \nATOM     10  CE2 TYR A   3      32.095   4.544  24.936  1.00 22.68           C  \nATOM     11  CZ  TYR A   3      32.622   4.405  26.208  1.00 25.21           C  \nATOM     12  OH  TYR A   3      33.070   3.171  26.625  1.00 27.53           O  \nATOM     13  N   LYS A   4      30.720   9.903  21.989  1.00 18.90           N  \nATOM     14  CA  LYS A   4      30.060  11.019  21.317  1.00 18.65           C  \nATOM     15  C   LYS A   4      28.537  10.918  21.313  1.00 15.20           C  \nATOM     16  O   LYS A   4      27.850  11.932  21.232  1.00 13.13           O  \nATOM     17  CB  LYS A   4      30.555  11.114  19.870  1.00 21.41           C  \nATOM     18  CG  LYS A   4      32.064  11.283  19.734  1.00 32.01           C  \nATOM     19  CD  LYS A   4      32.527  12.652  20.213  1.00 36.58           C  \nATOM     20  CE  LYS A   4      32.002  13.760  19.311  1.00 39.57           C  \nATOM     21  NZ  LYS A   4      32.463  15.105  19.752  1.00 43.99           N  \nATOM     22  N   ASN A   5      28.009   9.699  21.374  1.00 13.77           N  \nATOM     23  CA  ASN A   5      26.560   9.508  21.373  1.00 13.94           C  \nATOM     24  C   ASN A   5      26.217   8.213  22.092  1.00 14.07           C  \nATOM     25  O   ASN A   5      26.368   7.121  21.548  1.00 13.93           O  \nATOM     26  CB  ASN A   5      26.022   9.489  19.936  1.00 15.07           C  \nATOM     27  CG  ASN A   5      24.503   9.457  19.879  1.00 19.05           C  \nATOM     28  OD1 ASN A   5      23.826  10.028  20.734  1.00 18.93           O  \nATOM     29  ND2 ASN A   5      23.960   8.805  18.857  1.00 23.13           N  \nATOM     30  N   ILE A   6      25.749   8.359  23.324  1.00 12.56           N  \nATOM     31  CA  ILE A   6      25.398   7.232  24.174  1.00 10.81           C  \nATOM     32  C   ILE A   6      24.026   6.636  23.871  1.00  9.05           C  \nATOM     33  O   ILE A   6      23.032   7.360  23.784  1.00 10.03           O  \nATOM     34  CB  ILE A   6      25.409   7.661  25.661  1.00 10.42           C  \nATOM     35  CG1 ILE A   6      26.761   8.291  26.015  1.00 14.05           C  \nATOM     36  CG2 ILE A   6      25.114   6.465  26.555  1.00 10.54           C  \nATOM     37  CD1 ILE A   6      27.942   7.352  25.864  1.00 13.83           C  \nATOM     38  N   LEU A   7      23.978   5.317  23.695  1.00  7.97           N  \nATOM     39  CA  LEU A   7      22.708   4.638  23.468  1.00  7.84           C  \nATOM     40  C   LEU A   7      22.167   4.341  24.862  1.00  6.49           C  \nATOM     41  O   LEU A   7      22.786   3.598  25.623  1.00  7.93           O  \nATOM     42  CB  LEU A   7      22.901   3.315  22.724  1.00  7.80           C  \nATOM     43  CG  LEU A   7      21.627   2.465  22.610  1.00  8.47           C  \nATOM     44  CD1 LEU A   7      20.587   3.198  21.769  1.00  8.00           C  \nATOM     45  CD2 LEU A   7      21.961   1.115  21.988  1.00 10.59           C  \nATOM     46  N   THR A   8      21.029   4.936  25.201  1.00  5.70           N  \nATOM     47  CA  THR A   8      20.419   4.719  26.508  1.00  6.42           C  \nATOM     48  C   THR A   8      19.137   3.917  26.352  1.00  6.87           C  \nATOM     49  O   THR A   8      18.243   4.298  25.595  1.00  7.76           O  \nATOM     50  CB  THR A   8      20.101   6.061  27.208  1.00  6.58           C  \nATOM     51  OG1 THR A   8      21.328   6.729  27.538  1.00  7.53           O  \nATOM     52  CG2 THR A   8      19.310   5.826  28.490  1.00  7.99           C  \nATOM     53  N   LEU A   9      19.067   2.792  27.057  1.00  7.67           N  \nATOM     54  CA  LEU A   9      17.898   1.930  27.012  1.00  8.24           C  \nATOM     55  C   LEU A   9      17.289   1.878  28.404  1.00  8.48           C  \nATOM     56  O   LEU A   9      18.000   1.681  29.391  1.00  7.88           O  \nATOM     57  CB  LEU A   9      18.293   0.514  26.583  1.00  9.90           C  \nATOM     58  CG  LEU A   9      19.140   0.391  25.315  1.00 11.56           C  \nATOM     59  CD1 LEU A   9      19.413  -1.082  25.031  1.00 10.95           C  \nATOM     60  CD2 LEU A   9      18.418   1.039  24.145  1.00 10.46           C  \nATOM     61  N   ILE A  10      15.976   2.056  28.484  1.00  7.53           N  \nATOM     62  CA  ILE A  10      15.301   2.010  29.771  1.00  7.34           C  \nATOM     63  C   ILE A  10      13.911   1.408  29.690  1.00  8.82           C  \nATOM     64  O   ILE A  10      13.146   1.683  28.767  1.00 10.17           O  \nATOM     65  CB  ILE A  10      15.190   3.420  30.412  1.00  8.96           C  \nATOM     66  CG1 ILE A  10      14.388   3.338  31.717  1.00  7.62           C  \nATOM     67  CG2 ILE A  10      14.524   4.392  29.433  1.00  9.63           C  \nATOM     68  CD1 ILE A  10      14.445   4.613  32.566  1.00 11.33           C  \nATOM     69  N   SER A  11      13.605   0.560  30.664  1.00  8.33           N  \nATOM     70  CA  SER A  11      12.297  -0.060  30.761  1.00 10.47           C  \nATOM     71  C   SER A  11      11.962  -0.145  32.245  1.00  9.11           C  \nATOM     72  O   SER A  11      12.520  -0.964  32.972  1.00 11.58           O  \nATOM     73  CB  SER A  11      12.300  -1.457  30.143  1.00 13.19           C  \nATOM     74  OG  SER A  11      10.990  -1.998  30.156  1.00 19.72           O  \nATOM     75  N   VAL A  12      11.067   0.730  32.687  1.00 11.21           N  \nATOM     76  CA  VAL A  12      10.643   0.770  34.081  1.00 11.41           C  \nATOM     77  C   VAL A  12       9.161   1.098  34.156  1.00 15.63           C  \nATOM     78  O   VAL A  12       8.563   1.528  33.170  1.00 16.75           O  \nATOM     79  CB  VAL A  12      11.402   1.858  34.886  1.00 11.30           C  \nATOM     80  CG1 VAL A  12      12.884   1.530  34.945  1.00  8.11           C  \nATOM     81  CG2 VAL A  12      11.178   3.230  34.255  1.00 12.03           C  \nATOM     82  N   ASN A  13       8.575   0.887  35.330  1.00 17.25           N  \nATOM     83  CA  ASN A  13       7.170   1.200  35.547  1.00 20.47           C  \nATOM     84  C   ASN A  13       7.075   2.724  35.563  1.00 19.38           C  \nATOM     85  O   ASN A  13       8.061   3.404  35.845  1.00 18.17           O  \nATOM     86  CB  ASN A  13       6.700   0.622  36.885  1.00 23.13           C  \nATOM     87  CG  ASN A  13       6.713  -0.895  36.900  1.00 31.36           C  \nATOM     88  OD1 ASN A  13       6.035  -1.541  36.099  1.00 36.96           O  \nATOM     89  ND2 ASN A  13       7.484  -1.472  37.817  1.00 34.18           N  \nATOM     90  N   ASN A  14       5.896   3.259  35.266  1.00 18.03           N  \nATOM     91  CA  ASN A  14       5.707   4.707  35.224  1.00 19.51           C  \nATOM     92  C   ASN A  14       6.148   5.468  36.472  1.00 20.09           C  \nATOM     93  O   ASN A  14       6.659   6.582  36.372  1.00 20.91           O  \nATOM     94  CB  ASN A  14       4.242   5.048  34.941  1.00 20.73           C  \nATOM     95  CG  ASN A  14       3.742   4.437  33.653  1.00 23.53           C  \nATOM     96  OD1 ASN A  14       4.496   4.276  32.696  1.00 22.26           O  \nATOM     97  ND2 ASN A  14       2.456   4.108  33.615  1.00 26.38           N  \nATOM     98  N   ASP A  15       5.954   4.876  37.645  1.00 20.00           N  \nATOM     99  CA  ASP A  15       6.319   5.543  38.890  1.00 23.11           C  \nATOM    100  C   ASP A  15       7.828   5.697  39.071  1.00 20.27           C  \nATOM    101  O   ASP A  15       8.275   6.420  39.958  1.00 21.58           O  \nATOM    102  CB  ASP A  15       5.736   4.783  40.086  1.00 23.65           C  \nATOM    103  CG  ASP A  15       6.495   3.509  40.394  1.00 33.42           C  \nATOM    104  OD1 ASP A  15       6.862   2.787  39.443  1.00 37.24           O  \nATOM    105  OD2 ASP A  15       6.719   3.222  41.591  1.00 40.07           O  \nATOM    106  N   ASN A  16       8.607   5.025  38.228  1.00 17.28           N  \nATOM    107  CA  ASN A  16      10.063   5.089  38.322  1.00 16.22           C  \nATOM    108  C   ASN A  16      10.757   6.035  37.343  1.00 17.13           C  \nATOM    109  O   ASN A  16      11.960   6.258  37.458  1.00 15.71           O  \nATOM    110  CB  ASN A  16      10.670   3.691  38.150  1.00 18.31           C  \nATOM    111  CG  ASN A  16      10.692   2.896  39.440  1.00 21.25           C  \nATOM    112  OD1 ASN A  16      11.056   3.416  40.495  1.00 23.56           O  \nATOM    113  ND2 ASN A  16      10.323   1.623  39.357  1.00 19.07           N  \nATOM    114  N   PHE A  17      10.020   6.598  36.392  1.00 14.63           N  \nATOM    115  CA  PHE A  17      10.641   7.486  35.409  1.00 14.77           C  \nATOM    116  C   PHE A  17      11.409   8.670  35.984  1.00 14.87           C  \nATOM    117  O   PHE A  17      12.552   8.913  35.604  1.00  9.25           O  \nATOM    118  CB  PHE A  17       9.602   7.998  34.404  1.00 12.16           C  \nATOM    119  CG  PHE A  17       9.216   6.987  33.365  1.00 11.38           C  \nATOM    120  CD1 PHE A  17      10.192   6.337  32.614  1.00 13.83           C  \nATOM    121  CD2 PHE A  17       7.878   6.680  33.135  1.00 14.52           C  \nATOM    122  CE1 PHE A  17       9.842   5.393  31.649  1.00 14.54           C  \nATOM    123  CE2 PHE A  17       7.518   5.740  32.174  1.00 14.67           C  \nATOM    124  CZ  PHE A  17       8.500   5.095  31.429  1.00 14.46           C  \nATOM    125  N   GLU A  18      10.792   9.411  36.897  1.00 16.23           N  \nATOM    126  CA  GLU A  18      11.464  10.565  37.475  1.00 16.73           C  \nATOM    127  C   GLU A  18      12.805  10.207  38.106  1.00 16.00           C  \nATOM    128  O   GLU A  18      13.818  10.842  37.814  1.00 16.65           O  \nATOM    129  CB  GLU A  18      10.557  11.247  38.505  1.00 23.36           C  \nATOM    130  CG  GLU A  18       9.338  11.909  37.879  1.00 30.35           C  \nATOM    131  CD  GLU A  18       8.469  12.633  38.889  1.00 37.35           C  \nATOM    132  OE1 GLU A  18       8.971  13.562  39.558  1.00 37.02           O  \nATOM    133  OE2 GLU A  18       7.280  12.273  39.010  1.00 40.39           O  \nATOM    134  N   ASN A  19      12.816   9.184  38.954  1.00 16.87           N  \nATOM    135  CA  ASN A  19      14.049   8.770  39.618  1.00 15.97           C  \nATOM    136  C   ASN A  19      15.094   8.227  38.649  1.00 15.31           C  \nATOM    137  O   ASN A  19      16.278   8.557  38.756  1.00 13.61           O  \nATOM    138  CB  ASN A  19      13.761   7.713  40.690  1.00 19.94           C  \nATOM    139  CG  ASN A  19      12.921   8.251  41.831  1.00 26.59           C  \nATOM    140  OD1 ASN A  19      13.143   9.361  42.313  1.00 28.74           O  \nATOM    141  ND2 ASN A  19      11.958   7.454  42.283  1.00 31.96           N  \nATOM    142  N   TYR A  20      14.667   7.395  37.705  1.00  9.62           N  \nATOM    143  CA  TYR A  20      15.612   6.830  36.750  1.00  8.42           C  \nATOM    144  C   TYR A  20      16.193   7.835  35.765  1.00 10.15           C  \nATOM    145  O   TYR A  20      17.354   7.718  35.390  1.00  8.97           O  \nATOM    146  CB  TYR A  20      14.988   5.667  35.975  1.00  8.90           C  \nATOM    147  CG  TYR A  20      15.099   4.331  36.683  1.00 11.47           C  \nATOM    148  CD1 TYR A  20      14.377   4.074  37.848  1.00 11.36           C  \nATOM    149  CD2 TYR A  20      15.916   3.319  36.178  1.00  9.86           C  \nATOM    150  CE1 TYR A  20      14.461   2.838  38.488  1.00 10.09           C  \nATOM    151  CE2 TYR A  20      16.008   2.080  36.808  1.00 11.95           C  \nATOM    152  CZ  TYR A  20      15.272   1.847  37.965  1.00 10.22           C  \nATOM    153  OH  TYR A  20      15.329   0.615  38.579  1.00 12.19           O  \nATOM    154  N   PHE A  21      15.407   8.817  35.331  1.00 10.83           N  \nATOM    155  CA  PHE A  21      15.961   9.786  34.396  1.00 10.37           C  \nATOM    156  C   PHE A  21      17.015  10.652  35.066  1.00  9.86           C  \nATOM    157  O   PHE A  21      17.893  11.207  34.403  1.00 10.68           O  \nATOM    158  CB  PHE A  21      14.863  10.640  33.760  1.00 10.02           C  \nATOM    159  CG  PHE A  21      14.380  10.090  32.448  1.00  9.94           C  \nATOM    160  CD1 PHE A  21      13.536   8.984  32.413  1.00 10.87           C  \nATOM    161  CD2 PHE A  21      14.844  10.618  31.247  1.00 11.58           C  \nATOM    162  CE1 PHE A  21      13.166   8.405  31.199  1.00 10.52           C  \nATOM    163  CE2 PHE A  21      14.479  10.046  30.021  1.00 12.43           C  \nATOM    164  CZ  PHE A  21      13.640   8.937  29.999  1.00 11.64           C  \nATOM    165  N   ARG A  22      16.937  10.756  36.386  1.00 10.63           N  \nATOM    166  CA  ARG A  22      17.930  11.519  37.121  1.00 12.46           C  \nATOM    167  C   ARG A  22      19.243  10.741  36.990  1.00 12.16           C  \nATOM    168  O   ARG A  22      20.314  11.326  36.831  1.00 12.50           O  \nATOM    169  CB  ARG A  22      17.521  11.653  38.592  1.00 12.81           C  \nATOM    170  CG  ARG A  22      18.512  12.441  39.436  1.00 17.97           C  \nATOM    171  CD  ARG A  22      18.033  12.635  40.873  1.00 15.56           C  \nATOM    172  NE  ARG A  22      16.944  13.605  40.993  1.00 15.48           N  \nATOM    173  CZ  ARG A  22      16.484  14.056  42.158  1.00 17.00           C  \nATOM    174  NH1 ARG A  22      17.020  13.622  43.293  1.00 13.10           N  \nATOM    175  NH2 ARG A  22      15.495  14.941  42.195  1.00 16.86           N  \nATOM    176  N   LYS A  23      19.150   9.414  37.040  1.00  9.11           N  \nATOM    177  CA  LYS A  23      20.330   8.562  36.910  1.00  8.13           C  \nATOM    178  C   LYS A  23      20.899   8.647  35.497  1.00  8.65           C  \nATOM    179  O   LYS A  23      22.109   8.744  35.305  1.00 11.79           O  \nATOM    180  CB  LYS A  23      19.983   7.099  37.206  1.00 10.36           C  \nATOM    181  CG  LYS A  23      19.601   6.794  38.646  1.00 10.87           C  \nATOM    182  CD  LYS A  23      19.398   5.289  38.832  1.00 14.62           C  \nATOM    183  CE  LYS A  23      19.222   4.926  40.294  1.00 23.04           C  \nATOM    184  NZ  LYS A  23      20.438   5.264  41.088  1.00 16.09           N  \nATOM    185  N   ILE A  24      20.015   8.600  34.505  1.00  7.43           N  \nATOM    186  CA  ILE A  24      20.443   8.660  33.116  1.00  6.12           C  \nATOM    187  C   ILE A  24      21.374   9.834  32.842  1.00  8.47           C  \nATOM    188  O   ILE A  24      22.446   9.661  32.271  1.00  9.39           O  \nATOM    189  CB  ILE A  24      19.226   8.750  32.168  1.00  6.49           C  \nATOM    190  CG1 ILE A  24      18.475   7.414  32.183  1.00  5.04           C  \nATOM    191  CG2 ILE A  24      19.684   9.104  30.748  1.00  7.14           C  \nATOM    192  CD1 ILE A  24      17.160   7.432  31.432  1.00  5.89           C  \nATOM    193  N   PHE A  25      20.976  11.031  33.254  1.00  8.27           N  \nATOM    194  CA  PHE A  25      21.814  12.192  32.991  1.00 10.11           C  \nATOM    195  C   PHE A  25      23.098  12.230  33.813  1.00  8.55           C  \nATOM    196  O   PHE A  25      24.106  12.772  33.361  1.00  9.67           O  \nATOM    197  CB  PHE A  25      20.985  13.470  33.142  1.00  9.31           C  \nATOM    198  CG  PHE A  25      20.000  13.667  32.016  1.00 11.97           C  \nATOM    199  CD1 PHE A  25      20.452  13.926  30.721  1.00 13.37           C  \nATOM    200  CD2 PHE A  25      18.635  13.523  32.230  1.00 12.47           C  \nATOM    201  CE1 PHE A  25      19.556  14.034  29.657  1.00 12.22           C  \nATOM    202  CE2 PHE A  25      17.728  13.627  31.173  1.00 15.03           C  \nATOM    203  CZ  PHE A  25      18.193  13.883  29.883  1.00 13.24           C  \nATOM    204  N   LEU A  26      23.077  11.647  35.008  1.00  8.53           N  \nATOM    205  CA  LEU A  26      24.284  11.592  35.825  1.00 10.27           C  \nATOM    206  C   LEU A  26      25.305  10.752  35.054  1.00  7.43           C  \nATOM    207  O   LEU A  26      26.474  11.116  34.935  1.00  8.43           O  \nATOM    208  CB  LEU A  26      24.005  10.915  37.172  1.00 12.37           C  \nATOM    209  CG  LEU A  26      23.874  11.773  38.432  1.00 23.05           C  \nATOM    210  CD1 LEU A  26      22.666  12.653  38.319  1.00 28.50           C  \nATOM    211  CD2 LEU A  26      23.748  10.880  39.654  1.00 23.45           C  \nATOM    212  N   ASP A  27      24.847   9.626  34.519  1.00  8.78           N  \nATOM    213  CA  ASP A  27      25.724   8.732  33.779  1.00  6.87           C  \nATOM    214  C   ASP A  27      26.167   9.306  32.439  1.00  7.47           C  \nATOM    215  O   ASP A  27      27.331   9.171  32.059  1.00  8.28           O  \nATOM    216  CB  ASP A  27      25.053   7.370  33.581  1.00 10.81           C  \nATOM    217  CG  ASP A  27      24.911   6.601  34.882  1.00 11.54           C  \nATOM    218  OD1 ASP A  27      25.857   6.645  35.699  1.00  9.76           O  \nATOM    219  OD2 ASP A  27      23.868   5.947  35.086  1.00 10.25           O  \nATOM    220  N   VAL A  28      25.251   9.952  31.723  1.00  6.57           N  \nATOM    221  CA  VAL A  28      25.619  10.536  30.437  1.00  8.12           C  \nATOM    222  C   VAL A  28      26.681  11.616  30.644  1.00 10.25           C  \nATOM    223  O   VAL A  28      27.683  11.663  29.928  1.00  9.64           O  \nATOM    224  CB  VAL A  28      24.399  11.150  29.718  1.00  8.01           C  \nATOM    225  CG1 VAL A  28      24.862  11.969  28.515  1.00  9.50           C  \nATOM    226  CG2 VAL A  28      23.457  10.034  29.253  1.00  8.04           C  \nATOM    227  N   ARG A  29      26.475  12.475  31.636  1.00 10.05           N  \nATOM    228  CA  ARG A  29      27.444  13.536  31.898  1.00 11.15           C  \nATOM    229  C   ARG A  29      28.827  12.967  32.214  1.00 11.79           C  \nATOM    230  O   ARG A  29      29.835  13.455  31.704  1.00 12.01           O  \nATOM    231  CB  ARG A  29      26.970  14.422  33.053  1.00  9.99           C  \nATOM    232  CG  ARG A  29      25.831  15.367  32.695  1.00 10.18           C  \nATOM    233  CD  ARG A  29      25.445  16.189  33.912  1.00 10.25           C  \nATOM    234  NE  ARG A  29      24.425  17.192  33.628  1.00 14.64           N  \nATOM    235  CZ  ARG A  29      24.640  18.502  33.651  1.00 20.85           C  \nATOM    236  NH1 ARG A  29      25.844  18.976  33.943  1.00 20.73           N  \nATOM    237  NH2 ARG A  29      23.645  19.341  33.398  1.00 23.29           N  \nATOM    238  N   SER A  30      28.875  11.926  33.040  1.00 10.27           N  \nATOM    239  CA  SER A  30      30.149  11.310  33.406  1.00 10.98           C  \nATOM    240  C   SER A  30      30.842  10.609  32.239  1.00 13.07           C  \nATOM    241  O   SER A  30      32.064  10.454  32.245  1.00 12.79           O  \nATOM    242  CB  SER A  30      29.953  10.298  34.543  1.00  8.79           C  \nATOM    243  OG  SER A  30      29.665  10.953  35.765  1.00 12.96           O  \nATOM    244  N   SER A  31      30.067  10.189  31.243  1.00 12.07           N  \nATOM    245  CA  SER A  31      30.625   9.488  30.087  1.00 12.63           C  \nATOM    246  C   SER A  31      31.478  10.385  29.197  1.00 14.41           C  \nATOM    247  O   SER A  31      32.286   9.894  28.411  1.00 16.95           O  \nATOM    248  CB  SER A  31      29.507   8.879  29.237  1.00 15.15           C  \nATOM    249  OG  SER A  31      28.857   9.877  28.469  1.00 12.95           O  \nATOM    250  N   GLY A  32      31.289  11.694  29.312  1.00 16.32           N  \nATOM    251  CA  GLY A  32      32.051  12.623  28.496  1.00 17.33           C  \nATOM    252  C   GLY A  32      31.281  13.013  27.251  1.00 17.70           C  \nATOM    253  O   GLY A  32      31.649  13.951  26.540  1.00 16.74           O  \nATOM    254  N   SER A  33      30.205  12.284  26.981  1.00 14.11           N  \nATOM    255  CA  SER A  33      29.375  12.562  25.818  1.00 12.55           C  \nATOM    256  C   SER A  33      28.436  13.717  26.128  1.00 16.51           C  \nATOM    257  O   SER A  33      28.044  13.919  27.281  1.00 17.01           O  \nATOM    258  CB  SER A  33      28.557  11.324  25.442  1.00 12.31           C  \nATOM    259  OG  SER A  33      27.756  11.569  24.299  1.00 11.59           O  \nATOM    260  N   LYS A  34      28.081  14.476  25.099  1.00 15.42           N  \nATOM    261  CA  LYS A  34      27.176  15.601  25.267  1.00 17.53           C  \nATOM    262  C   LYS A  34      25.871  15.259  24.559  1.00 17.01           C  \nATOM    263  O   LYS A  34      24.970  16.090  24.465  1.00 17.51           O  \nATOM    264  CB  LYS A  34      27.785  16.869  24.656  1.00 21.02           C  \nATOM    265  CG  LYS A  34      29.250  17.100  25.025  1.00 25.18           C  \nATOM    266  CD  LYS A  34      29.463  17.088  26.533  1.00 29.46           C  \nATOM    267  CE  LYS A  34      30.942  17.190  26.884  1.00 31.20           C  \nATOM    268  NZ  LYS A  34      31.184  17.073  28.353  1.00 29.05           N  \nATOM    269  N   LYS A  35      25.781  14.020  24.078  1.00 16.37           N  \nATOM    270  CA  LYS A  35      24.604  13.544  23.358  1.00 13.55           C  \nATOM    271  C   LYS A  35      24.222  12.119  23.748  1.00 10.82           C  \nATOM    272  O   LYS A  35      25.074  11.303  24.092  1.00 12.00           O  \nATOM    273  CB  LYS A  35      24.861  13.551  21.851  1.00 14.65           C  \nATOM    274  CG  LYS A  35      25.180  14.899  21.239  1.00 23.77           C  \nATOM    275  CD  LYS A  35      25.571  14.724  19.774  1.00 29.96           C  \nATOM    276  CE  LYS A  35      25.766  16.063  19.075  1.00 34.03           C  \nATOM    277  NZ  LYS A  35      24.495  16.835  18.986  1.00 39.83           N  \nATOM    278  N   THR A  36      22.932  11.825  23.676  1.00 11.15           N  \nATOM    279  CA  THR A  36      22.449  10.487  23.972  1.00  9.64           C  \nATOM    280  C   THR A  36      21.129  10.278  23.253  1.00  8.90           C  \nATOM    281  O   THR A  36      20.336  11.211  23.103  1.00 11.37           O  \nATOM    282  CB  THR A  36      22.235  10.255  25.494  1.00  9.30           C  \nATOM    283  OG1 THR A  36      21.808   8.903  25.714  1.00 11.46           O  \nATOM    284  CG2 THR A  36      21.178  11.205  26.049  1.00 10.57           C  \nATOM    285  N   THR A  37      20.918   9.064  22.766  1.00  8.09           N  \nATOM    286  CA  THR A  37      19.669   8.733  22.098  1.00  8.90           C  \nATOM    287  C   THR A  37      18.999   7.773  23.072  1.00  9.34           C  \nATOM    288  O   THR A  37      19.467   6.652  23.292  1.00 10.35           O  \nATOM    289  CB  THR A  37      19.916   8.084  20.710  1.00 16.76           C  \nATOM    290  OG1 THR A  37      18.661   7.702  20.136  1.00 18.76           O  \nATOM    291  CG2 THR A  37      20.828   6.875  20.819  1.00 17.18           C  \nATOM    292  N   ILE A  38      17.924   8.254  23.685  1.00  8.42           N  \nATOM    293  CA  ILE A  38      17.186   7.508  24.697  1.00  9.46           C  \nATOM    294  C   ILE A  38      16.015   6.715  24.137  1.00 10.38           C  \nATOM    295  O   ILE A  38      15.143   7.264  23.462  1.00 11.66           O  \nATOM    296  CB  ILE A  38      16.668   8.472  25.778  1.00  9.91           C  \nATOM    297  CG1 ILE A  38      17.829   9.320  26.300  1.00 12.94           C  \nATOM    298  CG2 ILE A  38      16.015   7.697  26.913  1.00  9.08           C  \nATOM    299  CD1 ILE A  38      17.408  10.432  27.235  1.00 11.43           C  \nATOM    300  N   ASN A  39      15.999   5.422  24.441  1.00  6.80           N  \nATOM    301  CA  ASN A  39      14.946   4.527  23.976  1.00  8.56           C  \nATOM    302  C   ASN A  39      14.206   3.962  25.172  1.00  8.17           C  \nATOM    303  O   ASN A  39      14.772   3.221  25.977  1.00 12.28           O  \nATOM    304  CB  ASN A  39      15.563   3.409  23.141  1.00  6.67           C  \nATOM    305  CG  ASN A  39      16.136   3.923  21.841  1.00 11.85           C  \nATOM    306  OD1 ASN A  39      15.430   4.038  20.838  1.00 10.25           O  \nATOM    307  ND2 ASN A  39      17.416   4.264  21.856  1.00 11.82           N  \nATOM    308  N   VAL A  40      12.932   4.318  25.272  1.00  9.81           N  \nATOM    309  CA  VAL A  40      12.091   3.905  26.380  1.00 10.60           C  \nATOM    310  C   VAL A  40      11.061   2.874  25.947  1.00 11.33           C  \nATOM    311  O   VAL A  40      10.274   3.117  25.035  1.00 13.32           O  \nATOM    312  CB  VAL A  40      11.351   5.120  26.969  1.00 10.53           C  \nATOM    313  CG1 VAL A  40      10.654   4.734  28.265  1.00  9.46           C  \nATOM    314  CG2 VAL A  40      12.328   6.266  27.186  1.00 10.11           C  \nATOM    315  N   PHE A  41      11.073   1.724  26.609  1.00 10.47           N  \nATOM    316  CA  PHE A  41      10.134   0.655  26.303  1.00 10.56           C  \nATOM    317  C   PHE A  41       9.024   0.767  27.336  1.00 14.51           C  \nATOM    318  O   PHE A  41       9.169   0.343  28.482  1.00 12.82           O  \nATOM    319  CB  PHE A  41      10.880  -0.674  26.364  1.00 11.18           C  \nATOM    320  CG  PHE A  41      12.024  -0.741  25.393  1.00 13.39           C  \nATOM    321  CD1 PHE A  41      11.798  -1.046  24.052  1.00 11.41           C  \nATOM    322  CD2 PHE A  41      13.314  -0.401  25.795  1.00 13.82           C  \nATOM    323  CE1 PHE A  41      12.837  -1.005  23.125  1.00 12.58           C  \nATOM    324  CE2 PHE A  41      14.361  -0.357  24.875  1.00 16.09           C  \nATOM    325  CZ  PHE A  41      14.120  -0.659  23.535  1.00 13.07           C  \nATOM    326  N   THR A  42       7.918   1.371  26.909  1.00 15.02           N  \nATOM    327  CA  THR A  42       6.788   1.623  27.790  1.00 14.54           C  \nATOM    328  C   THR A  42       5.495   1.721  26.988  1.00 15.87           C  \nATOM    329  O   THR A  42       5.521   1.803  25.764  1.00 14.97           O  \nATOM    330  CB  THR A  42       7.011   2.962  28.532  1.00 16.35           C  \nATOM    331  OG1 THR A  42       5.902   3.242  29.391  1.00 16.32           O  \nATOM    332  CG2 THR A  42       7.166   4.098  27.525  1.00 15.89           C  \nATOM    333  N   GLU A  43       4.366   1.718  27.689  1.00 18.33           N  \nATOM    334  CA  GLU A  43       3.063   1.834  27.041  1.00 22.06           C  \nATOM    335  C   GLU A  43       2.551   3.265  27.188  1.00 23.02           C  \nATOM    336  O   GLU A  43       1.500   3.621  26.656  1.00 22.29           O  \nATOM    337  CB  GLU A  43       2.065   0.859  27.673  1.00 21.32           C  \nATOM    338  CG  GLU A  43       2.461  -0.607  27.557  1.00 26.43           C  \nATOM    339  CD  GLU A  43       2.665  -1.048  26.118  1.00 31.13           C  \nATOM    340  OE1 GLU A  43       1.763  -0.802  25.290  1.00 33.47           O  \nATOM    341  OE2 GLU A  43       3.724  -1.642  25.815  1.00 32.35           O  \nATOM    342  N   ILE A  44       3.311   4.083  27.910  1.00 23.91           N  \nATOM    343  CA  ILE A  44       2.948   5.476  28.149  1.00 26.52           C  \nATOM    344  C   ILE A  44       3.168   6.328  26.894  1.00 27.74           C  \nATOM    345  O   ILE A  44       3.974   5.976  26.033  1.00 24.73           O  \nATOM    346  CB  ILE A  44       3.783   6.040  29.326  1.00 28.12           C  \nATOM    347  CG1 ILE A  44       2.971   7.072  30.104  1.00 28.57           C  \nATOM    348  CG2 ILE A  44       5.080   6.650  28.810  1.00 24.21           C  \nATOM    349  CD1 ILE A  44       3.649   7.523  31.384  1.00 31.00           C  \nATOM    350  N   GLN A  45       2.447   7.444  26.787  1.00 29.19           N  \nATOM    351  CA  GLN A  45       2.580   8.334  25.633  1.00 30.61           C  \nATOM    352  C   GLN A  45       3.693   9.358  25.823  1.00 28.49           C  \nATOM    353  O   GLN A  45       4.030   9.722  26.950  1.00 29.37           O  \nATOM    354  CB  GLN A  45       1.258   9.058  25.363  1.00 36.95           C  \nATOM    355  CG  GLN A  45       0.165   8.172  24.788  1.00 48.09           C  \nATOM    356  CD  GLN A  45       0.496   7.672  23.394  1.00 54.95           C  \nATOM    357  OE1 GLN A  45       0.715   8.463  22.477  1.00 59.19           O  \nATOM    358  NE2 GLN A  45       0.531   6.354  23.229  1.00 59.21           N  \nATOM    359  N   TYR A  46       4.248   9.823  24.708  1.00 24.28           N  \nATOM    360  CA  TYR A  46       5.337  10.793  24.713  1.00 24.71           C  \nATOM    361  C   TYR A  46       5.090  11.982  25.639  1.00 25.54           C  \nATOM    362  O   TYR A  46       5.881  12.250  26.541  1.00 22.81           O  \nATOM    363  CB  TYR A  46       5.583  11.314  23.296  1.00 23.11           C  \nATOM    364  CG  TYR A  46       6.881  12.075  23.142  1.00 27.98           C  \nATOM    365  CD1 TYR A  46       8.087  11.399  22.962  1.00 31.13           C  \nATOM    366  CD2 TYR A  46       6.910  13.468  23.200  1.00 28.93           C  \nATOM    367  CE1 TYR A  46       9.291  12.088  22.845  1.00 32.93           C  \nATOM    368  CE2 TYR A  46       8.113  14.169  23.086  1.00 32.03           C  \nATOM    369  CZ  TYR A  46       9.298  13.470  22.909  1.00 32.08           C  \nATOM    370  OH  TYR A  46      10.492  14.148  22.803  1.00 33.47           O  \nATOM    371  N   GLN A  47       3.994  12.697  25.406  1.00 24.63           N  \nATOM    372  CA  GLN A  47       3.667  13.870  26.208  1.00 25.17           C  \nATOM    373  C   GLN A  47       3.568  13.610  27.706  1.00 23.21           C  \nATOM    374  O   GLN A  47       3.976  14.450  28.507  1.00 24.07           O  \nATOM    375  CB  GLN A  47       2.370  14.508  25.706  1.00 28.35           C  \nATOM    376  CG  GLN A  47       2.495  15.121  24.321  1.00 36.99           C  \nATOM    377  CD  GLN A  47       3.718  16.012  24.190  1.00 43.34           C  \nATOM    378  OE1 GLN A  47       3.944  16.904  25.011  1.00 46.34           O  \nATOM    379  NE2 GLN A  47       4.514  15.776  23.152  1.00 45.64           N  \nATOM    380  N   GLU A  48       3.025  12.459  28.091  1.00 23.97           N  \nATOM    381  CA  GLU A  48       2.911  12.138  29.507  1.00 22.97           C  \nATOM    382  C   GLU A  48       4.296  11.901  30.099  1.00 22.51           C  \nATOM    383  O   GLU A  48       4.583  12.325  31.217  1.00 17.54           O  \nATOM    384  CB  GLU A  48       2.029  10.903  29.720  1.00 27.75           C  \nATOM    385  CG  GLU A  48       2.033  10.402  31.160  1.00 35.85           C  \nATOM    386  CD  GLU A  48       0.862   9.493  31.483  1.00 42.98           C  \nATOM    387  OE1 GLU A  48       0.527   8.621  30.652  1.00 46.34           O  \nATOM    388  OE2 GLU A  48       0.281   9.645  32.578  1.00 44.85           O  \nATOM    389  N   LEU A  49       5.157  11.228  29.342  1.00 18.62           N  \nATOM    390  CA  LEU A  49       6.510  10.961  29.811  1.00 18.78           C  \nATOM    391  C   LEU A  49       7.267  12.268  30.002  1.00 17.00           C  \nATOM    392  O   LEU A  49       7.848  12.511  31.058  1.00 16.05           O  \nATOM    393  CB  LEU A  49       7.269  10.084  28.811  1.00 16.29           C  \nATOM    394  CG  LEU A  49       8.755   9.895  29.139  1.00 16.44           C  \nATOM    395  CD1 LEU A  49       8.901   9.183  30.479  1.00 17.18           C  \nATOM    396  CD2 LEU A  49       9.432   9.102  28.033  1.00 19.52           C  \nATOM    397  N   VAL A  50       7.262  13.102  28.967  1.00 16.87           N  \nATOM    398  CA  VAL A  50       7.953  14.385  29.010  1.00 15.59           C  \nATOM    399  C   VAL A  50       7.490  15.214  30.201  1.00 17.36           C  \nATOM    400  O   VAL A  50       8.260  15.984  30.771  1.00 15.94           O  \nATOM    401  CB  VAL A  50       7.715  15.185  27.712  1.00 20.49           C  \nATOM    402  CG1 VAL A  50       8.450  16.511  27.775  1.00 22.89           C  \nATOM    403  CG2 VAL A  50       8.186  14.373  26.511  1.00 20.90           C  \nATOM    404  N   THR A  51       6.222  15.061  30.568  1.00 16.58           N  \nATOM    405  CA  THR A  51       5.677  15.789  31.705  1.00 13.61           C  \nATOM    406  C   THR A  51       6.308  15.251  32.989  1.00 13.20           C  \nATOM    407  O   THR A  51       6.723  16.020  33.856  1.00 14.98           O  \nATOM    408  CB  THR A  51       4.147  15.633  31.774  1.00 16.56           C  \nATOM    409  OG1 THR A  51       3.559  16.293  30.645  1.00 19.12           O  \nATOM    410  CG2 THR A  51       3.597  16.237  33.060  1.00 17.52           C  \nATOM    411  N   LEU A  52       6.396  13.929  33.099  1.00 13.91           N  \nATOM    412  CA  LEU A  52       6.985  13.303  34.279  1.00 13.78           C  \nATOM    413  C   LEU A  52       8.467  13.623  34.464  1.00 16.52           C  \nATOM    414  O   LEU A  52       8.925  13.837  35.587  1.00 20.03           O  \nATOM    415  CB  LEU A  52       6.814  11.781  34.219  1.00 15.00           C  \nATOM    416  CG  LEU A  52       5.407  11.210  34.404  1.00 18.12           C  \nATOM    417  CD1 LEU A  52       5.443   9.698  34.229  1.00 19.35           C  \nATOM    418  CD2 LEU A  52       4.885  11.576  35.785  1.00 20.14           C  \nATOM    419  N   ILE A  53       9.220  13.657  33.371  1.00 13.70           N  \nATOM    420  CA  ILE A  53      10.653  13.921  33.466  1.00 15.34           C  \nATOM    421  C   ILE A  53      11.051  15.357  33.146  1.00 16.08           C  \nATOM    422  O   ILE A  53      12.228  15.643  32.926  1.00 12.68           O  \nATOM    423  CB  ILE A  53      11.451  12.979  32.540  1.00 13.70           C  \nATOM    424  CG1 ILE A  53      11.137  13.288  31.076  1.00 12.89           C  \nATOM    425  CG2 ILE A  53      11.112  11.530  32.859  1.00 15.48           C  \nATOM    426  CD1 ILE A  53      11.973  12.498  30.092  1.00 17.37           C  \nATOM    427  N   ARG A  54      10.075  16.259  33.133  1.00 14.93           N  \nATOM    428  CA  ARG A  54      10.339  17.663  32.831  1.00 17.46           C  \nATOM    429  C   ARG A  54      11.521  18.227  33.615  1.00 15.05           C  \nATOM    430  O   ARG A  54      12.396  18.875  33.043  1.00 13.17           O  \nATOM    431  CB  ARG A  54       9.100  18.515  33.120  1.00 21.33           C  \nATOM    432  CG  ARG A  54       9.292  19.993  32.805  1.00 27.86           C  \nATOM    433  CD  ARG A  54       8.119  20.838  33.282  1.00 38.40           C  \nATOM    434  NE  ARG A  54       7.921  20.738  34.727  1.00 45.55           N  \nATOM    435  CZ  ARG A  54       6.935  20.058  35.304  1.00 48.28           C  \nATOM    436  NH1 ARG A  54       6.838  20.021  36.627  1.00 49.43           N  \nATOM    437  NH2 ARG A  54       6.037  19.424  34.560  1.00 44.89           N  \nATOM    438  N   GLU A  55      11.542  17.982  34.922  1.00 14.40           N  \nATOM    439  CA  GLU A  55      12.616  18.484  35.777  1.00 18.96           C  \nATOM    440  C   GLU A  55      13.983  17.950  35.365  1.00 15.03           C  \nATOM    441  O   GLU A  55      14.967  18.691  35.337  1.00 13.65           O  \nATOM    442  CB  GLU A  55      12.335  18.123  37.240  1.00 20.18           C  \nATOM    443  CG  GLU A  55      13.348  18.673  38.231  1.00 27.21           C  \nATOM    444  CD  GLU A  55      13.525  20.176  38.117  1.00 30.48           C  \nATOM    445  OE1 GLU A  55      12.515  20.882  37.911  1.00 32.00           O  \nATOM    446  OE2 GLU A  55      14.673  20.653  38.246  1.00 30.82           O  \nATOM    447  N   ALA A  56      14.046  16.664  35.041  1.00 15.12           N  \nATOM    448  CA  ALA A  56      15.308  16.061  34.628  1.00 13.23           C  \nATOM    449  C   ALA A  56      15.794  16.704  33.334  1.00 12.47           C  \nATOM    450  O   ALA A  56      16.980  16.980  33.175  1.00 12.54           O  \nATOM    451  CB  ALA A  56      15.137  14.559  34.439  1.00 12.68           C  \nATOM    452  N   LEU A  57      14.873  16.938  32.404  1.00  8.74           N  \nATOM    453  CA  LEU A  57      15.230  17.554  31.136  1.00  7.77           C  \nATOM    454  C   LEU A  57      15.739  18.981  31.332  1.00  8.61           C  \nATOM    455  O   LEU A  57      16.717  19.390  30.700  1.00  9.52           O  \nATOM    456  CB  LEU A  57      14.023  17.558  30.189  1.00 10.14           C  \nATOM    457  CG  LEU A  57      13.440  16.175  29.888  1.00  9.25           C  \nATOM    458  CD1 LEU A  57      12.287  16.312  28.914  1.00 10.72           C  \nATOM    459  CD2 LEU A  57      14.518  15.277  29.300  1.00 10.29           C  \nATOM    460  N   LEU A  58      15.081  19.731  32.211  1.00  9.14           N  \nATOM    461  CA  LEU A  58      15.472  21.111  32.480  1.00 10.13           C  \nATOM    462  C   LEU A  58      16.850  21.191  33.132  1.00  9.44           C  \nATOM    463  O   LEU A  58      17.678  22.021  32.756  1.00  9.82           O  \nATOM    464  CB  LEU A  58      14.433  21.785  33.386  1.00 13.24           C  \nATOM    465  CG  LEU A  58      14.756  23.201  33.871  1.00 18.30           C  \nATOM    466  CD1 LEU A  58      14.880  24.140  32.686  1.00 21.51           C  \nATOM    467  CD2 LEU A  58      13.657  23.679  34.814  1.00 25.65           C  \nATOM    468  N   GLU A  59      17.090  20.322  34.107  1.00  8.78           N  \nATOM    469  CA  GLU A  59      18.364  20.302  34.818  1.00 11.12           C  \nATOM    470  C   GLU A  59      19.538  19.936  33.920  1.00 11.69           C  \nATOM    471  O   GLU A  59      20.687  20.279  34.210  1.00 12.28           O  \nATOM    472  CB  GLU A  59      18.304  19.309  35.980  1.00 13.15           C  \nATOM    473  CG  GLU A  59      17.497  19.777  37.170  1.00 17.13           C  \nATOM    474  CD  GLU A  59      17.449  18.742  38.275  1.00 18.20           C  \nATOM    475  OE1 GLU A  59      18.404  17.944  38.381  1.00 18.34           O  \nATOM    476  OE2 GLU A  59      16.466  18.734  39.045  1.00 19.18           O  \nATOM    477  N   ASN A  60      19.249  19.245  32.826  1.00  9.78           N  \nATOM    478  CA  ASN A  60      20.295  18.811  31.914  1.00 10.61           C  \nATOM    479  C   ASN A  60      20.108  19.363  30.509  1.00 12.44           C  \nATOM    480  O   ASN A  60      20.324  18.670  29.515  1.00 10.50           O  \nATOM    481  CB  ASN A  60      20.327  17.286  31.914  1.00 11.88           C  \nATOM    482  CG  ASN A  60      20.659  16.731  33.279  1.00 11.93           C  \nATOM    483  OD1 ASN A  60      21.817  16.741  33.693  1.00 13.53           O  \nATOM    484  ND2 ASN A  60      19.640  16.277  34.007  1.00  9.60           N  \nATOM    485  N   ILE A  61      19.726  20.634  30.453  1.00 14.87           N  \nATOM    486  CA  ILE A  61      19.486  21.340  29.203  1.00 14.76           C  \nATOM    487  C   ILE A  61      20.688  21.322  28.253  1.00 15.03           C  \nATOM    488  O   ILE A  61      20.517  21.351  27.035  1.00 13.45           O  \nATOM    489  CB  ILE A  61      19.085  22.812  29.492  1.00 15.88           C  \nATOM    490  CG1 ILE A  61      18.626  23.505  28.208  1.00 20.00           C  \nATOM    491  CG2 ILE A  61      20.250  23.555  30.119  1.00 19.27           C  \nATOM    492  CD1 ILE A  61      17.277  23.039  27.718  1.00 24.49           C  \nATOM    493  N   ASP A  62      21.900  21.274  28.803  1.00 13.67           N  \nATOM    494  CA  ASP A  62      23.103  21.264  27.972  1.00 14.54           C  \nATOM    495  C   ASP A  62      23.280  19.967  27.191  1.00 14.65           C  \nATOM    496  O   ASP A  62      23.929  19.953  26.146  1.00 18.15           O  \nATOM    497  CB  ASP A  62      24.359  21.499  28.819  1.00 17.19           C  \nATOM    498  CG  ASP A  62      24.426  22.899  29.397  1.00 23.32           C  \nATOM    499  OD1 ASP A  62      23.613  23.757  28.991  1.00 22.32           O  \nATOM    500  OD2 ASP A  62      25.304  23.141  30.253  1.00 23.74           O  \nATOM    501  N   ILE A  63      22.711  18.880  27.699  1.00 12.30           N  \nATOM    502  CA  ILE A  63      22.830  17.585  27.038  1.00 12.18           C  \nATOM    503  C   ILE A  63      21.861  17.474  25.867  1.00 14.22           C  \nATOM    504  O   ILE A  63      20.675  17.746  26.010  1.00 18.15           O  \nATOM    505  CB  ILE A  63      22.543  16.420  28.018  1.00 13.92           C  \nATOM    506  CG1 ILE A  63      23.548  16.441  29.172  1.00 17.28           C  \nATOM    507  CG2 ILE A  63      22.620  15.091  27.280  1.00 14.00           C  \nATOM    508  CD1 ILE A  63      24.995  16.287  28.735  1.00 17.06           C  \nATOM    509  N   GLY A  64      22.375  17.081  24.708  1.00 14.14           N  \nATOM    510  CA  GLY A  64      21.516  16.922  23.552  1.00 16.94           C  \nATOM    511  C   GLY A  64      20.961  15.515  23.593  1.00 18.30           C  \nATOM    512  O   GLY A  64      21.693  14.568  23.869  1.00 20.02           O  \nATOM    513  N   TYR A  65      19.673  15.357  23.331  1.00 18.65           N  \nATOM    514  CA  TYR A  65      19.100  14.024  23.372  1.00 18.31           C  \nATOM    515  C   TYR A  65      17.954  13.851  22.395  1.00 20.44           C  \nATOM    516  O   TYR A  65      17.351  14.821  21.934  1.00 19.03           O  \nATOM    517  CB  TYR A  65      18.598  13.718  24.790  1.00 22.93           C  \nATOM    518  CG  TYR A  65      17.282  14.393  25.118  1.00 22.93           C  \nATOM    519  CD1 TYR A  65      16.071  13.842  24.693  1.00 27.91           C  \nATOM    520  CD2 TYR A  65      17.249  15.608  25.797  1.00 24.79           C  \nATOM    521  CE1 TYR A  65      14.862  14.486  24.929  1.00 26.74           C  \nATOM    522  CE2 TYR A  65      16.042  16.264  26.040  1.00 26.83           C  \nATOM    523  CZ  TYR A  65      14.853  15.695  25.600  1.00 28.42           C  \nATOM    524  OH  TYR A  65      13.655  16.334  25.824  1.00 30.78           O  \nATOM    525  N   GLU A  66      17.679  12.593  22.080  1.00 19.35           N  \nATOM    526  CA  GLU A  66      16.576  12.221  21.212  1.00 18.13           C  \nATOM    527  C   GLU A  66      15.814  11.238  22.081  1.00 17.07           C  \nATOM    528  O   GLU A  66      16.422  10.477  22.836  1.00 13.89           O  \nATOM    529  CB  GLU A  66      17.066  11.523  19.944  1.00 22.10           C  \nATOM    530  CG  GLU A  66      17.781  12.427  18.959  1.00 31.96           C  \nATOM    531  CD  GLU A  66      18.028  11.743  17.627  1.00 38.40           C  \nATOM    532  OE1 GLU A  66      18.679  10.676  17.616  1.00 42.11           O  \nATOM    533  OE2 GLU A  66      17.569  12.272  16.592  1.00 43.89           O  \nATOM    534  N   LEU A  67      14.491  11.264  21.992  1.00 15.56           N  \nATOM    535  CA  LEU A  67      13.666  10.376  22.794  1.00 14.40           C  \nATOM    536  C   LEU A  67      12.745   9.543  21.909  1.00 14.70           C  \nATOM    537  O   LEU A  67      11.996  10.080  21.093  1.00 15.80           O  \nATOM    538  CB  LEU A  67      12.839  11.203  23.785  1.00 16.90           C  \nATOM    539  CG  LEU A  67      11.914  10.470  24.757  1.00 19.24           C  \nATOM    540  CD1 LEU A  67      12.727   9.532  25.637  1.00 21.66           C  \nATOM    541  CD2 LEU A  67      11.172  11.489  25.610  1.00 20.68           C  \nATOM    542  N   PHE A  68      12.818   8.227  22.076  1.00 11.13           N  \nATOM    543  CA  PHE A  68      11.996   7.298  21.314  1.00 12.93           C  \nATOM    544  C   PHE A  68      11.285   6.355  22.272  1.00 12.63           C  \nATOM    545  O   PHE A  68      11.911   5.759  23.149  1.00 12.01           O  \nATOM    546  CB  PHE A  68      12.866   6.479  20.355  1.00 12.05           C  \nATOM    547  CG  PHE A  68      13.523   7.296  19.285  1.00 14.59           C  \nATOM    548  CD1 PHE A  68      12.792   7.756  18.195  1.00 14.07           C  \nATOM    549  CD2 PHE A  68      14.870   7.625  19.375  1.00 15.16           C  \nATOM    550  CE1 PHE A  68      13.394   8.532  17.208  1.00 15.37           C  \nATOM    551  CE2 PHE A  68      15.482   8.401  18.393  1.00 17.63           C  \nATOM    552  CZ  PHE A  68      14.744   8.856  17.308  1.00 18.22           C  \nATOM    553  N   LEU A  69       9.974   6.232  22.112  1.00 12.84           N  \nATOM    554  CA  LEU A  69       9.198   5.334  22.955  1.00 13.24           C  \nATOM    555  C   LEU A  69       8.765   4.137  22.123  1.00 14.32           C  \nATOM    556  O   LEU A  69       8.332   4.289  20.978  1.00 13.65           O  \nATOM    557  CB  LEU A  69       7.968   6.046  23.526  1.00 14.24           C  \nATOM    558  CG  LEU A  69       8.206   6.979  24.718  1.00 18.28           C  \nATOM    559  CD1 LEU A  69       9.175   8.085  24.331  1.00 18.52           C  \nATOM    560  CD2 LEU A  69       6.879   7.565  25.175  1.00 19.14           C  \nATOM    561  N   TRP A  70       8.900   2.949  22.702  1.00 12.36           N  \nATOM    562  CA  TRP A  70       8.536   1.716  22.025  1.00 13.82           C  \nATOM    563  C   TRP A  70       7.665   0.826  22.889  1.00 14.23           C  \nATOM    564  O   TRP A  70       7.958   0.612  24.063  1.00 14.03           O  \nATOM    565  CB  TRP A  70       9.783   0.908  21.663  1.00 10.85           C  \nATOM    566  CG  TRP A  70      10.830   1.673  20.944  1.00 10.51           C  \nATOM    567  CD1 TRP A  70      12.000   2.158  21.461  1.00 11.33           C  \nATOM    568  CD2 TRP A  70      10.815   2.036  19.565  1.00  9.50           C  \nATOM    569  NE1 TRP A  70      12.718   2.801  20.477  1.00 10.64           N  \nATOM    570  CE2 TRP A  70      12.012   2.740  19.305  1.00  9.79           C  \nATOM    571  CE3 TRP A  70       9.905   1.834  18.520  1.00 12.09           C  \nATOM    572  CZ2 TRP A  70      12.322   3.243  18.038  1.00 11.85           C  \nATOM    573  CZ3 TRP A  70      10.215   2.336  17.259  1.00 12.80           C  \nATOM    574  CH2 TRP A  70      11.414   3.031  17.031  1.00 14.03           C  \nATOM    575  N   LYS A  71       6.585   0.311  22.315  1.00 16.48           N  \nATOM    576  CA  LYS A  71       5.751  -0.615  23.057  1.00 18.93           C  \nATOM    577  C   LYS A  71       6.589  -1.886  22.981  1.00 22.72           C  \nATOM    578  O   LYS A  71       7.369  -2.052  22.045  1.00 20.37           O  \nATOM    579  CB  LYS A  71       4.404  -0.808  22.362  1.00 21.31           C  \nATOM    580  CG  LYS A  71       3.515   0.422  22.417  1.00 26.79           C  \nATOM    581  CD  LYS A  71       2.153   0.147  21.800  1.00 34.56           C  \nATOM    582  CE  LYS A  71       1.226   1.341  21.964  1.00 38.54           C  \nATOM    583  NZ  LYS A  71       1.787   2.569  21.336  1.00 42.94           N  \nATOM    584  N   LYS A  72       6.453  -2.775  23.957  1.00 25.48           N  \nATOM    585  CA  LYS A  72       7.250  -3.995  23.956  1.00 28.37           C  \nATOM    586  C   LYS A  72       7.172  -4.780  22.646  1.00 25.79           C  \nATOM    587  O   LYS A  72       8.112  -5.485  22.282  1.00 26.09           O  \nATOM    588  CB  LYS A  72       6.847  -4.875  25.142  1.00 33.91           C  \nATOM    589  CG  LYS A  72       7.142  -4.215  26.484  1.00 41.92           C  \nATOM    590  CD  LYS A  72       6.760  -5.093  27.661  1.00 49.29           C  \nATOM    591  CE  LYS A  72       7.062  -4.389  28.976  1.00 53.30           C  \nATOM    592  NZ  LYS A  72       6.675  -5.210  30.154  1.00 56.26           N  \nATOM    593  N   ASN A  73       6.063  -4.638  21.929  1.00 22.90           N  \nATOM    594  CA  ASN A  73       5.882  -5.339  20.663  1.00 22.29           C  \nATOM    595  C   ASN A  73       6.590  -4.636  19.501  1.00 18.11           C  \nATOM    596  O   ASN A  73       6.606  -5.141  18.379  1.00 16.58           O  \nATOM    597  CB  ASN A  73       4.388  -5.471  20.351  1.00 26.17           C  \nATOM    598  CG  ASN A  73       3.713  -4.126  20.148  1.00 30.05           C  \nATOM    599  OD1 ASN A  73       3.996  -3.417  19.182  1.00 34.23           O  \nATOM    600  ND2 ASN A  73       2.815  -3.767  21.060  1.00 33.29           N  \nATOM    601  N   GLU A  74       7.181  -3.476  19.774  1.00 15.76           N  \nATOM    602  CA  GLU A  74       7.876  -2.716  18.737  1.00 12.60           C  \nATOM    603  C   GLU A  74       9.394  -2.799  18.865  1.00 10.48           C  \nATOM    604  O   GLU A  74      10.123  -2.059  18.200  1.00  9.42           O  \nATOM    605  CB  GLU A  74       7.441  -1.250  18.779  1.00 16.35           C  \nATOM    606  CG  GLU A  74       5.944  -1.042  18.607  1.00 17.92           C  \nATOM    607  CD  GLU A  74       5.549   0.420  18.673  1.00 20.34           C  \nATOM    608  OE1 GLU A  74       5.999   1.117  19.606  1.00 16.46           O  \nATOM    609  OE2 GLU A  74       4.782   0.874  17.800  1.00 19.67           O  \nATOM    610  N   VAL A  75       9.871  -3.700  19.715  1.00  9.06           N  \nATOM    611  CA  VAL A  75      11.307  -3.853  19.904  1.00 10.52           C  \nATOM    612  C   VAL A  75      12.000  -4.150  18.577  1.00 10.22           C  \nATOM    613  O   VAL A  75      13.149  -3.753  18.366  1.00 11.77           O  \nATOM    614  CB  VAL A  75      11.630  -4.984  20.903  1.00 11.34           C  \nATOM    615  CG1 VAL A  75      13.144  -5.106  21.081  1.00 15.60           C  \nATOM    616  CG2 VAL A  75      10.972  -4.693  22.241  1.00 17.33           C  \nATOM    617  N   ASP A  76      11.312  -4.838  17.672  1.00  9.91           N  \nATOM    618  CA  ASP A  76      11.929  -5.147  16.387  1.00 12.34           C  \nATOM    619  C   ASP A  76      12.226  -3.892  15.563  1.00  9.21           C  \nATOM    620  O   ASP A  76      13.214  -3.852  14.831  1.00  9.36           O  \nATOM    621  CB  ASP A  76      11.070  -6.145  15.589  1.00 14.04           C  \nATOM    622  CG  ASP A  76       9.660  -5.646  15.307  1.00 17.54           C  \nATOM    623  OD1 ASP A  76       9.238  -4.607  15.857  1.00 13.26           O  \nATOM    624  OD2 ASP A  76       8.960  -6.325  14.525  1.00 15.98           O  \nATOM    625  N   ILE A  77      11.388  -2.865  15.690  1.00  7.60           N  \nATOM    626  CA  ILE A  77      11.612  -1.620  14.956  1.00  8.71           C  \nATOM    627  C   ILE A  77      12.832  -0.927  15.568  1.00  9.62           C  \nATOM    628  O   ILE A  77      13.683  -0.391  14.857  1.00  8.90           O  \nATOM    629  CB  ILE A  77      10.393  -0.676  15.051  1.00 10.93           C  \nATOM    630  CG1 ILE A  77       9.149  -1.364  14.476  1.00 10.71           C  \nATOM    631  CG2 ILE A  77      10.673   0.611  14.282  1.00 10.85           C  \nATOM    632  CD1 ILE A  77       7.862  -0.594  14.705  1.00 12.30           C  \nATOM    633  N   PHE A  78      12.907  -0.944  16.894  1.00  7.81           N  \nATOM    634  CA  PHE A  78      14.037  -0.347  17.592  1.00  8.65           C  \nATOM    635  C   PHE A  78      15.349  -0.969  17.115  1.00 11.53           C  \nATOM    636  O   PHE A  78      16.296  -0.264  16.767  1.00 11.69           O  \nATOM    637  CB  PHE A  78      13.900  -0.555  19.101  1.00  8.63           C  \nATOM    638  CG  PHE A  78      15.210  -0.506  19.831  1.00 10.37           C  \nATOM    639  CD1 PHE A  78      15.906   0.690  19.962  1.00 13.42           C  \nATOM    640  CD2 PHE A  78      15.776  -1.673  20.335  1.00 11.53           C  \nATOM    641  CE1 PHE A  78      17.155   0.722  20.581  1.00 15.39           C  \nATOM    642  CE2 PHE A  78      17.025  -1.651  20.955  1.00 11.81           C  \nATOM    643  CZ  PHE A  78      17.713  -0.451  21.077  1.00 14.87           C  \nATOM    644  N   LEU A  79      15.400  -2.296  17.108  1.00 10.16           N  \nATOM    645  CA  LEU A  79      16.603  -3.000  16.689  1.00  9.69           C  \nATOM    646  C   LEU A  79      16.961  -2.733  15.231  1.00 10.98           C  \nATOM    647  O   LEU A  79      18.139  -2.623  14.893  1.00 10.05           O  \nATOM    648  CB  LEU A  79      16.443  -4.500  16.940  1.00 11.59           C  \nATOM    649  CG  LEU A  79      16.470  -4.879  18.425  1.00  9.25           C  \nATOM    650  CD1 LEU A  79      15.977  -6.304  18.620  1.00 13.42           C  \nATOM    651  CD2 LEU A  79      17.888  -4.720  18.953  1.00 12.07           C  \nATOM    652  N   LYS A  80      15.954  -2.620  14.369  1.00 10.41           N  \nATOM    653  CA  LYS A  80      16.218  -2.349  12.958  1.00 10.15           C  \nATOM    654  C   LYS A  80      16.780  -0.939  12.799  1.00 10.76           C  \nATOM    655  O   LYS A  80      17.782  -0.733  12.114  1.00 10.37           O  \nATOM    656  CB  LYS A  80      14.940  -2.495  12.126  1.00 12.27           C  \nATOM    657  CG  LYS A  80      15.145  -2.238  10.633  1.00 16.44           C  \nATOM    658  CD  LYS A  80      16.171  -3.193  10.040  1.00 20.17           C  \nATOM    659  CE  LYS A  80      16.448  -2.877   8.575  1.00 24.66           C  \nATOM    660  NZ  LYS A  80      17.426  -3.837   7.977  1.00 25.43           N  \nATOM    661  N   ASN A  81      16.134   0.032  13.438  1.00  8.82           N  \nATOM    662  CA  ASN A  81      16.580   1.417  13.367  1.00  9.52           C  \nATOM    663  C   ASN A  81      17.985   1.579  13.938  1.00  9.21           C  \nATOM    664  O   ASN A  81      18.736   2.458  13.516  1.00  8.16           O  \nATOM    665  CB  ASN A  81      15.615   2.325  14.133  1.00  6.26           C  \nATOM    666  CG  ASN A  81      14.281   2.498  13.423  1.00  9.62           C  \nATOM    667  OD1 ASN A  81      14.035   1.894  12.378  1.00  9.19           O  \nATOM    668  ND2 ASN A  81      13.414   3.328  13.993  1.00  6.70           N  \nATOM    669  N   LEU A  82      18.331   0.736  14.904  1.00  8.29           N  \nATOM    670  CA  LEU A  82      19.650   0.796  15.531  1.00  9.25           C  \nATOM    671  C   LEU A  82      20.761   0.619  14.493  1.00 10.59           C  \nATOM    672  O   LEU A  82      21.870   1.130  14.661  1.00  9.88           O  \nATOM    673  CB  LEU A  82      19.762  -0.282  16.614  1.00  9.95           C  \nATOM    674  CG  LEU A  82      21.043  -0.292  17.456  1.00 14.09           C  \nATOM    675  CD1 LEU A  82      21.245   1.066  18.111  1.00 13.71           C  \nATOM    676  CD2 LEU A  82      20.950  -1.389  18.509  1.00 10.74           C  \nATOM    677  N   GLU A  83      20.458  -0.095  13.413  1.00  9.50           N  \nATOM    678  CA  GLU A  83      21.448  -0.317  12.362  1.00 11.88           C  \nATOM    679  C   GLU A  83      21.947   0.992  11.755  1.00 12.86           C  \nATOM    680  O   GLU A  83      23.071   1.058  11.257  1.00 13.04           O  \nATOM    681  CB  GLU A  83      20.865  -1.191  11.249  1.00 12.61           C  \nATOM    682  CG  GLU A  83      20.452  -2.577  11.705  1.00 14.42           C  \nATOM    683  CD  GLU A  83      19.991  -3.454  10.558  1.00 18.48           C  \nATOM    684  OE1 GLU A  83      19.859  -2.939   9.430  1.00 18.66           O  \nATOM    685  OE2 GLU A  83      19.754  -4.658  10.787  1.00 22.59           O  \nATOM    686  N   LYS A  84      21.115   2.030  11.799  1.00 11.63           N  \nATOM    687  CA  LYS A  84      21.477   3.330  11.232  1.00 14.14           C  \nATOM    688  C   LYS A  84      21.896   4.374  12.268  1.00 16.24           C  \nATOM    689  O   LYS A  84      22.274   5.489  11.911  1.00 17.54           O  \nATOM    690  CB  LYS A  84      20.302   3.900  10.431  1.00 13.67           C  \nATOM    691  CG  LYS A  84      19.888   3.087   9.219  1.00 18.74           C  \nATOM    692  CD  LYS A  84      18.672   3.720   8.549  1.00 19.43           C  \nATOM    693  CE  LYS A  84      18.253   2.953   7.308  1.00 25.40           C  \nATOM    694  NZ  LYS A  84      19.315   2.959   6.266  1.00 30.14           N  \nATOM    695  N   SER A  85      21.823   4.016  13.544  1.00 12.83           N  \nATOM    696  CA  SER A  85      22.165   4.943  14.616  1.00 16.34           C  \nATOM    697  C   SER A  85      23.641   4.895  14.983  1.00 17.60           C  \nATOM    698  O   SER A  85      24.186   3.830  15.267  1.00 14.60           O  \nATOM    699  CB  SER A  85      21.316   4.638  15.855  1.00 18.24           C  \nATOM    700  OG  SER A  85      21.550   5.583  16.885  1.00 25.32           O  \nATOM    701  N   GLU A  86      24.281   6.058  14.976  1.00 16.65           N  \nATOM    702  CA  GLU A  86      25.691   6.148  15.318  1.00 20.54           C  \nATOM    703  C   GLU A  86      25.847   6.356  16.818  1.00 19.99           C  \nATOM    704  O   GLU A  86      25.795   7.484  17.308  1.00 23.78           O  \nATOM    705  CB  GLU A  86      26.349   7.301  14.555  1.00 25.96           C  \nATOM    706  CG  GLU A  86      27.754   7.656  15.035  1.00 39.12           C  \nATOM    707  CD  GLU A  86      28.656   6.445  15.179  1.00 45.75           C  \nATOM    708  OE1 GLU A  86      28.753   5.654  14.216  1.00 50.19           O  \nATOM    709  OE2 GLU A  86      29.275   6.290  16.256  1.00 50.06           O  \nATOM    710  N   VAL A  87      26.020   5.254  17.540  1.00 20.16           N  \nATOM    711  CA  VAL A  87      26.198   5.286  18.989  1.00 18.68           C  \nATOM    712  C   VAL A  87      27.523   4.612  19.338  1.00 18.77           C  \nATOM    713  O   VAL A  87      27.977   3.724  18.616  1.00 17.50           O  \nATOM    714  CB  VAL A  87      25.051   4.552  19.704  1.00 18.06           C  \nATOM    715  CG1 VAL A  87      23.748   5.309  19.504  1.00 20.67           C  \nATOM    716  CG2 VAL A  87      24.926   3.138  19.163  1.00 18.82           C  \nATOM    717  N   ASP A  88      28.144   5.031  20.439  1.00 16.11           N  \nATOM    718  CA  ASP A  88      29.428   4.461  20.846  1.00 16.31           C  \nATOM    719  C   ASP A  88      29.521   4.009  22.300  1.00 20.76           C  \nATOM    720  O   ASP A  88      30.507   3.385  22.698  1.00 25.38           O  \nATOM    721  CB  ASP A  88      30.556   5.454  20.570  1.00 19.28           C  \nATOM    722  CG  ASP A  88      30.224   6.857  21.036  1.00 18.16           C  \nATOM    723  OD1 ASP A  88      29.422   7.004  21.984  1.00 19.26           O  \nATOM    724  OD2 ASP A  88      30.779   7.813  20.458  1.00 20.16           O  \nATOM    725  N   GLY A  89      28.514   4.344  23.094  1.00 14.98           N  \nATOM    726  CA  GLY A  89      28.505   3.944  24.492  1.00 11.49           C  \nATOM    727  C   GLY A  89      27.131   3.392  24.807  1.00 11.28           C  \nATOM    728  O   GLY A  89      26.179   3.676  24.081  1.00 11.07           O  \nATOM    729  N   LEU A  90      27.014   2.623  25.887  1.00  7.86           N  \nATOM    730  CA  LEU A  90      25.732   2.028  26.248  1.00  8.27           C  \nATOM    731  C   LEU A  90      25.364   2.179  27.720  1.00  6.84           C  \nATOM    732  O   LEU A  90      26.191   1.947  28.599  1.00  8.06           O  \nATOM    733  CB  LEU A  90      25.743   0.539  25.897  1.00  9.22           C  \nATOM    734  CG  LEU A  90      24.518  -0.287  26.296  1.00  7.17           C  \nATOM    735  CD1 LEU A  90      23.307   0.167  25.493  1.00  7.45           C  \nATOM    736  CD2 LEU A  90      24.793  -1.763  26.048  1.00 10.76           C  \nATOM    737  N   LEU A  91      24.115   2.563  27.969  1.00  6.67           N  \nATOM    738  CA  LEU A  91      23.578   2.701  29.323  1.00  5.88           C  \nATOM    739  C   LEU A  91      22.297   1.877  29.362  1.00  7.65           C  \nATOM    740  O   LEU A  91      21.460   1.981  28.461  1.00  7.92           O  \nATOM    741  CB  LEU A  91      23.271   4.165  29.649  1.00  6.06           C  \nATOM    742  CG  LEU A  91      24.490   5.069  29.862  1.00  7.72           C  \nATOM    743  CD1 LEU A  91      24.037   6.516  30.030  1.00  9.04           C  \nATOM    744  CD2 LEU A  91      25.261   4.604  31.098  1.00 11.40           C  \nATOM    745  N   VAL A  92      22.147   1.056  30.397  1.00  7.74           N  \nATOM    746  CA  VAL A  92      20.973   0.196  30.526  1.00  9.41           C  \nATOM    747  C   VAL A  92      20.280   0.360  31.876  1.00  8.85           C  \nATOM    748  O   VAL A  92      20.929   0.302  32.920  1.00  9.80           O  \nATOM    749  CB  VAL A  92      21.368  -1.292  30.351  1.00  9.33           C  \nATOM    750  CG1 VAL A  92      20.167  -2.188  30.602  1.00 11.21           C  \nATOM    751  CG2 VAL A  92      21.923  -1.520  28.949  1.00  9.68           C  \nATOM    752  N   TYR A  93      18.962   0.546  31.846  1.00  8.30           N  \nATOM    753  CA  TYR A  93      18.179   0.713  33.072  1.00  7.46           C  \nATOM    754  C   TYR A  93      16.867  -0.059  33.053  1.00  9.64           C  \nATOM    755  O   TYR A  93      16.169  -0.096  32.039  1.00  9.58           O  \nATOM    756  CB  TYR A  93      17.833   2.185  33.292  1.00  7.49           C  \nATOM    757  CG  TYR A  93      19.013   3.115  33.250  1.00  7.32           C  \nATOM    758  CD1 TYR A  93      19.727   3.425  34.408  1.00 10.22           C  \nATOM    759  CD2 TYR A  93      19.428   3.677  32.045  1.00  8.50           C  \nATOM    760  CE1 TYR A  93      20.827   4.275  34.363  1.00  7.50           C  \nATOM    761  CE2 TYR A  93      20.519   4.520  31.989  1.00 10.65           C  \nATOM    762  CZ  TYR A  93      21.217   4.818  33.149  1.00  9.17           C  \nATOM    763  OH  TYR A  93      22.297   5.665  33.083  1.00  9.81           O  \nATOM    764  N   CYS A  94      16.525  -0.652  34.191  1.00  9.58           N  \nATOM    765  CA  CYS A  94      15.270  -1.383  34.321  1.00 11.58           C  \nATOM    766  C   CYS A  94      14.964  -1.598  35.795  1.00 11.27           C  \nATOM    767  O   CYS A  94      15.816  -1.357  36.656  1.00 12.83           O  \nATOM    768  CB  CYS A  94      15.356  -2.754  33.632  1.00 11.71           C  \nATOM    769  SG  CYS A  94      16.168  -4.070  34.608  1.00 12.06           S  \nATOM    770  N   ASP A  95      13.733  -2.008  36.085  1.00 13.29           N  \nATOM    771  CA  ASP A  95      13.353  -2.344  37.450  1.00 15.28           C  \nATOM    772  C   ASP A  95      13.033  -3.840  37.408  1.00 15.81           C  \nATOM    773  O   ASP A  95      13.032  -4.440  36.335  1.00 14.16           O  \nATOM    774  CB  ASP A  95      12.152  -1.522  37.960  1.00 14.63           C  \nATOM    775  CG  ASP A  95      11.055  -1.342  36.927  1.00 16.19           C  \nATOM    776  OD1 ASP A  95      10.946  -2.160  35.993  1.00 16.16           O  \nATOM    777  OD2 ASP A  95      10.279  -0.370  37.074  1.00 16.66           O  \nATOM    778  N   ASP A  96      12.781  -4.451  38.561  1.00 18.96           N  \nATOM    779  CA  ASP A  96      12.504  -5.884  38.602  1.00 20.56           C  \nATOM    780  C   ASP A  96      11.413  -6.363  37.654  1.00 20.25           C  \nATOM    781  O   ASP A  96      11.549  -7.411  37.027  1.00 19.79           O  \nATOM    782  CB  ASP A  96      12.154  -6.317  40.026  1.00 25.74           C  \nATOM    783  CG  ASP A  96      13.353  -6.310  40.945  1.00 27.79           C  \nATOM    784  OD1 ASP A  96      14.408  -6.847  40.547  1.00 33.13           O  \nATOM    785  OD2 ASP A  96      13.237  -5.779  42.067  1.00 35.26           O  \nATOM    786  N   GLU A  97      10.333  -5.599  37.556  1.00 20.92           N  \nATOM    787  CA  GLU A  97       9.216  -5.962  36.693  1.00 22.17           C  \nATOM    788  C   GLU A  97       9.593  -6.037  35.216  1.00 22.07           C  \nATOM    789  O   GLU A  97       8.908  -6.691  34.431  1.00 21.21           O  \nATOM    790  CB  GLU A  97       8.068  -4.964  36.869  1.00 25.44           C  \nATOM    791  CG  GLU A  97       7.371  -5.031  38.219  1.00 37.78           C  \nATOM    792  CD  GLU A  97       8.317  -4.805  39.384  1.00 43.22           C  \nATOM    793  OE1 GLU A  97       9.043  -3.786  39.372  1.00 45.28           O  \nATOM    794  OE2 GLU A  97       8.330  -5.642  40.314  1.00 42.89           O  \nATOM    795  N   ASN A  98      10.685  -5.380  34.840  1.00 17.80           N  \nATOM    796  CA  ASN A  98      11.110  -5.371  33.443  1.00 15.94           C  \nATOM    797  C   ASN A  98      12.511  -5.926  33.204  1.00 16.06           C  \nATOM    798  O   ASN A  98      13.054  -5.792  32.104  1.00 13.18           O  \nATOM    799  CB  ASN A  98      11.031  -3.942  32.901  1.00 16.46           C  \nATOM    800  CG  ASN A  98       9.621  -3.391  32.918  1.00 19.73           C  \nATOM    801  OD1 ASN A  98       8.775  -3.797  32.120  1.00 23.19           O  \nATOM    802  ND2 ASN A  98       9.354  -2.468  33.837  1.00 17.02           N  \nATOM    803  N   LYS A  99      13.088  -6.561  34.218  1.00 13.73           N  \nATOM    804  CA  LYS A  99      14.437  -7.107  34.102  1.00 14.87           C  \nATOM    805  C   LYS A  99      14.580  -8.218  33.063  1.00 14.96           C  \nATOM    806  O   LYS A  99      15.552  -8.238  32.307  1.00 14.14           O  \nATOM    807  CB  LYS A  99      14.920  -7.605  35.468  1.00 16.79           C  \nATOM    808  CG  LYS A  99      16.342  -8.144  35.460  1.00 18.70           C  \nATOM    809  CD  LYS A  99      16.878  -8.325  36.875  1.00 25.73           C  \nATOM    810  CE  LYS A  99      16.023  -9.280  37.685  1.00 30.36           C  \nATOM    811  NZ  LYS A  99      16.496  -9.377  39.094  1.00 34.03           N  \nATOM    812  N   VAL A 100      13.628  -9.147  33.025  1.00 15.47           N  \nATOM    813  CA  VAL A 100      13.688 -10.233  32.049  1.00 14.52           C  \nATOM    814  C   VAL A 100      13.612  -9.647  30.641  1.00 13.62           C  \nATOM    815  O   VAL A 100      14.373 -10.028  29.752  1.00 13.40           O  \nATOM    816  CB  VAL A 100      12.520 -11.229  32.240  1.00 17.58           C  \nATOM    817  CG1 VAL A 100      12.531 -12.268  31.124  1.00 14.99           C  \nATOM    818  CG2 VAL A 100      12.641 -11.914  33.593  1.00 18.88           C  \nATOM    819  N   PHE A 101      12.694  -8.707  30.454  1.00 14.49           N  \nATOM    820  CA  PHE A 101      12.518  -8.053  29.166  1.00 16.41           C  \nATOM    821  C   PHE A 101      13.790  -7.329  28.728  1.00 16.42           C  \nATOM    822  O   PHE A 101      14.326  -7.593  27.650  1.00 13.50           O  \nATOM    823  CB  PHE A 101      11.368  -7.052  29.243  1.00 16.85           C  \nATOM    824  CG  PHE A 101      11.188  -6.238  27.995  1.00 21.20           C  \nATOM    825  CD1 PHE A 101      10.807  -6.843  26.801  1.00 22.47           C  \nATOM    826  CD2 PHE A 101      11.394  -4.864  28.013  1.00 24.04           C  \nATOM    827  CE1 PHE A 101      10.633  -6.091  25.642  1.00 24.25           C  \nATOM    828  CE2 PHE A 101      11.224  -4.101  26.861  1.00 28.34           C  \nATOM    829  CZ  PHE A 101      10.842  -4.716  25.672  1.00 27.51           C  \nHETATM  830  N   MSE A 102      14.271  -6.413  29.562  1.00 15.07           N  \nHETATM  831  CA  MSE A 102      15.471  -5.656  29.229  1.00 15.73           C  \nHETATM  832  C   MSE A 102      16.697  -6.542  29.030  1.00 15.29           C  \nHETATM  833  O   MSE A 102      17.510  -6.291  28.138  1.00 14.86           O  \nHETATM  834  CB  MSE A 102      15.761  -4.609  30.308  1.00 16.50           C  \nHETATM  835  CG  MSE A 102      16.999  -3.766  30.031  1.00 12.98           C  \nHETATM  836 SE   MSE A 102      16.938  -2.880  28.300  1.00 27.13          SE  \nHETATM  837  CE  MSE A 102      15.668  -1.533  28.732  1.00  8.64           C  \nATOM    838  N   SER A 103      16.835  -7.578  29.852  1.00 17.48           N  \nATOM    839  CA  SER A 103      17.978  -8.478  29.733  1.00 17.27           C  \nATOM    840  C   SER A 103      18.018  -9.139  28.360  1.00 17.75           C  \nATOM    841  O   SER A 103      19.089  -9.324  27.783  1.00 18.72           O  \nATOM    842  CB  SER A 103      17.930  -9.555  30.822  1.00 17.33           C  \nATOM    843  OG  SER A 103      18.125  -8.986  32.103  1.00 22.22           O  \nATOM    844  N   LYS A 104      16.848  -9.489  27.836  1.00 18.40           N  \nATOM    845  CA  LYS A 104      16.772 -10.126  26.526  1.00 17.38           C  \nATOM    846  C   LYS A 104      17.196  -9.150  25.431  1.00 17.58           C  \nATOM    847  O   LYS A 104      17.929  -9.518  24.512  1.00 19.01           O  \nATOM    848  CB  LYS A 104      15.349 -10.623  26.261  1.00 18.69           C  \nATOM    849  CG  LYS A 104      15.172 -11.313  24.916  1.00 22.54           C  \nATOM    850  CD  LYS A 104      13.791 -11.952  24.792  1.00 23.95           C  \nATOM    851  CE  LYS A 104      12.674 -10.929  24.964  1.00 27.27           C  \nATOM    852  NZ  LYS A 104      11.319 -11.539  24.823  1.00 29.03           N  \nATOM    853  N   ILE A 105      16.734  -7.906  25.533  1.00 16.37           N  \nATOM    854  CA  ILE A 105      17.081  -6.884  24.551  1.00 16.07           C  \nATOM    855  C   ILE A 105      18.596  -6.688  24.526  1.00 14.20           C  \nATOM    856  O   ILE A 105      19.206  -6.640  23.458  1.00 15.34           O  \nATOM    857  CB  ILE A 105      16.404  -5.529  24.878  1.00 15.75           C  \nATOM    858  CG1 ILE A 105      14.885  -5.662  24.757  1.00 18.48           C  \nATOM    859  CG2 ILE A 105      16.901  -4.445  23.925  1.00 16.56           C  \nATOM    860  CD1 ILE A 105      14.134  -4.377  25.044  1.00 22.69           C  \nATOM    861  N   VAL A 106      19.198  -6.572  25.706  1.00 11.65           N  \nATOM    862  CA  VAL A 106      20.641  -6.388  25.798  1.00 13.23           C  \nATOM    863  C   VAL A 106      21.380  -7.546  25.132  1.00 17.19           C  \nATOM    864  O   VAL A 106      22.370  -7.336  24.431  1.00 15.73           O  \nATOM    865  CB  VAL A 106      21.103  -6.275  27.268  1.00 14.34           C  \nATOM    866  CG1 VAL A 106      22.621  -6.188  27.332  1.00 14.51           C  \nATOM    867  CG2 VAL A 106      20.482  -5.042  27.909  1.00 12.30           C  \nATOM    868  N   ASP A 107      20.894  -8.767  25.344  1.00 15.92           N  \nATOM    869  CA  ASP A 107      21.528  -9.939  24.748  1.00 19.28           C  \nATOM    870  C   ASP A 107      21.531  -9.877  23.224  1.00 18.25           C  \nATOM    871  O   ASP A 107      22.408 -10.453  22.581  1.00 19.40           O  \nATOM    872  CB  ASP A 107      20.820 -11.232  25.174  1.00 21.10           C  \nATOM    873  CG  ASP A 107      20.957 -11.522  26.654  1.00 24.44           C  \nATOM    874  OD1 ASP A 107      22.031 -11.238  27.225  1.00 24.29           O  \nATOM    875  OD2 ASP A 107      19.993 -12.057  27.244  1.00 26.54           O  \nATOM    876  N   ASN A 108      20.550  -9.187  22.650  1.00 16.67           N  \nATOM    877  CA  ASN A 108      20.448  -9.090  21.196  1.00 16.97           C  \nATOM    878  C   ASN A 108      21.076  -7.848  20.570  1.00 15.91           C  \nATOM    879  O   ASN A 108      20.954  -7.636  19.366  1.00 13.39           O  \nATOM    880  CB  ASN A 108      18.984  -9.189  20.759  1.00 19.30           C  \nATOM    881  CG  ASN A 108      18.415 -10.582  20.944  1.00 23.83           C  \nATOM    882  OD1 ASN A 108      18.184 -11.032  22.068  1.00 26.90           O  \nATOM    883  ND2 ASN A 108      18.194 -11.278  19.835  1.00 22.68           N  \nATOM    884  N   LEU A 109      21.741  -7.026  21.374  1.00 14.98           N  \nATOM    885  CA  LEU A 109      22.385  -5.828  20.840  1.00 14.18           C  \nATOM    886  C   LEU A 109      23.672  -6.221  20.135  1.00 16.48           C  \nATOM    887  O   LEU A 109      24.253  -7.265  20.431  1.00 14.47           O  \nATOM    888  CB  LEU A 109      22.727  -4.847  21.963  1.00 11.94           C  \nATOM    889  CG  LEU A 109      21.578  -4.194  22.728  1.00  9.62           C  \nATOM    890  CD1 LEU A 109      22.146  -3.384  23.887  1.00  8.05           C  \nATOM    891  CD2 LEU A 109      20.769  -3.304  21.795  1.00  8.93           C  \nATOM    892  N   PRO A 110      24.137  -5.388  19.190  1.00 16.03           N  \nATOM    893  CA  PRO A 110      25.377  -5.682  18.467  1.00 18.68           C  \nATOM    894  C   PRO A 110      26.539  -5.848  19.445  1.00 18.36           C  \nATOM    895  O   PRO A 110      26.588  -5.189  20.486  1.00 16.80           O  \nATOM    896  CB  PRO A 110      25.551  -4.459  17.572  1.00 17.68           C  \nATOM    897  CG  PRO A 110      24.137  -4.055  17.288  1.00 20.90           C  \nATOM    898  CD  PRO A 110      23.488  -4.181  18.649  1.00 17.75           C  \nATOM    899  N   THR A 111      27.473  -6.725  19.102  1.00 17.87           N  \nATOM    900  CA  THR A 111      28.631  -6.987  19.946  1.00 19.17           C  \nATOM    901  C   THR A 111      29.378  -5.717  20.354  1.00 18.59           C  \nATOM    902  O   THR A 111      29.683  -5.518  21.529  1.00 15.29           O  \nATOM    903  CB  THR A 111      29.625  -7.918  19.230  1.00 18.45           C  \nATOM    904  OG1 THR A 111      28.975  -9.154  18.913  1.00 26.33           O  \nATOM    905  CG2 THR A 111      30.828  -8.193  20.116  1.00 22.32           C  \nATOM    906  N   ALA A 112      29.671  -4.864  19.377  1.00 16.37           N  \nATOM    907  CA  ALA A 112      30.402  -3.627  19.631  1.00 18.47           C  \nATOM    908  C   ALA A 112      29.717  -2.716  20.643  1.00 17.46           C  \nATOM    909  O   ALA A 112      30.381  -2.010  21.401  1.00 19.35           O  \nATOM    910  CB  ALA A 112      30.624  -2.875  18.321  1.00 18.49           C  \nATOM    911  N   ILE A 113      28.390  -2.731  20.658  1.00 12.89           N  \nATOM    912  CA  ILE A 113      27.644  -1.887  21.583  1.00 16.15           C  \nATOM    913  C   ILE A 113      27.695  -2.444  23.001  1.00 15.76           C  \nATOM    914  O   ILE A 113      27.925  -1.706  23.959  1.00 17.40           O  \nATOM    915  CB  ILE A 113      26.179  -1.734  21.130  1.00 15.62           C  \nATOM    916  CG1 ILE A 113      26.143  -1.026  19.771  1.00 16.32           C  \nATOM    917  CG2 ILE A 113      25.391  -0.936  22.162  1.00 15.49           C  \nATOM    918  CD1 ILE A 113      24.753  -0.743  19.245  1.00 16.88           C  \nATOM    919  N   LYS A 114      27.491  -3.749  23.134  1.00 16.40           N  \nATOM    920  CA  LYS A 114      27.527  -4.383  24.446  1.00 17.88           C  \nATOM    921  C   LYS A 114      28.898  -4.255  25.099  1.00 18.65           C  \nATOM    922  O   LYS A 114      29.004  -4.206  26.323  1.00 19.90           O  \nATOM    923  CB  LYS A 114      27.149  -5.863  24.332  1.00 20.13           C  \nATOM    924  CG  LYS A 114      25.693  -6.097  23.967  1.00 23.14           C  \nATOM    925  CD  LYS A 114      25.324  -7.573  24.001  1.00 28.04           C  \nATOM    926  CE  LYS A 114      25.952  -8.340  22.854  1.00 31.86           C  \nATOM    927  NZ  LYS A 114      25.460  -9.747  22.805  1.00 36.71           N  \nATOM    928  N   ARG A 115      29.946  -4.185  24.285  1.00 19.13           N  \nATOM    929  CA  ARG A 115      31.299  -4.081  24.819  1.00 21.63           C  \nATOM    930  C   ARG A 115      31.620  -2.708  25.393  1.00 21.69           C  \nATOM    931  O   ARG A 115      32.625  -2.540  26.082  1.00 19.57           O  \nATOM    932  CB  ARG A 115      32.322  -4.458  23.745  1.00 29.14           C  \nATOM    933  CG  ARG A 115      32.066  -5.832  23.150  1.00 40.81           C  \nATOM    934  CD  ARG A 115      33.338  -6.510  22.674  1.00 51.82           C  \nATOM    935  NE  ARG A 115      33.045  -7.808  22.070  1.00 60.88           N  \nATOM    936  CZ  ARG A 115      33.959  -8.734  21.800  1.00 65.54           C  \nATOM    937  NH1 ARG A 115      35.235  -8.513  22.083  1.00 68.77           N  \nATOM    938  NH2 ARG A 115      33.595  -9.882  21.242  1.00 67.23           N  \nATOM    939  N   ASN A 116      30.768  -1.727  25.116  1.00 16.60           N  \nATOM    940  CA  ASN A 116      30.983  -0.385  25.639  1.00 13.28           C  \nATOM    941  C   ASN A 116      29.921  -0.012  26.664  1.00 13.98           C  \nATOM    942  O   ASN A 116      29.466   1.131  26.721  1.00 11.77           O  \nATOM    943  CB  ASN A 116      31.011   0.644  24.508  1.00 17.96           C  \nATOM    944  CG  ASN A 116      32.280   0.560  23.682  1.00 23.95           C  \nATOM    945  OD1 ASN A 116      32.393  -0.258  22.771  1.00 27.65           O  \nATOM    946  ND2 ASN A 116      33.253   1.399  24.014  1.00 24.96           N  \nATOM    947  N   LEU A 117      29.532  -0.993  27.472  1.00 14.76           N  \nATOM    948  CA  LEU A 117      28.539  -0.790  28.520  1.00 16.01           C  \nATOM    949  C   LEU A 117      29.169   0.082  29.606  1.00 16.50           C  \nATOM    950  O   LEU A 117      30.149  -0.311  30.238  1.00 19.94           O  \nATOM    951  CB  LEU A 117      28.119  -2.142  29.100  1.00 13.89           C  \nATOM    952  CG  LEU A 117      27.156  -2.147  30.288  1.00 15.07           C  \nATOM    953  CD1 LEU A 117      25.825  -1.532  29.881  1.00 13.69           C  \nATOM    954  CD2 LEU A 117      26.961  -3.579  30.766  1.00 16.68           C  \nATOM    955  N   ILE A 118      28.601   1.266  29.813  1.00 11.74           N  \nATOM    956  CA  ILE A 118      29.109   2.215  30.801  1.00 13.36           C  \nATOM    957  C   ILE A 118      28.505   1.995  32.180  1.00 12.53           C  \nATOM    958  O   ILE A 118      29.206   2.033  33.191  1.00 12.37           O  \nATOM    959  CB  ILE A 118      28.810   3.664  30.367  1.00 14.81           C  \nATOM    960  CG1 ILE A 118      29.505   3.958  29.037  1.00 17.20           C  \nATOM    961  CG2 ILE A 118      29.273   4.644  31.445  1.00 16.33           C  \nATOM    962  CD1 ILE A 118      29.137   5.297  28.442  1.00 15.95           C  \nATOM    963  N   LYS A 119      27.196   1.782  32.216  1.00  9.94           N  \nATOM    964  CA  LYS A 119      26.491   1.553  33.470  1.00  8.83           C  \nATOM    965  C   LYS A 119      25.264   0.711  33.185  1.00 12.00           C  \nATOM    966  O   LYS A 119      24.547   0.953  32.216  1.00  9.96           O  \nATOM    967  CB  LYS A 119      26.062   2.883  34.105  1.00 10.54           C  \nATOM    968  CG  LYS A 119      25.176   2.742  35.358  1.00 12.68           C  \nATOM    969  CD  LYS A 119      25.904   2.066  36.516  1.00 12.97           C  \nATOM    970  CE  LYS A 119      25.005   1.904  37.747  1.00  9.78           C  \nATOM    971  NZ  LYS A 119      24.704   3.205  38.415  1.00  9.17           N  \nATOM    972  N   ASP A 120      25.043  -0.291  34.025  1.00 11.88           N  \nATOM    973  CA  ASP A 120      23.892  -1.164  33.887  1.00 12.15           C  \nATOM    974  C   ASP A 120      23.189  -1.204  35.238  1.00 13.35           C  \nATOM    975  O   ASP A 120      23.647  -1.875  36.158  1.00 13.72           O  \nATOM    976  CB  ASP A 120      24.332  -2.579  33.492  1.00 13.47           C  \nATOM    977  CG  ASP A 120      23.156  -3.506  33.216  1.00 18.79           C  \nATOM    978  OD1 ASP A 120      22.239  -3.586  34.061  1.00 19.37           O  \nATOM    979  OD2 ASP A 120      23.149  -4.162  32.155  1.00 26.90           O  \nATOM    980  N   PHE A 121      22.112  -0.440  35.374  1.00  9.12           N  \nATOM    981  CA  PHE A 121      21.345  -0.460  36.612  1.00  8.53           C  \nATOM    982  C   PHE A 121      20.158  -1.323  36.233  1.00 10.99           C  \nATOM    983  O   PHE A 121      19.062  -0.820  35.976  1.00 12.01           O  \nATOM    984  CB  PHE A 121      20.864   0.938  37.000  1.00  8.25           C  \nATOM    985  CG  PHE A 121      20.292   1.008  38.388  1.00  9.71           C  \nATOM    986  CD1 PHE A 121      21.126   1.167  39.490  1.00  9.45           C  \nATOM    987  CD2 PHE A 121      18.926   0.875  38.597  1.00 13.08           C  \nATOM    988  CE1 PHE A 121      20.606   1.190  40.781  1.00 10.63           C  \nATOM    989  CE2 PHE A 121      18.394   0.895  39.887  1.00 11.99           C  \nATOM    990  CZ  PHE A 121      19.238   1.054  40.981  1.00 12.89           C  \nATOM    991  N   CYS A 122      20.385  -2.631  36.182  1.00 12.06           N  \nATOM    992  CA  CYS A 122      19.331  -3.542  35.781  1.00 13.91           C  \nATOM    993  C   CYS A 122      19.612  -5.009  36.086  1.00 15.31           C  \nATOM    994  O   CYS A 122      19.032  -5.583  37.008  1.00 15.62           O  \nATOM    995  CB  CYS A 122      19.078  -3.364  34.280  1.00 13.84           C  \nATOM    996  SG  CYS A 122      17.857  -4.508  33.568  1.00 13.88           S  \nATOM    997  N   ARG A 123      20.511  -5.611  35.318  1.00 16.09           N  \nATOM    998  CA  ARG A 123      20.827  -7.025  35.485  1.00 18.40           C  \nATOM    999  C   ARG A 123      21.351  -7.484  36.846  1.00 17.94           C  \nATOM   1000  O   ARG A 123      21.097  -8.621  37.244  1.00 17.65           O  \nATOM   1001  CB  ARG A 123      21.772  -7.468  34.366  1.00 19.65           C  \nATOM   1002  CG  ARG A 123      21.072  -7.500  33.007  1.00 28.18           C  \nATOM   1003  CD  ARG A 123      22.004  -7.899  31.879  1.00 29.84           C  \nATOM   1004  NE  ARG A 123      23.045  -6.901  31.658  1.00 32.33           N  \nATOM   1005  CZ  ARG A 123      24.006  -7.013  30.748  1.00 29.90           C  \nATOM   1006  NH1 ARG A 123      24.060  -8.083  29.967  1.00 27.70           N  \nATOM   1007  NH2 ARG A 123      24.913  -6.056  30.619  1.00 29.83           N  \nATOM   1008  N   LYS A 124      22.063  -6.621  37.567  1.00 13.84           N  \nATOM   1009  CA  LYS A 124      22.574  -7.010  38.881  1.00 12.49           C  \nATOM   1010  C   LYS A 124      21.558  -6.778  40.004  1.00 10.77           C  \nATOM   1011  O   LYS A 124      21.839  -7.074  41.164  1.00 12.23           O  \nATOM   1012  CB  LYS A 124      23.877  -6.264  39.210  1.00 15.02           C  \nATOM   1013  CG  LYS A 124      25.124  -6.785  38.485  1.00 17.86           C  \nATOM   1014  CD  LYS A 124      26.376  -6.035  38.942  1.00 21.21           C  \nATOM   1015  CE  LYS A 124      27.647  -6.566  38.282  1.00 24.54           C  \nATOM   1016  NZ  LYS A 124      28.878  -5.873  38.791  1.00 21.46           N  \nATOM   1017  N   LEU A 125      20.385  -6.246  39.670  1.00  9.74           N  \nATOM   1018  CA  LEU A 125      19.359  -6.009  40.684  1.00 11.32           C  \nATOM   1019  C   LEU A 125      18.803  -7.337  41.180  1.00 14.53           C  \nATOM   1020  O   LEU A 125      18.539  -8.239  40.388  1.00 14.63           O  \nATOM   1021  CB  LEU A 125      18.213  -5.171  40.115  1.00 11.72           C  \nATOM   1022  CG  LEU A 125      18.482  -3.693  39.848  1.00 13.13           C  \nATOM   1023  CD1 LEU A 125      17.307  -3.105  39.084  1.00 13.14           C  \nATOM   1024  CD2 LEU A 125      18.690  -2.955  41.168  1.00 13.06           C  \nATOM   1025  N   SER A 126      18.630  -7.454  42.493  1.00 13.97           N  \nATOM   1026  CA  SER A 126      18.095  -8.673  43.087  1.00 18.03           C  \nATOM   1027  C   SER A 126      16.570  -8.624  43.178  1.00 20.57           C  \nATOM   1028  O   SER A 126      15.954  -9.708  43.269  1.00 24.85           O  \nATOM   1029  CB  SER A 126      18.697  -8.899  44.479  1.00 18.07           C  \nATOM   1030  OG  SER A 126      18.407  -7.823  45.351  1.00 15.78           O  \nTER    1031      SER A 126                                                      \nATOM   1032  N   TYR B   3      24.874 -14.238  65.592  1.00 21.36           N  \nATOM   1033  CA  TYR B   3      24.778 -13.845  64.154  1.00 14.51           C  \nATOM   1034  C   TYR B   3      24.644 -15.062  63.250  1.00 13.36           C  \nATOM   1035  O   TYR B   3      25.275 -16.090  63.494  1.00 14.59           O  \nATOM   1036  CB  TYR B   3      26.025 -13.057  63.736  1.00 14.32           C  \nATOM   1037  CG  TYR B   3      26.252 -11.805  64.544  1.00 12.05           C  \nATOM   1038  CD1 TYR B   3      27.202 -11.769  65.564  1.00 12.30           C  \nATOM   1039  CD2 TYR B   3      25.492 -10.662  64.309  1.00 10.81           C  \nATOM   1040  CE1 TYR B   3      27.388 -10.616  66.331  1.00 14.06           C  \nATOM   1041  CE2 TYR B   3      25.667  -9.512  65.069  1.00 13.41           C  \nATOM   1042  CZ  TYR B   3      26.614  -9.496  66.076  1.00 15.79           C  \nATOM   1043  OH  TYR B   3      26.781  -8.356  66.825  1.00 14.76           O  \nATOM   1044  N   LYS B   4      23.823 -14.950  62.210  1.00 11.22           N  \nATOM   1045  CA  LYS B   4      23.663 -16.057  61.274  1.00 13.45           C  \nATOM   1046  C   LYS B   4      23.831 -15.659  59.804  1.00 10.36           C  \nATOM   1047  O   LYS B   4      23.870 -16.522  58.933  1.00 10.86           O  \nATOM   1048  CB  LYS B   4      22.316 -16.761  61.471  1.00 16.58           C  \nATOM   1049  CG  LYS B   4      21.093 -15.942  61.128  1.00 16.48           C  \nATOM   1050  CD  LYS B   4      19.882 -16.859  61.028  1.00 21.17           C  \nATOM   1051  CE  LYS B   4      18.595 -16.085  60.822  1.00 27.98           C  \nATOM   1052  NZ  LYS B   4      18.247 -15.263  62.014  1.00 29.87           N  \nATOM   1053  N   ASN B   5      23.921 -14.359  59.523  1.00  8.93           N  \nATOM   1054  CA  ASN B   5      24.134 -13.899  58.150  1.00  8.93           C  \nATOM   1055  C   ASN B   5      24.842 -12.553  58.160  1.00  8.91           C  \nATOM   1056  O   ASN B   5      24.222 -11.500  58.322  1.00 10.65           O  \nATOM   1057  CB  ASN B   5      22.820 -13.791  57.372  1.00 11.88           C  \nATOM   1058  CG  ASN B   5      23.049 -13.491  55.898  1.00 13.66           C  \nATOM   1059  OD1 ASN B   5      24.105 -13.815  55.347  1.00 19.21           O  \nATOM   1060  ND2 ASN B   5      22.060 -12.887  55.250  1.00 22.41           N  \nATOM   1061  N   ILE B   6      26.152 -12.612  57.965  1.00  8.00           N  \nATOM   1062  CA  ILE B   6      27.003 -11.433  57.994  1.00  9.10           C  \nATOM   1063  C   ILE B   6      27.177 -10.713  56.666  1.00  8.01           C  \nATOM   1064  O   ILE B   6      27.518 -11.327  55.654  1.00  9.10           O  \nATOM   1065  CB  ILE B   6      28.416 -11.809  58.500  1.00  9.03           C  \nATOM   1066  CG1 ILE B   6      28.320 -12.480  59.874  1.00  9.90           C  \nATOM   1067  CG2 ILE B   6      29.303 -10.572  58.544  1.00 10.80           C  \nATOM   1068  CD1 ILE B   6      27.770 -11.591  60.966  1.00  9.93           C  \nATOM   1069  N   LEU B   7      26.941  -9.405  56.678  1.00  8.14           N  \nATOM   1070  CA  LEU B   7      27.147  -8.591  55.489  1.00  6.09           C  \nATOM   1071  C   LEU B   7      28.588  -8.124  55.596  1.00  6.79           C  \nATOM   1072  O   LEU B   7      28.950  -7.434  56.551  1.00  7.97           O  \nATOM   1073  CB  LEU B   7      26.225  -7.367  55.478  1.00  7.81           C  \nATOM   1074  CG  LEU B   7      26.529  -6.349  54.369  1.00  8.36           C  \nATOM   1075  CD1 LEU B   7      26.304  -6.988  53.002  1.00  9.26           C  \nATOM   1076  CD2 LEU B   7      25.638  -5.118  54.545  1.00  7.47           C  \nATOM   1077  N   THR B   8      29.417  -8.518  54.635  1.00  6.69           N  \nATOM   1078  CA  THR B   8      30.821  -8.123  54.639  1.00  7.81           C  \nATOM   1079  C   THR B   8      31.088  -7.181  53.468  1.00  6.38           C  \nATOM   1080  O   THR B   8      30.726  -7.481  52.328  1.00  6.46           O  \nATOM   1081  CB  THR B   8      31.759  -9.352  54.501  1.00 10.09           C  \nATOM   1082  OG1 THR B   8      31.631 -10.194  55.656  1.00  7.20           O  \nATOM   1083  CG2 THR B   8      33.214  -8.901  54.370  1.00  8.79           C  \nATOM   1084  N   LEU B   9      31.706  -6.039  53.757  1.00  4.35           N  \nATOM   1085  CA  LEU B   9      32.043  -5.062  52.729  1.00  5.78           C  \nATOM   1086  C   LEU B   9      33.558  -4.900  52.689  1.00  6.78           C  \nATOM   1087  O   LEU B   9      34.209  -4.773  53.731  1.00  6.68           O  \nATOM   1088  CB  LEU B   9      31.407  -3.701  53.039  1.00  6.10           C  \nATOM   1089  CG  LEU B   9      29.928  -3.657  53.430  1.00  6.69           C  \nATOM   1090  CD1 LEU B   9      29.491  -2.202  53.589  1.00  7.98           C  \nATOM   1091  CD2 LEU B   9      29.087  -4.351  52.367  1.00  8.90           C  \nATOM   1092  N   ILE B  10      34.125  -4.911  51.490  1.00  5.68           N  \nATOM   1093  CA  ILE B  10      35.562  -4.744  51.369  1.00  6.72           C  \nATOM   1094  C   ILE B  10      35.965  -4.002  50.110  1.00  7.62           C  \nATOM   1095  O   ILE B  10      35.402  -4.206  49.037  1.00  5.59           O  \nATOM   1096  CB  ILE B  10      36.308  -6.109  51.406  1.00  6.91           C  \nATOM   1097  CG1 ILE B  10      37.820  -5.882  51.274  1.00  7.02           C  \nATOM   1098  CG2 ILE B  10      35.802  -7.021  50.297  1.00  6.03           C  \nATOM   1099  CD1 ILE B  10      38.662  -7.130  51.515  1.00  8.43           C  \nATOM   1100  N   SER B  11      36.934  -3.110  50.267  1.00  7.10           N  \nATOM   1101  CA  SER B  11      37.476  -2.363  49.148  1.00  6.62           C  \nATOM   1102  C   SER B  11      38.942  -2.164  49.466  1.00  8.26           C  \nATOM   1103  O   SER B  11      39.288  -1.400  50.368  1.00  7.92           O  \nATOM   1104  CB  SER B  11      36.790  -1.008  48.984  1.00  6.11           C  \nATOM   1105  OG  SER B  11      37.256  -0.365  47.808  1.00  9.34           O  \nATOM   1106  N   VAL B  12      39.792  -2.885  48.742  1.00  7.09           N  \nATOM   1107  CA  VAL B  12      41.239  -2.801  48.918  1.00 10.34           C  \nATOM   1108  C   VAL B  12      41.924  -2.927  47.557  1.00 12.03           C  \nATOM   1109  O   VAL B  12      41.310  -3.347  46.576  1.00 10.61           O  \nATOM   1110  CB  VAL B  12      41.782  -3.938  49.832  1.00 10.18           C  \nATOM   1111  CG1 VAL B  12      41.208  -3.817  51.237  1.00  7.55           C  \nATOM   1112  CG2 VAL B  12      41.446  -5.301  49.234  1.00 11.44           C  \nATOM   1113  N   ASN B  13      43.197  -2.553  47.500  1.00 11.33           N  \nATOM   1114  CA  ASN B  13      43.973  -2.680  46.275  1.00 11.60           C  \nATOM   1115  C   ASN B  13      44.161  -4.169  46.021  1.00 10.16           C  \nATOM   1116  O   ASN B  13      44.092  -4.971  46.953  1.00 11.25           O  \nATOM   1117  CB  ASN B  13      45.327  -1.996  46.446  1.00 14.31           C  \nATOM   1118  CG  ASN B  13      45.205  -0.496  46.587  1.00 19.40           C  \nATOM   1119  OD1 ASN B  13      46.076   0.158  47.157  1.00 27.47           O  \nATOM   1120  ND2 ASN B  13      44.121   0.060  46.054  1.00 20.72           N  \nATOM   1121  N   ASN B  14      44.410  -4.534  44.769  1.00 10.10           N  \nATOM   1122  CA  ASN B  14      44.581  -5.938  44.400  1.00 11.06           C  \nATOM   1123  C   ASN B  14      45.570  -6.732  45.250  1.00 10.81           C  \nATOM   1124  O   ASN B  14      45.307  -7.888  45.580  1.00 10.95           O  \nATOM   1125  CB  ASN B  14      44.995  -6.057  42.930  1.00 10.61           C  \nATOM   1126  CG  ASN B  14      43.954  -5.496  41.982  1.00 15.18           C  \nATOM   1127  OD1 ASN B  14      42.782  -5.372  42.330  1.00 14.69           O  \nATOM   1128  ND2 ASN B  14      44.378  -5.164  40.769  1.00 19.56           N  \nATOM   1129  N   ASP B  15      46.702  -6.125  45.602  1.00 10.94           N  \nATOM   1130  CA  ASP B  15      47.705  -6.838  46.383  1.00 10.98           C  \nATOM   1131  C   ASP B  15      47.330  -7.096  47.836  1.00 10.19           C  \nATOM   1132  O   ASP B  15      48.071  -7.759  48.557  1.00 10.38           O  \nATOM   1133  CB  ASP B  15      49.065  -6.124  46.325  1.00 14.95           C  \nATOM   1134  CG  ASP B  15      49.000  -4.684  46.787  1.00 21.05           C  \nATOM   1135  OD1 ASP B  15      48.229  -4.376  47.719  1.00 22.00           O  \nATOM   1136  OD2 ASP B  15      49.746  -3.853  46.223  1.00 30.99           O  \nATOM   1137  N   ASN B  16      46.183  -6.581  48.267  1.00 11.48           N  \nATOM   1138  CA  ASN B  16      45.732  -6.790  49.641  1.00  7.76           C  \nATOM   1139  C   ASN B  16      44.579  -7.784  49.751  1.00  8.08           C  \nATOM   1140  O   ASN B  16      44.177  -8.141  50.855  1.00  8.44           O  \nATOM   1141  CB  ASN B  16      45.291  -5.466  50.279  1.00 10.28           C  \nATOM   1142  CG  ASN B  16      46.462  -4.627  50.763  1.00 15.33           C  \nATOM   1143  OD1 ASN B  16      47.456  -5.156  51.263  1.00 15.34           O  \nATOM   1144  ND2 ASN B  16      46.339  -3.308  50.640  1.00 12.76           N  \nATOM   1145  N   PHE B  17      44.050  -8.238  48.619  1.00  7.20           N  \nATOM   1146  CA  PHE B  17      42.923  -9.167  48.655  1.00  8.00           C  \nATOM   1147  C   PHE B  17      43.147 -10.464  49.434  1.00  8.33           C  \nATOM   1148  O   PHE B  17      42.342 -10.807  50.296  1.00  7.68           O  \nATOM   1149  CB  PHE B  17      42.446  -9.503  47.237  1.00  9.52           C  \nATOM   1150  CG  PHE B  17      41.524  -8.472  46.637  1.00  8.82           C  \nATOM   1151  CD1 PHE B  17      40.442  -7.979  47.362  1.00  9.39           C  \nATOM   1152  CD2 PHE B  17      41.709  -8.030  45.330  1.00  9.79           C  \nATOM   1153  CE1 PHE B  17      39.554  -7.063  46.793  1.00 11.35           C  \nATOM   1154  CE2 PHE B  17      40.827  -7.116  44.753  1.00  9.80           C  \nATOM   1155  CZ  PHE B  17      39.746  -6.631  45.487  1.00 12.77           C  \nATOM   1156  N   GLU B  18      44.218 -11.194  49.136  1.00  8.33           N  \nATOM   1157  CA  GLU B  18      44.467 -12.456  49.833  1.00  9.72           C  \nATOM   1158  C   GLU B  18      44.568 -12.297  51.348  1.00  6.59           C  \nATOM   1159  O   GLU B  18      43.893 -13.004  52.094  1.00  7.10           O  \nATOM   1160  CB  GLU B  18      45.735 -13.128  49.290  1.00  9.13           C  \nATOM   1161  CG  GLU B  18      46.238 -14.336  50.100  1.00  9.85           C  \nATOM   1162  CD  GLU B  18      45.206 -15.448  50.289  1.00  8.42           C  \nATOM   1163  OE1 GLU B  18      44.234 -15.524  49.511  1.00  9.56           O  \nATOM   1164  OE2 GLU B  18      45.382 -16.271  51.218  1.00  8.00           O  \nATOM   1165  N   ASN B  19      45.401 -11.369  51.806  1.00  9.24           N  \nATOM   1166  CA  ASN B  19      45.557 -11.164  53.242  1.00  9.87           C  \nATOM   1167  C   ASN B  19      44.248 -10.732  53.898  1.00  8.85           C  \nATOM   1168  O   ASN B  19      43.897 -11.222  54.976  1.00  8.14           O  \nATOM   1169  CB  ASN B  19      46.644 -10.121  53.523  1.00 14.61           C  \nATOM   1170  CG  ASN B  19      48.006 -10.540  52.996  1.00 22.00           C  \nATOM   1171  OD1 ASN B  19      48.394 -11.704  53.106  1.00 25.40           O  \nATOM   1172  ND2 ASN B  19      48.743  -9.590  52.434  1.00 24.63           N  \nATOM   1173  N   TYR B  20      43.531  -9.813  53.257  1.00  8.18           N  \nATOM   1174  CA  TYR B  20      42.266  -9.340  53.804  1.00  8.95           C  \nATOM   1175  C   TYR B  20      41.182 -10.413  53.812  1.00  6.99           C  \nATOM   1176  O   TYR B  20      40.396 -10.486  54.756  1.00  6.01           O  \nATOM   1177  CB  TYR B  20      41.754  -8.112  53.038  1.00  7.13           C  \nATOM   1178  CG  TYR B  20      42.236  -6.785  53.592  1.00 10.34           C  \nATOM   1179  CD1 TYR B  20      43.548  -6.365  53.404  1.00 10.74           C  \nATOM   1180  CD2 TYR B  20      41.368  -5.940  54.287  1.00  8.51           C  \nATOM   1181  CE1 TYR B  20      43.987  -5.135  53.886  1.00 12.05           C  \nATOM   1182  CE2 TYR B  20      41.797  -4.704  54.778  1.00 10.80           C  \nATOM   1183  CZ  TYR B  20      43.110  -4.309  54.569  1.00  8.47           C  \nATOM   1184  OH  TYR B  20      43.553  -3.083  55.017  1.00  8.55           O  \nATOM   1185  N   PHE B  21      41.125 -11.248  52.780  1.00  5.65           N  \nATOM   1186  CA  PHE B  21      40.097 -12.284  52.766  1.00  7.22           C  \nATOM   1187  C   PHE B  21      40.299 -13.326  53.856  1.00  6.90           C  \nATOM   1188  O   PHE B  21      39.324 -13.832  54.410  1.00  8.49           O  \nATOM   1189  CB  PHE B  21      39.983 -12.952  51.392  1.00  5.51           C  \nATOM   1190  CG  PHE B  21      38.875 -12.384  50.547  1.00  7.65           C  \nATOM   1191  CD1 PHE B  21      39.053 -11.194  49.852  1.00  6.57           C  \nATOM   1192  CD2 PHE B  21      37.629 -13.008  50.502  1.00  8.14           C  \nATOM   1193  CE1 PHE B  21      38.005 -10.630  49.123  1.00  8.19           C  \nATOM   1194  CE2 PHE B  21      36.577 -12.451  49.778  1.00  7.92           C  \nATOM   1195  CZ  PHE B  21      36.765 -11.262  49.089  1.00  7.63           C  \nATOM   1196  N   ARG B  22      41.545 -13.654  54.184  1.00  8.64           N  \nATOM   1197  CA  ARG B  22      41.753 -14.615  55.260  1.00  7.68           C  \nATOM   1198  C   ARG B  22      41.218 -13.986  56.546  1.00  9.23           C  \nATOM   1199  O   ARG B  22      40.626 -14.672  57.380  1.00  9.14           O  \nATOM   1200  CB  ARG B  22      43.234 -14.984  55.408  1.00  9.83           C  \nATOM   1201  CG  ARG B  22      43.737 -15.893  54.292  1.00 10.47           C  \nATOM   1202  CD  ARG B  22      45.028 -16.626  54.665  1.00 13.14           C  \nATOM   1203  NE  ARG B  22      46.093 -15.705  55.047  1.00 13.85           N  \nATOM   1204  CZ  ARG B  22      46.393 -15.381  56.301  1.00 16.65           C  \nATOM   1205  NH1 ARG B  22      47.374 -14.525  56.546  1.00 19.74           N  \nATOM   1206  NH2 ARG B  22      45.724 -15.926  57.310  1.00 16.23           N  \nATOM   1207  N   LYS B  23      41.398 -12.673  56.692  1.00  7.74           N  \nATOM   1208  CA  LYS B  23      40.906 -11.974  57.875  1.00  7.68           C  \nATOM   1209  C   LYS B  23      39.377 -11.989  57.872  1.00  5.61           C  \nATOM   1210  O   LYS B  23      38.747 -12.230  58.905  1.00  7.57           O  \nATOM   1211  CB  LYS B  23      41.417 -10.528  57.899  1.00  9.24           C  \nATOM   1212  CG  LYS B  23      41.097  -9.790  59.192  1.00 11.93           C  \nATOM   1213  CD  LYS B  23      41.651  -8.368  59.170  1.00 14.74           C  \nATOM   1214  CE  LYS B  23      41.414  -7.664  60.495  1.00 14.38           C  \nATOM   1215  NZ  LYS B  23      42.184  -8.300  61.608  1.00 14.94           N  \nATOM   1216  N   ILE B  24      38.780 -11.740  56.710  1.00  5.67           N  \nATOM   1217  CA  ILE B  24      37.320 -11.754  56.607  1.00  7.29           C  \nATOM   1218  C   ILE B  24      36.753 -13.062  57.160  1.00  6.15           C  \nATOM   1219  O   ILE B  24      35.866 -13.060  58.012  1.00  5.44           O  \nATOM   1220  CB  ILE B  24      36.851 -11.614  55.145  1.00  7.36           C  \nATOM   1221  CG1 ILE B  24      37.094 -10.182  54.655  1.00  8.85           C  \nATOM   1222  CG2 ILE B  24      35.367 -11.981  55.032  1.00  6.64           C  \nATOM   1223  CD1 ILE B  24      36.766  -9.965  53.187  1.00 10.23           C  \nATOM   1224  N   PHE B  25      37.273 -14.181  56.675  1.00  7.30           N  \nATOM   1225  CA  PHE B  25      36.786 -15.477  57.122  1.00  6.63           C  \nATOM   1226  C   PHE B  25      37.036 -15.736  58.600  1.00  6.31           C  \nATOM   1227  O   PHE B  25      36.211 -16.363  59.267  1.00  8.06           O  \nATOM   1228  CB  PHE B  25      37.379 -16.585  56.248  1.00  6.24           C  \nATOM   1229  CG  PHE B  25      36.784 -16.631  54.864  1.00  7.17           C  \nATOM   1230  CD1 PHE B  25      35.424 -16.880  54.690  1.00 10.68           C  \nATOM   1231  CD2 PHE B  25      37.574 -16.405  53.740  1.00  8.30           C  \nATOM   1232  CE1 PHE B  25      34.854 -16.902  53.414  1.00  9.57           C  \nATOM   1233  CE2 PHE B  25      37.018 -16.424  52.459  1.00  9.90           C  \nATOM   1234  CZ  PHE B  25      35.653 -16.674  52.295  1.00  9.39           C  \nATOM   1235  N   LEU B  26      38.160 -15.256  59.125  1.00  6.24           N  \nATOM   1236  CA  LEU B  26      38.429 -15.438  60.548  1.00  7.07           C  \nATOM   1237  C   LEU B  26      37.368 -14.669  61.341  1.00  8.61           C  \nATOM   1238  O   LEU B  26      36.790 -15.187  62.301  1.00  5.92           O  \nATOM   1239  CB  LEU B  26      39.826 -14.922  60.903  1.00  9.61           C  \nATOM   1240  CG  LEU B  26      40.979 -15.783  60.382  1.00 11.99           C  \nATOM   1241  CD1 LEU B  26      42.318 -15.135  60.716  1.00 15.65           C  \nATOM   1242  CD2 LEU B  26      40.888 -17.159  61.010  1.00 15.48           C  \nATOM   1243  N   ASP B  27      37.096 -13.436  60.929  1.00  8.13           N  \nATOM   1244  CA  ASP B  27      36.103 -12.634  61.626  1.00  7.07           C  \nATOM   1245  C   ASP B  27      34.694 -13.209  61.508  1.00  7.64           C  \nATOM   1246  O   ASP B  27      33.921 -13.169  62.470  1.00  7.91           O  \nATOM   1247  CB  ASP B  27      36.155 -11.187  61.136  1.00  7.16           C  \nATOM   1248  CG  ASP B  27      37.445 -10.494  61.533  1.00 11.83           C  \nATOM   1249  OD1 ASP B  27      38.008 -10.859  62.590  1.00 13.94           O  \nATOM   1250  OD2 ASP B  27      37.894  -9.586  60.805  1.00  9.25           O  \nATOM   1251  N   VAL B  28      34.356 -13.751  60.342  1.00  7.89           N  \nATOM   1252  CA  VAL B  28      33.037 -14.357  60.160  1.00  7.06           C  \nATOM   1253  C   VAL B  28      32.926 -15.562  61.097  1.00  9.16           C  \nATOM   1254  O   VAL B  28      31.903 -15.760  61.754  1.00  7.46           O  \nATOM   1255  CB  VAL B  28      32.816 -14.809  58.693  1.00  6.73           C  \nATOM   1256  CG1 VAL B  28      31.580 -15.694  58.589  1.00  7.73           C  \nATOM   1257  CG2 VAL B  28      32.634 -13.586  57.804  1.00  7.11           C  \nATOM   1258  N   ARG B  29      33.987 -16.359  61.174  1.00  8.79           N  \nATOM   1259  CA  ARG B  29      33.973 -17.523  62.054  1.00  7.46           C  \nATOM   1260  C   ARG B  29      33.776 -17.098  63.509  1.00  8.15           C  \nATOM   1261  O   ARG B  29      33.002 -17.712  64.242  1.00  9.77           O  \nATOM   1262  CB  ARG B  29      35.277 -18.318  61.898  1.00  8.24           C  \nATOM   1263  CG  ARG B  29      35.368 -19.078  60.575  1.00  9.41           C  \nATOM   1264  CD  ARG B  29      36.749 -19.682  60.375  1.00  8.70           C  \nATOM   1265  NE  ARG B  29      36.866 -20.456  59.139  1.00  8.62           N  \nATOM   1266  CZ  ARG B  29      36.483 -21.722  59.003  1.00  8.78           C  \nATOM   1267  NH1 ARG B  29      35.950 -22.369  60.030  1.00  9.82           N  \nATOM   1268  NH2 ARG B  29      36.656 -22.349  57.843  1.00  7.70           N  \nATOM   1269  N   SER B  30      34.465 -16.037  63.918  1.00  8.47           N  \nATOM   1270  CA  SER B  30      34.359 -15.538  65.287  1.00  8.70           C  \nATOM   1271  C   SER B  30      32.961 -15.039  65.643  1.00 11.97           C  \nATOM   1272  O   SER B  30      32.552 -15.105  66.807  1.00 10.24           O  \nATOM   1273  CB  SER B  30      35.365 -14.405  65.520  1.00 10.41           C  \nATOM   1274  OG  SER B  30      36.696 -14.894  65.528  1.00 11.54           O  \nATOM   1275  N   SER B  31      32.233 -14.544  64.644  1.00  9.60           N  \nATOM   1276  CA  SER B  31      30.889 -14.011  64.854  1.00 10.45           C  \nATOM   1277  C   SER B  31      29.856 -15.081  65.192  1.00 14.38           C  \nATOM   1278  O   SER B  31      28.767 -14.765  65.677  1.00 12.30           O  \nATOM   1279  CB  SER B  31      30.422 -13.255  63.607  1.00 11.04           C  \nATOM   1280  OG  SER B  31      30.032 -14.161  62.589  1.00 12.20           O  \nATOM   1281  N   GLY B  32      30.193 -16.340  64.928  1.00 10.52           N  \nATOM   1282  CA  GLY B  32      29.270 -17.425  65.206  1.00 11.98           C  \nATOM   1283  C   GLY B  32      28.446 -17.773  63.980  1.00 13.86           C  \nATOM   1284  O   GLY B  32      27.744 -18.785  63.947  1.00 12.72           O  \nATOM   1285  N   SER B  33      28.535 -16.928  62.959  1.00 10.25           N  \nATOM   1286  CA  SER B  33      27.795 -17.154  61.730  1.00 10.12           C  \nATOM   1287  C   SER B  33      28.492 -18.175  60.842  1.00 13.27           C  \nATOM   1288  O   SER B  33      29.716 -18.303  60.857  1.00 14.12           O  \nATOM   1289  CB  SER B  33      27.634 -15.844  60.953  1.00 11.43           C  \nATOM   1290  OG  SER B  33      26.877 -16.052  59.770  1.00  9.60           O  \nATOM   1291  N   LYS B  34      27.692 -18.904  60.075  1.00 12.90           N  \nATOM   1292  CA  LYS B  34      28.201 -19.903  59.151  1.00 16.28           C  \nATOM   1293  C   LYS B  34      28.040 -19.350  57.738  1.00 15.90           C  \nATOM   1294  O   LYS B  34      28.468 -19.973  56.766  1.00 17.22           O  \nATOM   1295  CB  LYS B  34      27.387 -21.195  59.265  1.00 20.08           C  \nATOM   1296  CG  LYS B  34      27.424 -21.879  60.621  1.00 26.09           C  \nATOM   1297  CD  LYS B  34      28.788 -22.475  60.911  1.00 34.94           C  \nATOM   1298  CE  LYS B  34      28.685 -23.580  61.956  1.00 40.70           C  \nATOM   1299  NZ  LYS B  34      27.976 -23.125  63.184  1.00 42.62           N  \nATOM   1300  N   LYS B  35      27.418 -18.177  57.635  1.00 15.00           N  \nATOM   1301  CA  LYS B  35      27.156 -17.559  56.339  1.00 11.11           C  \nATOM   1302  C   LYS B  35      27.487 -16.076  56.267  1.00 10.39           C  \nATOM   1303  O   LYS B  35      27.381 -15.347  57.255  1.00 11.24           O  \nATOM   1304  CB  LYS B  35      25.683 -17.740  55.977  1.00 15.77           C  \nATOM   1305  CG  LYS B  35      25.189 -19.176  56.068  1.00 20.51           C  \nATOM   1306  CD  LYS B  35      23.718 -19.269  55.693  1.00 27.36           C  \nATOM   1307  CE  LYS B  35      23.207 -20.698  55.805  1.00 30.29           C  \nATOM   1308  NZ  LYS B  35      21.767 -20.799  55.436  1.00 32.88           N  \nATOM   1309  N   THR B  36      27.878 -15.635  55.080  1.00  9.45           N  \nATOM   1310  CA  THR B  36      28.195 -14.235  54.860  1.00  6.93           C  \nATOM   1311  C   THR B  36      28.056 -13.890  53.388  1.00  9.04           C  \nATOM   1312  O   THR B  36      28.339 -14.711  52.515  1.00  8.55           O  \nATOM   1313  CB  THR B  36      29.639 -13.890  55.312  1.00  8.94           C  \nATOM   1314  OG1 THR B  36      29.877 -12.488  55.108  1.00  7.64           O  \nATOM   1315  CG2 THR B  36      30.668 -14.686  54.509  1.00  8.11           C  \nATOM   1316  N   THR B  37      27.575 -12.685  53.116  1.00  6.55           N  \nATOM   1317  CA  THR B  37      27.456 -12.220  51.747  1.00  7.22           C  \nATOM   1318  C   THR B  37      28.550 -11.157  51.653  1.00  8.96           C  \nATOM   1319  O   THR B  37      28.499 -10.132  52.332  1.00 10.00           O  \nATOM   1320  CB  THR B  37      26.045 -11.642  51.461  1.00  9.54           C  \nATOM   1321  OG1 THR B  37      26.030 -11.052  50.157  1.00 19.34           O  \nATOM   1322  CG2 THR B  37      25.651 -10.610  52.505  1.00 10.53           C  \nATOM   1323  N   ILE B  38      29.562 -11.441  50.837  1.00  8.16           N  \nATOM   1324  CA  ILE B  38      30.718 -10.567  50.672  1.00  8.94           C  \nATOM   1325  C   ILE B  38      30.612  -9.660  49.451  1.00 10.05           C  \nATOM   1326  O   ILE B  38      30.499 -10.126  48.319  1.00  9.73           O  \nATOM   1327  CB  ILE B  38      32.004 -11.415  50.574  1.00  7.92           C  \nATOM   1328  CG1 ILE B  38      32.062 -12.379  51.763  1.00  9.45           C  \nATOM   1329  CG2 ILE B  38      33.238 -10.515  50.565  1.00  8.79           C  \nATOM   1330  CD1 ILE B  38      33.220 -13.372  51.715  1.00  7.50           C  \nATOM   1331  N   ASN B  39      30.662  -8.357  49.696  1.00  6.83           N  \nATOM   1332  CA  ASN B  39      30.555  -7.375  48.632  1.00  7.60           C  \nATOM   1333  C   ASN B  39      31.892  -6.676  48.469  1.00  7.50           C  \nATOM   1334  O   ASN B  39      32.391  -6.020  49.387  1.00  7.74           O  \nATOM   1335  CB  ASN B  39      29.431  -6.397  48.972  1.00  6.86           C  \nATOM   1336  CG  ASN B  39      28.067  -7.076  48.974  1.00  9.10           C  \nATOM   1337  OD1 ASN B  39      27.369  -7.091  47.962  1.00  8.69           O  \nATOM   1338  ND2 ASN B  39      27.695  -7.661  50.108  1.00  7.52           N  \nATOM   1339  N   VAL B  40      32.458  -6.839  47.279  1.00  7.15           N  \nATOM   1340  CA  VAL B  40      33.767  -6.311  46.936  1.00  7.12           C  \nATOM   1341  C   VAL B  40      33.661  -5.146  45.967  1.00  5.32           C  \nATOM   1342  O   VAL B  40      33.176  -5.295  44.850  1.00  7.18           O  \nATOM   1343  CB  VAL B  40      34.619  -7.420  46.298  1.00  7.37           C  \nATOM   1344  CG1 VAL B  40      36.071  -6.974  46.193  1.00  8.05           C  \nATOM   1345  CG2 VAL B  40      34.495  -8.707  47.128  1.00  8.26           C  \nATOM   1346  N   PHE B  41      34.125  -3.985  46.407  1.00  6.40           N  \nATOM   1347  CA  PHE B  41      34.074  -2.781  45.595  1.00  7.08           C  \nATOM   1348  C   PHE B  41      35.436  -2.650  44.936  1.00  8.59           C  \nATOM   1349  O   PHE B  41      36.407  -2.182  45.533  1.00  9.38           O  \nATOM   1350  CB  PHE B  41      33.711  -1.605  46.501  1.00  7.78           C  \nATOM   1351  CG  PHE B  41      32.379  -1.790  47.188  1.00  6.03           C  \nATOM   1352  CD1 PHE B  41      31.199  -1.394  46.565  1.00  7.43           C  \nATOM   1353  CD2 PHE B  41      32.299  -2.440  48.419  1.00  9.83           C  \nATOM   1354  CE1 PHE B  41      29.961  -1.645  47.155  1.00  7.05           C  \nATOM   1355  CE2 PHE B  41      31.067  -2.696  49.017  1.00  6.67           C  \nATOM   1356  CZ  PHE B  41      29.894  -2.297  48.381  1.00  8.89           C  \nATOM   1357  N   THR B  42      35.482  -3.107  43.690  1.00  7.50           N  \nATOM   1358  CA  THR B  42      36.710  -3.151  42.912  1.00  8.15           C  \nATOM   1359  C   THR B  42      36.402  -3.075  41.421  1.00  9.00           C  \nATOM   1360  O   THR B  42      35.268  -3.300  40.997  1.00  9.92           O  \nATOM   1361  CB  THR B  42      37.437  -4.487  43.196  1.00  8.93           C  \nATOM   1362  OG1 THR B  42      38.652  -4.557  42.448  1.00 10.65           O  \nATOM   1363  CG2 THR B  42      36.541  -5.666  42.806  1.00 11.87           C  \nATOM   1364  N   GLU B  43      37.422  -2.775  40.624  1.00 10.57           N  \nATOM   1365  CA  GLU B  43      37.249  -2.693  39.181  1.00 12.53           C  \nATOM   1366  C   GLU B  43      37.648  -3.989  38.483  1.00 14.07           C  \nATOM   1367  O   GLU B  43      37.383  -4.157  37.293  1.00 16.11           O  \nATOM   1368  CB  GLU B  43      38.075  -1.536  38.611  1.00 16.12           C  \nATOM   1369  CG  GLU B  43      37.726  -0.181  39.197  1.00 15.81           C  \nATOM   1370  CD  GLU B  43      36.268   0.189  38.986  1.00 23.61           C  \nATOM   1371  OE1 GLU B  43      35.846   0.301  37.816  1.00 24.60           O  \nATOM   1372  OE2 GLU B  43      35.545   0.365  39.989  1.00 18.58           O  \nATOM   1373  N   ILE B  44      38.278  -4.910  39.208  1.00 14.38           N  \nATOM   1374  CA  ILE B  44      38.701  -6.163  38.588  1.00 13.44           C  \nATOM   1375  C   ILE B  44      37.572  -7.170  38.400  1.00 15.13           C  \nATOM   1376  O   ILE B  44      36.524  -7.074  39.036  1.00 15.84           O  \nATOM   1377  CB  ILE B  44      39.841  -6.843  39.375  1.00 14.02           C  \nATOM   1378  CG1 ILE B  44      39.340  -7.340  40.733  1.00 11.19           C  \nATOM   1379  CG2 ILE B  44      40.994  -5.866  39.553  1.00 16.33           C  \nATOM   1380  CD1 ILE B  44      40.359  -8.210  41.455  1.00 15.68           C  \nATOM   1381  N   GLN B  45      37.807  -8.134  37.514  1.00 16.76           N  \nATOM   1382  CA  GLN B  45      36.832  -9.174  37.202  1.00 19.24           C  \nATOM   1383  C   GLN B  45      36.789 -10.271  38.260  1.00 16.19           C  \nATOM   1384  O   GLN B  45      37.752 -10.479  38.996  1.00 14.16           O  \nATOM   1385  CB  GLN B  45      37.155  -9.808  35.845  1.00 24.48           C  \nATOM   1386  CG  GLN B  45      37.228  -8.825  34.687  1.00 36.32           C  \nATOM   1387  CD  GLN B  45      35.945  -8.039  34.503  1.00 44.19           C  \nATOM   1388  OE1 GLN B  45      35.594  -7.194  35.328  1.00 48.12           O  \nATOM   1389  NE2 GLN B  45      35.232  -8.317  33.416  1.00 48.87           N  \nATOM   1390  N   TYR B  46      35.667 -10.979  38.312  1.00 14.44           N  \nATOM   1391  CA  TYR B  46      35.469 -12.063  39.267  1.00 15.86           C  \nATOM   1392  C   TYR B  46      36.586 -13.102  39.193  1.00 15.61           C  \nATOM   1393  O   TYR B  46      37.147 -13.498  40.215  1.00 13.79           O  \nATOM   1394  CB  TYR B  46      34.119 -12.740  39.004  1.00 18.12           C  \nATOM   1395  CG  TYR B  46      33.872 -13.978  39.836  1.00 21.54           C  \nATOM   1396  CD1 TYR B  46      33.393 -13.885  41.142  1.00 25.49           C  \nATOM   1397  CD2 TYR B  46      34.141 -15.242  39.324  1.00 25.07           C  \nATOM   1398  CE1 TYR B  46      33.190 -15.030  41.917  1.00 27.73           C  \nATOM   1399  CE2 TYR B  46      33.944 -16.387  40.088  1.00 28.82           C  \nATOM   1400  CZ  TYR B  46      33.470 -16.274  41.381  1.00 26.16           C  \nATOM   1401  OH  TYR B  46      33.292 -17.410  42.136  1.00 35.66           O  \nATOM   1402  N   GLN B  47      36.904 -13.545  37.980  1.00 14.94           N  \nATOM   1403  CA  GLN B  47      37.942 -14.550  37.785  1.00 16.78           C  \nATOM   1404  C   GLN B  47      39.307 -14.112  38.297  1.00 13.48           C  \nATOM   1405  O   GLN B  47      40.060 -14.923  38.834  1.00 14.27           O  \nATOM   1406  CB  GLN B  47      38.049 -14.931  36.306  1.00 22.36           C  \nATOM   1407  CG  GLN B  47      36.854 -15.712  35.777  1.00 35.45           C  \nATOM   1408  CD  GLN B  47      36.478 -16.881  36.668  1.00 40.51           C  \nATOM   1409  OE1 GLN B  47      37.328 -17.687  37.049  1.00 47.75           O  \nATOM   1410  NE2 GLN B  47      35.195 -16.982  37.001  1.00 44.08           N  \nATOM   1411  N   GLU B  48      39.635 -12.835  38.127  1.00 14.84           N  \nATOM   1412  CA  GLU B  48      40.919 -12.340  38.598  1.00 15.28           C  \nATOM   1413  C   GLU B  48      40.953 -12.332  40.122  1.00 11.23           C  \nATOM   1414  O   GLU B  48      41.966 -12.685  40.728  1.00 12.95           O  \nATOM   1415  CB  GLU B  48      41.194 -10.929  38.068  1.00 19.97           C  \nATOM   1416  CG  GLU B  48      42.401 -10.274  38.728  1.00 27.02           C  \nATOM   1417  CD  GLU B  48      42.936  -9.080  37.961  1.00 35.49           C  \nATOM   1418  OE1 GLU B  48      42.132  -8.218  37.548  1.00 40.04           O  \nATOM   1419  OE2 GLU B  48      44.169  -8.997  37.783  1.00 40.61           O  \nATOM   1420  N   LEU B  49      39.846 -11.926  40.736  1.00 11.02           N  \nATOM   1421  CA  LEU B  49      39.762 -11.885  42.193  1.00 11.31           C  \nATOM   1422  C   LEU B  49      39.961 -13.280  42.770  1.00 10.26           C  \nATOM   1423  O   LEU B  49      40.787 -13.481  43.656  1.00  9.70           O  \nATOM   1424  CB  LEU B  49      38.404 -11.336  42.644  1.00 10.72           C  \nATOM   1425  CG  LEU B  49      38.112 -11.444  44.146  1.00 11.65           C  \nATOM   1426  CD1 LEU B  49      39.136 -10.645  44.939  1.00 10.78           C  \nATOM   1427  CD2 LEU B  49      36.704 -10.938  44.434  1.00 11.81           C  \nATOM   1428  N   VAL B  50      39.202 -14.244  42.261  1.00 10.32           N  \nATOM   1429  CA  VAL B  50      39.306 -15.613  42.748  1.00 10.38           C  \nATOM   1430  C   VAL B  50      40.726 -16.154  42.600  1.00 10.88           C  \nATOM   1431  O   VAL B  50      41.206 -16.896  43.455  1.00 13.41           O  \nATOM   1432  CB  VAL B  50      38.310 -16.535  42.016  1.00 13.49           C  \nATOM   1433  CG1 VAL B  50      38.539 -17.985  42.420  1.00 17.72           C  \nATOM   1434  CG2 VAL B  50      36.884 -16.117  42.361  1.00 15.41           C  \nATOM   1435  N   THR B  51      41.407 -15.783  41.523  1.00 11.07           N  \nATOM   1436  CA  THR B  51      42.776 -16.248  41.341  1.00 10.86           C  \nATOM   1437  C   THR B  51      43.654 -15.720  42.478  1.00 11.23           C  \nATOM   1438  O   THR B  51      44.450 -16.459  43.060  1.00 10.30           O  \nATOM   1439  CB  THR B  51      43.347 -15.788  39.984  1.00 12.39           C  \nATOM   1440  OG1 THR B  51      42.631 -16.439  38.926  1.00 15.79           O  \nATOM   1441  CG2 THR B  51      44.827 -16.145  39.877  1.00 18.33           C  \nATOM   1442  N   LEU B  52      43.487 -14.445  42.810  1.00  9.34           N  \nATOM   1443  CA  LEU B  52      44.268 -13.828  43.879  1.00  9.57           C  \nATOM   1444  C   LEU B  52      43.998 -14.404  45.271  1.00 11.04           C  \nATOM   1445  O   LEU B  52      44.922 -14.555  46.074  1.00  9.13           O  \nATOM   1446  CB  LEU B  52      44.007 -12.317  43.913  1.00 10.77           C  \nATOM   1447  CG  LEU B  52      44.517 -11.502  42.726  1.00 12.17           C  \nATOM   1448  CD1 LEU B  52      43.986 -10.074  42.826  1.00  9.44           C  \nATOM   1449  CD2 LEU B  52      46.042 -11.518  42.710  1.00 12.47           C  \nATOM   1450  N   ILE B  53      42.737 -14.722  45.555  1.00  9.03           N  \nATOM   1451  CA  ILE B  53      42.364 -15.239  46.870  1.00  7.73           C  \nATOM   1452  C   ILE B  53      42.152 -16.749  46.942  1.00  7.93           C  \nATOM   1453  O   ILE B  53      41.464 -17.244  47.836  1.00  8.40           O  \nATOM   1454  CB  ILE B  53      41.103 -14.523  47.406  1.00  5.70           C  \nATOM   1455  CG1 ILE B  53      39.873 -14.863  46.556  1.00  6.12           C  \nATOM   1456  CG2 ILE B  53      41.334 -13.011  47.401  1.00  9.05           C  \nATOM   1457  CD1 ILE B  53      38.572 -14.312  47.139  1.00  8.25           C  \nATOM   1458  N   ARG B  54      42.758 -17.477  46.014  1.00  9.29           N  \nATOM   1459  CA  ARG B  54      42.631 -18.928  45.974  1.00  9.99           C  \nATOM   1460  C   ARG B  54      42.875 -19.572  47.327  1.00  8.02           C  \nATOM   1461  O   ARG B  54      42.100 -20.417  47.756  1.00  9.00           O  \nATOM   1462  CB  ARG B  54      43.621 -19.514  44.970  1.00 10.84           C  \nATOM   1463  CG  ARG B  54      43.545 -21.034  44.825  1.00 15.54           C  \nATOM   1464  CD  ARG B  54      44.889 -21.574  44.350  1.00 25.54           C  \nATOM   1465  NE  ARG B  54      45.874 -21.548  45.431  1.00 35.40           N  \nATOM   1466  CZ  ARG B  54      45.931 -22.444  46.417  1.00 35.95           C  \nATOM   1467  NH1 ARG B  54      46.855 -22.337  47.363  1.00 34.18           N  \nATOM   1468  NH2 ARG B  54      45.084 -23.463  46.445  1.00 36.89           N  \nATOM   1469  N   GLU B  55      43.955 -19.179  48.001  1.00  7.65           N  \nATOM   1470  CA  GLU B  55      44.280 -19.755  49.306  1.00  8.27           C  \nATOM   1471  C   GLU B  55      43.230 -19.447  50.378  1.00  8.18           C  \nATOM   1472  O   GLU B  55      42.825 -20.334  51.128  1.00  7.81           O  \nATOM   1473  CB  GLU B  55      45.660 -19.268  49.765  1.00  7.59           C  \nATOM   1474  CG  GLU B  55      46.121 -19.813  51.110  1.00  9.10           C  \nATOM   1475  CD  GLU B  55      46.189 -21.334  51.151  1.00 11.01           C  \nATOM   1476  OE1 GLU B  55      46.581 -21.942  50.133  1.00 11.02           O  \nATOM   1477  OE2 GLU B  55      45.871 -21.924  52.210  1.00 14.73           O  \nATOM   1478  N   ALA B  56      42.780 -18.197  50.450  1.00  5.58           N  \nATOM   1479  CA  ALA B  56      41.766 -17.826  51.441  1.00  8.49           C  \nATOM   1480  C   ALA B  56      40.509 -18.678  51.253  1.00  6.38           C  \nATOM   1481  O   ALA B  56      39.930 -19.169  52.222  1.00  7.61           O  \nATOM   1482  CB  ALA B  56      41.421 -16.341  51.305  1.00  7.15           C  \nATOM   1483  N   LEU B  57      40.087 -18.854  50.003  1.00  6.97           N  \nATOM   1484  CA  LEU B  57      38.895 -19.654  49.723  1.00  6.21           C  \nATOM   1485  C   LEU B  57      39.125 -21.130  50.040  1.00  6.89           C  \nATOM   1486  O   LEU B  57      38.231 -21.810  50.550  1.00  7.94           O  \nATOM   1487  CB  LEU B  57      38.481 -19.495  48.256  1.00  6.42           C  \nATOM   1488  CG  LEU B  57      38.129 -18.065  47.838  1.00  5.28           C  \nATOM   1489  CD1 LEU B  57      37.753 -18.044  46.360  1.00  9.60           C  \nATOM   1490  CD2 LEU B  57      36.975 -17.546  48.688  1.00  8.97           C  \nATOM   1491  N   LEU B  58      40.328 -21.617  49.746  1.00  7.19           N  \nATOM   1492  CA  LEU B  58      40.682 -23.014  50.003  1.00  6.27           C  \nATOM   1493  C   LEU B  58      40.545 -23.373  51.479  1.00  7.53           C  \nATOM   1494  O   LEU B  58      40.129 -24.481  51.820  1.00  8.25           O  \nATOM   1495  CB  LEU B  58      42.121 -23.282  49.548  1.00  6.35           C  \nATOM   1496  CG  LEU B  58      42.717 -24.658  49.858  1.00  7.35           C  \nATOM   1497  CD1 LEU B  58      41.888 -25.747  49.182  1.00  7.89           C  \nATOM   1498  CD2 LEU B  58      44.163 -24.708  49.380  1.00 10.98           C  \nATOM   1499  N   GLU B  59      40.896 -22.431  52.349  1.00  7.39           N  \nATOM   1500  CA  GLU B  59      40.833 -22.649  53.795  1.00  5.78           C  \nATOM   1501  C   GLU B  59      39.439 -22.459  54.377  1.00  7.88           C  \nATOM   1502  O   GLU B  59      39.225 -22.688  55.567  1.00  7.81           O  \nATOM   1503  CB  GLU B  59      41.794 -21.689  54.508  1.00  7.90           C  \nATOM   1504  CG  GLU B  59      43.269 -21.913  54.189  1.00  9.78           C  \nATOM   1505  CD  GLU B  59      44.161 -20.852  54.813  1.00 14.31           C  \nATOM   1506  OE1 GLU B  59      43.781 -20.303  55.868  1.00 14.64           O  \nATOM   1507  OE2 GLU B  59      45.246 -20.578  54.261  1.00 12.79           O  \nATOM   1508  N   ASN B  60      38.487 -22.056  53.543  1.00  7.83           N  \nATOM   1509  CA  ASN B  60      37.139 -21.803  54.034  1.00  6.84           C  \nATOM   1510  C   ASN B  60      36.024 -22.395  53.193  1.00  9.20           C  \nATOM   1511  O   ASN B  60      34.979 -21.777  52.989  1.00  7.74           O  \nATOM   1512  CB  ASN B  60      36.959 -20.295  54.187  1.00  7.58           C  \nATOM   1513  CG  ASN B  60      37.812 -19.737  55.302  1.00  7.35           C  \nATOM   1514  OD1 ASN B  60      37.463 -19.854  56.474  1.00  8.74           O  \nATOM   1515  ND2 ASN B  60      38.955 -19.151  54.947  1.00  7.82           N  \nATOM   1516  N   ILE B  61      36.254 -23.612  52.716  1.00  7.19           N  \nATOM   1517  CA  ILE B  61      35.274 -24.308  51.903  1.00  8.45           C  \nATOM   1518  C   ILE B  61      33.970 -24.537  52.664  1.00  6.57           C  \nATOM   1519  O   ILE B  61      32.893 -24.505  52.067  1.00  7.89           O  \nATOM   1520  CB  ILE B  61      35.847 -25.659  51.421  1.00  5.90           C  \nATOM   1521  CG1 ILE B  61      36.984 -25.406  50.425  1.00  9.41           C  \nATOM   1522  CG2 ILE B  61      34.754 -26.509  50.796  1.00  8.75           C  \nATOM   1523  CD1 ILE B  61      37.798 -26.654  50.073  1.00  8.14           C  \nATOM   1524  N   ASP B  62      34.053 -24.753  53.977  1.00  7.51           N  \nATOM   1525  CA  ASP B  62      32.839 -24.992  54.752  1.00  7.54           C  \nATOM   1526  C   ASP B  62      32.080 -23.742  55.198  1.00  8.49           C  \nATOM   1527  O   ASP B  62      31.092 -23.839  55.927  1.00  9.19           O  \nATOM   1528  CB  ASP B  62      33.125 -25.913  55.954  1.00  8.95           C  \nATOM   1529  CG  ASP B  62      34.151 -25.345  56.931  1.00 11.12           C  \nATOM   1530  OD1 ASP B  62      34.862 -24.373  56.603  1.00 11.35           O  \nATOM   1531  OD2 ASP B  62      34.250 -25.905  58.043  1.00 12.08           O  \nATOM   1532  N   ILE B  63      32.526 -22.570  54.754  1.00  6.73           N  \nATOM   1533  CA  ILE B  63      31.831 -21.333  55.099  1.00  7.47           C  \nATOM   1534  C   ILE B  63      30.831 -21.025  53.983  1.00  6.96           C  \nATOM   1535  O   ILE B  63      31.175 -21.080  52.801  1.00  8.12           O  \nATOM   1536  CB  ILE B  63      32.812 -20.143  55.247  1.00  7.47           C  \nATOM   1537  CG1 ILE B  63      33.789 -20.415  56.397  1.00  8.97           C  \nATOM   1538  CG2 ILE B  63      32.041 -18.852  55.484  1.00  9.26           C  \nATOM   1539  CD1 ILE B  63      33.126 -20.594  57.752  1.00 13.96           C  \nATOM   1540  N   GLY B  64      29.594 -20.718  54.361  1.00  8.71           N  \nATOM   1541  CA  GLY B  64      28.574 -20.414  53.371  1.00  9.81           C  \nATOM   1542  C   GLY B  64      28.652 -18.974  52.900  1.00 11.60           C  \nATOM   1543  O   GLY B  64      27.928 -18.109  53.392  1.00 16.00           O  \nATOM   1544  N   TYR B  65      29.521 -18.716  51.931  1.00  9.38           N  \nATOM   1545  CA  TYR B  65      29.691 -17.360  51.422  1.00  9.58           C  \nATOM   1546  C   TYR B  65      29.271 -17.191  49.968  1.00  9.17           C  \nATOM   1547  O   TYR B  65      29.208 -18.152  49.198  1.00 10.42           O  \nATOM   1548  CB  TYR B  65      31.159 -16.940  51.560  1.00  8.00           C  \nATOM   1549  CG  TYR B  65      32.102 -17.727  50.671  1.00  8.44           C  \nATOM   1550  CD1 TYR B  65      32.355 -17.325  49.358  1.00  8.81           C  \nATOM   1551  CD2 TYR B  65      32.707 -18.900  51.130  1.00  7.86           C  \nATOM   1552  CE1 TYR B  65      33.186 -18.072  48.522  1.00  9.11           C  \nATOM   1553  CE2 TYR B  65      33.542 -19.655  50.300  1.00  7.54           C  \nATOM   1554  CZ  TYR B  65      33.773 -19.233  48.997  1.00  8.70           C  \nATOM   1555  OH  TYR B  65      34.584 -19.970  48.162  1.00  8.32           O  \nATOM   1556  N   GLU B  66      28.971 -15.950  49.609  1.00  9.95           N  \nATOM   1557  CA  GLU B  66      28.626 -15.599  48.244  1.00 10.88           C  \nATOM   1558  C   GLU B  66      29.390 -14.316  47.987  1.00 10.98           C  \nATOM   1559  O   GLU B  66      29.493 -13.463  48.869  1.00 11.96           O  \nATOM   1560  CB  GLU B  66      27.117 -15.390  48.066  1.00 16.40           C  \nATOM   1561  CG  GLU B  66      26.420 -14.541  49.113  1.00 22.87           C  \nATOM   1562  CD  GLU B  66      24.932 -14.377  48.814  1.00 29.66           C  \nATOM   1563  OE1 GLU B  66      24.317 -15.340  48.309  1.00 28.07           O  \nATOM   1564  OE2 GLU B  66      24.372 -13.294  49.089  1.00 28.91           O  \nATOM   1565  N   LEU B  67      29.958 -14.200  46.793  1.00 10.09           N  \nATOM   1566  CA  LEU B  67      30.736 -13.023  46.438  1.00  9.45           C  \nATOM   1567  C   LEU B  67      30.013 -12.174  45.404  1.00  9.82           C  \nATOM   1568  O   LEU B  67      29.510 -12.684  44.405  1.00  9.58           O  \nATOM   1569  CB  LEU B  67      32.098 -13.436  45.864  1.00 10.31           C  \nATOM   1570  CG  LEU B  67      33.024 -14.359  46.663  1.00 12.61           C  \nATOM   1571  CD1 LEU B  67      34.260 -14.652  45.824  1.00 14.54           C  \nATOM   1572  CD2 LEU B  67      33.416 -13.716  47.986  1.00 16.56           C  \nATOM   1573  N   PHE B  68      29.965 -10.874  45.655  1.00  7.13           N  \nATOM   1574  CA  PHE B  68      29.349  -9.941  44.731  1.00  8.35           C  \nATOM   1575  C   PHE B  68      30.373  -8.842  44.496  1.00  8.15           C  \nATOM   1576  O   PHE B  68      30.893  -8.265  45.452  1.00  9.87           O  \nATOM   1577  CB  PHE B  68      28.079  -9.342  45.338  1.00  6.56           C  \nATOM   1578  CG  PHE B  68      26.940 -10.313  45.438  1.00 11.63           C  \nATOM   1579  CD1 PHE B  68      26.211 -10.667  44.306  1.00 15.37           C  \nATOM   1580  CD2 PHE B  68      26.596 -10.875  46.662  1.00 12.83           C  \nATOM   1581  CE1 PHE B  68      25.152 -11.568  44.393  1.00 13.27           C  \nATOM   1582  CE2 PHE B  68      25.539 -11.778  46.760  1.00 15.36           C  \nATOM   1583  CZ  PHE B  68      24.817 -12.124  45.626  1.00 16.24           C  \nATOM   1584  N   LEU B  69      30.692  -8.578  43.234  1.00  5.68           N  \nATOM   1585  CA  LEU B  69      31.650  -7.527  42.914  1.00  4.44           C  \nATOM   1586  C   LEU B  69      30.907  -6.317  42.384  1.00  6.39           C  \nATOM   1587  O   LEU B  69      29.952  -6.459  41.617  1.00  7.09           O  \nATOM   1588  CB  LEU B  69      32.661  -8.008  41.873  1.00  5.18           C  \nATOM   1589  CG  LEU B  69      33.798  -8.882  42.412  1.00 10.26           C  \nATOM   1590  CD1 LEU B  69      33.221 -10.151  43.019  1.00 11.61           C  \nATOM   1591  CD2 LEU B  69      34.768  -9.215  41.286  1.00 11.86           C  \nATOM   1592  N   TRP B  70      31.340  -5.130  42.800  1.00  6.32           N  \nATOM   1593  CA  TRP B  70      30.705  -3.894  42.360  1.00  6.17           C  \nATOM   1594  C   TRP B  70      31.718  -2.869  41.889  1.00  6.61           C  \nATOM   1595  O   TRP B  70      32.664  -2.547  42.611  1.00  7.06           O  \nATOM   1596  CB  TRP B  70      29.895  -3.267  43.501  1.00  7.19           C  \nATOM   1597  CG  TRP B  70      28.922  -4.198  44.142  1.00  8.42           C  \nATOM   1598  CD1 TRP B  70      29.044  -4.803  45.358  1.00  9.62           C  \nATOM   1599  CD2 TRP B  70      27.671  -4.631  43.600  1.00 10.62           C  \nATOM   1600  NE1 TRP B  70      27.941  -5.588  45.610  1.00  8.49           N  \nATOM   1601  CE2 TRP B  70      27.083  -5.499  44.545  1.00  7.83           C  \nATOM   1602  CE3 TRP B  70      26.989  -4.369  42.403  1.00 11.10           C  \nATOM   1603  CZ2 TRP B  70      25.840  -6.108  44.333  1.00 10.76           C  \nATOM   1604  CZ3 TRP B  70      25.756  -4.974  42.191  1.00 13.52           C  \nATOM   1605  CH2 TRP B  70      25.194  -5.835  43.152  1.00 12.87           C  \nATOM   1606  N   LYS B  71      31.529  -2.358  40.679  1.00  7.61           N  \nATOM   1607  CA  LYS B  71      32.419  -1.326  40.172  1.00  6.82           C  \nATOM   1608  C   LYS B  71      32.048  -0.038  40.905  1.00  7.46           C  \nATOM   1609  O   LYS B  71      30.964   0.055  41.489  1.00  8.76           O  \nATOM   1610  CB  LYS B  71      32.262  -1.184  38.657  1.00 10.45           C  \nATOM   1611  CG  LYS B  71      32.688  -2.447  37.920  1.00 14.60           C  \nATOM   1612  CD  LYS B  71      32.776  -2.235  36.424  1.00 21.45           C  \nATOM   1613  CE  LYS B  71      33.170  -3.528  35.718  1.00 28.85           C  \nATOM   1614  NZ  LYS B  71      34.417  -4.119  36.279  1.00 29.47           N  \nATOM   1615  N   LYS B  72      32.934   0.952  40.881  1.00 10.20           N  \nATOM   1616  CA  LYS B  72      32.683   2.190  41.615  1.00 10.67           C  \nATOM   1617  C   LYS B  72      31.363   2.895  41.325  1.00 11.13           C  \nATOM   1618  O   LYS B  72      30.823   3.562  42.204  1.00 12.36           O  \nATOM   1619  CB  LYS B  72      33.845   3.175  41.423  1.00 12.82           C  \nATOM   1620  CG  LYS B  72      34.057   3.639  40.001  1.00 18.96           C  \nATOM   1621  CD  LYS B  72      35.183   4.664  39.913  1.00 28.19           C  \nATOM   1622  CE  LYS B  72      36.520   4.078  40.352  1.00 32.59           C  \nATOM   1623  NZ  LYS B  72      37.623   5.080  40.287  1.00 35.96           N  \nATOM   1624  N   ASN B  73      30.832   2.751  40.113  1.00  8.90           N  \nATOM   1625  CA  ASN B  73      29.574   3.414  39.788  1.00  9.56           C  \nATOM   1626  C   ASN B  73      28.354   2.527  40.037  1.00 10.10           C  \nATOM   1627  O   ASN B  73      27.233   2.896  39.693  1.00 10.34           O  \nATOM   1628  CB  ASN B  73      29.592   3.918  38.328  1.00  8.81           C  \nATOM   1629  CG  ASN B  73      29.639   2.794  37.304  1.00 10.55           C  \nATOM   1630  OD1 ASN B  73      29.998   1.660  37.616  1.00 12.03           O  \nATOM   1631  ND2 ASN B  73      29.290   3.117  36.060  1.00  9.29           N  \nATOM   1632  N   GLU B  74      28.569   1.373  40.666  1.00  9.00           N  \nATOM   1633  CA  GLU B  74      27.469   0.454  40.940  1.00  6.85           C  \nATOM   1634  C   GLU B  74      27.067   0.383  42.410  1.00  8.04           C  \nATOM   1635  O   GLU B  74      26.327  -0.515  42.811  1.00  7.33           O  \nATOM   1636  CB  GLU B  74      27.822  -0.950  40.445  1.00  9.08           C  \nATOM   1637  CG  GLU B  74      28.150  -1.011  38.957  1.00  8.15           C  \nATOM   1638  CD  GLU B  74      28.526  -2.404  38.503  1.00 12.67           C  \nATOM   1639  OE1 GLU B  74      29.315  -3.068  39.207  1.00 10.13           O  \nATOM   1640  OE2 GLU B  74      28.042  -2.832  37.435  1.00 15.47           O  \nATOM   1641  N   VAL B  75      27.546   1.323  43.217  1.00  6.01           N  \nATOM   1642  CA  VAL B  75      27.194   1.309  44.628  1.00  6.91           C  \nATOM   1643  C   VAL B  75      25.682   1.445  44.799  1.00  6.67           C  \nATOM   1644  O   VAL B  75      25.110   0.892  45.736  1.00  8.26           O  \nATOM   1645  CB  VAL B  75      27.912   2.439  45.412  1.00  7.12           C  \nATOM   1646  CG1 VAL B  75      27.420   2.463  46.858  1.00  5.38           C  \nATOM   1647  CG2 VAL B  75      29.418   2.209  45.390  1.00  6.09           C  \nATOM   1648  N   ASP B  76      25.025   2.163  43.893  1.00  6.82           N  \nATOM   1649  CA  ASP B  76      23.583   2.319  44.020  1.00  7.89           C  \nATOM   1650  C   ASP B  76      22.834   1.000  43.830  1.00  7.12           C  \nATOM   1651  O   ASP B  76      21.776   0.803  44.422  1.00  8.14           O  \nATOM   1652  CB  ASP B  76      23.051   3.404  43.064  1.00  7.64           C  \nATOM   1653  CG  ASP B  76      23.365   3.132  41.602  1.00 11.13           C  \nATOM   1654  OD1 ASP B  76      24.132   2.203  41.297  1.00 10.63           O  \nATOM   1655  OD2 ASP B  76      22.837   3.878  40.751  1.00 13.20           O  \nATOM   1656  N   ILE B  77      23.387   0.092  43.028  1.00  6.11           N  \nATOM   1657  CA  ILE B  77      22.744  -1.205  42.808  1.00  8.01           C  \nATOM   1658  C   ILE B  77      22.865  -2.010  44.101  1.00  8.15           C  \nATOM   1659  O   ILE B  77      21.906  -2.637  44.558  1.00  9.44           O  \nATOM   1660  CB  ILE B  77      23.425  -2.003  41.673  1.00  9.58           C  \nATOM   1661  CG1 ILE B  77      23.411  -1.197  40.376  1.00  7.88           C  \nATOM   1662  CG2 ILE B  77      22.686  -3.322  41.452  1.00  8.83           C  \nATOM   1663  CD1 ILE B  77      24.174  -1.865  39.240  1.00 12.83           C  \nATOM   1664  N   PHE B  78      24.063  -1.987  44.677  1.00  6.79           N  \nATOM   1665  CA  PHE B  78      24.345  -2.679  45.931  1.00  8.25           C  \nATOM   1666  C   PHE B  78      23.391  -2.195  47.028  1.00  8.65           C  \nATOM   1667  O   PHE B  78      22.766  -2.994  47.732  1.00  7.35           O  \nATOM   1668  CB  PHE B  78      25.797  -2.404  46.343  1.00  8.13           C  \nATOM   1669  CG  PHE B  78      26.064  -2.614  47.804  1.00  9.18           C  \nATOM   1670  CD1 PHE B  78      26.089  -3.896  48.347  1.00 11.50           C  \nATOM   1671  CD2 PHE B  78      26.260  -1.525  48.647  1.00  9.14           C  \nATOM   1672  CE1 PHE B  78      26.302  -4.091  49.710  1.00 12.70           C  \nATOM   1673  CE2 PHE B  78      26.472  -1.709  50.011  1.00  8.09           C  \nATOM   1674  CZ  PHE B  78      26.492  -2.997  50.543  1.00  8.89           C  \nATOM   1675  N   LEU B  79      23.280  -0.879  47.174  1.00  6.99           N  \nATOM   1676  CA  LEU B  79      22.406  -0.309  48.195  1.00  8.19           C  \nATOM   1677  C   LEU B  79      20.935  -0.653  47.975  1.00  9.19           C  \nATOM   1678  O   LEU B  79      20.199  -0.903  48.933  1.00 10.56           O  \nATOM   1679  CB  LEU B  79      22.586   1.212  48.258  1.00  7.77           C  \nATOM   1680  CG  LEU B  79      23.921   1.718  48.820  1.00  5.84           C  \nATOM   1681  CD1 LEU B  79      23.942   3.241  48.802  1.00  6.51           C  \nATOM   1682  CD2 LEU B  79      24.111   1.209  50.245  1.00  8.59           C  \nATOM   1683  N   LYS B  80      20.506  -0.667  46.717  1.00  8.80           N  \nATOM   1684  CA  LYS B  80      19.117  -0.992  46.399  1.00 11.21           C  \nATOM   1685  C   LYS B  80      18.807  -2.433  46.794  1.00 10.33           C  \nATOM   1686  O   LYS B  80      17.754  -2.720  47.370  1.00 11.42           O  \nATOM   1687  CB  LYS B  80      18.856  -0.805  44.901  1.00  8.58           C  \nATOM   1688  CG  LYS B  80      17.441  -1.174  44.457  1.00 13.04           C  \nATOM   1689  CD  LYS B  80      16.393  -0.278  45.106  1.00 19.56           C  \nATOM   1690  CE  LYS B  80      14.994  -0.616  44.612  1.00 20.22           C  \nATOM   1691  NZ  LYS B  80      14.629  -2.024  44.919  1.00 31.99           N  \nATOM   1692  N   ASN B  81      19.731  -3.335  46.486  1.00  7.78           N  \nATOM   1693  CA  ASN B  81      19.559  -4.746  46.801  1.00  8.85           C  \nATOM   1694  C   ASN B  81      19.494  -5.008  48.302  1.00 11.79           C  \nATOM   1695  O   ASN B  81      18.920  -6.005  48.733  1.00 13.02           O  \nATOM   1696  CB  ASN B  81      20.695  -5.571  46.195  1.00  8.56           C  \nATOM   1697  CG  ASN B  81      20.609  -5.668  44.686  1.00 11.64           C  \nATOM   1698  OD1 ASN B  81      19.701  -5.116  44.060  1.00 10.80           O  \nATOM   1699  ND2 ASN B  81      21.561  -6.377  44.091  1.00 10.75           N  \nATOM   1700  N   LEU B  82      20.082  -4.120  49.098  1.00  9.55           N  \nATOM   1701  CA  LEU B  82      20.057  -4.301  50.545  1.00 10.33           C  \nATOM   1702  C   LEU B  82      18.641  -4.223  51.100  1.00 11.86           C  \nATOM   1703  O   LEU B  82      18.372  -4.695  52.203  1.00 13.00           O  \nATOM   1704  CB  LEU B  82      20.930  -3.254  51.240  1.00  9.26           C  \nATOM   1705  CG  LEU B  82      22.442  -3.431  51.116  1.00  9.05           C  \nATOM   1706  CD1 LEU B  82      23.140  -2.329  51.907  1.00  8.92           C  \nATOM   1707  CD2 LEU B  82      22.851  -4.799  51.646  1.00 10.02           C  \nATOM   1708  N   GLU B  83      17.731  -3.629  50.339  1.00 14.53           N  \nATOM   1709  CA  GLU B  83      16.353  -3.521  50.798  1.00 19.28           C  \nATOM   1710  C   GLU B  83      15.740  -4.909  50.969  1.00 16.91           C  \nATOM   1711  O   GLU B  83      14.796  -5.087  51.740  1.00 22.85           O  \nATOM   1712  CB  GLU B  83      15.523  -2.705  49.806  1.00 17.82           C  \nATOM   1713  CG  GLU B  83      16.124  -1.348  49.480  1.00 20.84           C  \nATOM   1714  CD  GLU B  83      15.169  -0.450  48.720  1.00 24.65           C  \nATOM   1715  OE1 GLU B  83      14.455  -0.957  47.831  1.00 24.44           O  \nATOM   1716  OE2 GLU B  83      15.143   0.766  49.008  1.00 29.53           O  \nATOM   1717  N   LYS B  84      16.288  -5.890  50.257  1.00 18.37           N  \nATOM   1718  CA  LYS B  84      15.791  -7.263  50.318  1.00 19.92           C  \nATOM   1719  C   LYS B  84      16.692  -8.213  51.104  1.00 21.36           C  \nATOM   1720  O   LYS B  84      16.516  -9.429  51.038  1.00 22.42           O  \nATOM   1721  CB  LYS B  84      15.623  -7.824  48.905  1.00 19.42           C  \nATOM   1722  CG  LYS B  84      14.672  -7.046  48.012  1.00 20.23           C  \nATOM   1723  CD  LYS B  84      14.571  -7.707  46.647  1.00 19.41           C  \nATOM   1724  CE  LYS B  84      13.602  -6.969  45.739  1.00 21.89           C  \nATOM   1725  NZ  LYS B  84      13.462  -7.655  44.424  1.00 22.51           N  \nATOM   1726  N   SER B  85      17.653  -7.668  51.842  1.00 20.41           N  \nATOM   1727  CA  SER B  85      18.573  -8.503  52.610  1.00 23.07           C  \nATOM   1728  C   SER B  85      18.061  -8.818  54.011  1.00 23.57           C  \nATOM   1729  O   SER B  85      17.211  -8.109  54.546  1.00 24.14           O  \nATOM   1730  CB  SER B  85      19.933  -7.813  52.728  1.00 21.57           C  \nATOM   1731  OG  SER B  85      19.832  -6.638  53.513  1.00 25.20           O  \nATOM   1732  N   GLU B  86      18.589  -9.890  54.595  1.00 26.07           N  \nATOM   1733  CA  GLU B  86      18.218 -10.297  55.947  1.00 27.12           C  \nATOM   1734  C   GLU B  86      19.449 -10.455  56.833  1.00 25.62           C  \nATOM   1735  O   GLU B  86      19.457 -11.265  57.761  1.00 29.42           O  \nATOM   1736  CB  GLU B  86      17.442 -11.616  55.932  1.00 33.85           C  \nATOM   1737  CG  GLU B  86      15.974 -11.483  55.572  1.00 46.71           C  \nATOM   1738  CD  GLU B  86      15.149 -12.647  56.094  1.00 55.10           C  \nATOM   1739  OE1 GLU B  86      15.076 -12.816  57.331  1.00 58.77           O  \nATOM   1740  OE2 GLU B  86      14.577 -13.393  55.272  1.00 60.31           O  \nATOM   1741  N   VAL B  87      20.487  -9.678  56.549  1.00 19.87           N  \nATOM   1742  CA  VAL B  87      21.721  -9.739  57.325  1.00 15.79           C  \nATOM   1743  C   VAL B  87      21.506  -9.220  58.747  1.00 15.58           C  \nATOM   1744  O   VAL B  87      20.686  -8.329  58.969  1.00 16.78           O  \nATOM   1745  CB  VAL B  87      22.835  -8.920  56.642  1.00 13.99           C  \nATOM   1746  CG1 VAL B  87      23.189  -9.550  55.304  1.00 14.84           C  \nATOM   1747  CG2 VAL B  87      22.378  -7.485  56.435  1.00 15.74           C  \nATOM   1748  N   ASP B  88      22.243  -9.777  59.707  1.00 12.15           N  \nATOM   1749  CA  ASP B  88      22.111  -9.363  61.103  1.00 12.58           C  \nATOM   1750  C   ASP B  88      23.424  -8.891  61.719  1.00 12.85           C  \nATOM   1751  O   ASP B  88      23.489  -8.607  62.913  1.00 12.10           O  \nATOM   1752  CB  ASP B  88      21.535 -10.510  61.946  1.00 12.92           C  \nATOM   1753  CG  ASP B  88      22.373 -11.778  61.865  1.00 16.42           C  \nATOM   1754  OD1 ASP B  88      23.456 -11.748  61.248  1.00 13.85           O  \nATOM   1755  OD2 ASP B  88      21.945 -12.809  62.426  1.00 18.60           O  \nATOM   1756  N   GLY B  89      24.465  -8.810  60.898  1.00  9.61           N  \nATOM   1757  CA  GLY B  89      25.765  -8.370  61.375  1.00  8.63           C  \nATOM   1758  C   GLY B  89      26.526  -7.749  60.220  1.00  8.43           C  \nATOM   1759  O   GLY B  89      26.303  -8.118  59.068  1.00  9.07           O  \nATOM   1760  N   LEU B  90      27.431  -6.824  60.526  1.00  6.06           N  \nATOM   1761  CA  LEU B  90      28.197  -6.125  59.495  1.00  7.92           C  \nATOM   1762  C   LEU B  90      29.699  -6.040  59.755  1.00  8.64           C  \nATOM   1763  O   LEU B  90      30.126  -5.642  60.839  1.00  8.63           O  \nATOM   1764  CB  LEU B  90      27.641  -4.703  59.335  1.00  6.14           C  \nATOM   1765  CG  LEU B  90      28.462  -3.683  58.540  1.00  7.39           C  \nATOM   1766  CD1 LEU B  90      28.459  -4.048  57.061  1.00  8.17           C  \nATOM   1767  CD2 LEU B  90      27.865  -2.287  58.742  1.00  7.67           C  \nATOM   1768  N   LEU B  91      30.488  -6.410  58.747  1.00  8.03           N  \nATOM   1769  CA  LEU B  91      31.948  -6.346  58.821  1.00  7.73           C  \nATOM   1770  C   LEU B  91      32.418  -5.421  57.696  1.00  7.16           C  \nATOM   1771  O   LEU B  91      31.980  -5.560  56.556  1.00  7.44           O  \nATOM   1772  CB  LEU B  91      32.566  -7.739  58.630  1.00  8.30           C  \nATOM   1773  CG  LEU B  91      32.297  -8.804  59.697  1.00  9.27           C  \nATOM   1774  CD1 LEU B  91      32.918 -10.122  59.253  1.00  8.84           C  \nATOM   1775  CD2 LEU B  91      32.879  -8.366  61.036  1.00  9.26           C  \nATOM   1776  N   VAL B  92      33.300  -4.476  58.020  1.00  5.28           N  \nATOM   1777  CA  VAL B  92      33.805  -3.528  57.030  1.00  7.29           C  \nATOM   1778  C   VAL B  92      35.331  -3.537  56.959  1.00  8.28           C  \nATOM   1779  O   VAL B  92      36.003  -3.466  57.991  1.00  8.12           O  \nATOM   1780  CB  VAL B  92      33.333  -2.097  57.360  1.00  6.10           C  \nATOM   1781  CG1 VAL B  92      33.953  -1.102  56.387  1.00  9.80           C  \nATOM   1782  CG2 VAL B  92      31.810  -2.031  57.295  1.00  8.41           C  \nATOM   1783  N   TYR B  93      35.865  -3.613  55.739  1.00  7.56           N  \nATOM   1784  CA  TYR B  93      37.314  -3.644  55.512  1.00  8.52           C  \nATOM   1785  C   TYR B  93      37.751  -2.746  54.368  1.00  8.93           C  \nATOM   1786  O   TYR B  93      37.059  -2.635  53.356  1.00  8.79           O  \nATOM   1787  CB  TYR B  93      37.777  -5.054  55.143  1.00  6.28           C  \nATOM   1788  CG  TYR B  93      37.401  -6.110  56.135  1.00  7.75           C  \nATOM   1789  CD1 TYR B  93      38.258  -6.448  57.178  1.00  8.54           C  \nATOM   1790  CD2 TYR B  93      36.173  -6.760  56.047  1.00  6.62           C  \nATOM   1791  CE1 TYR B  93      37.899  -7.410  58.112  1.00  7.93           C  \nATOM   1792  CE2 TYR B  93      35.805  -7.720  56.973  1.00  7.24           C  \nATOM   1793  CZ  TYR B  93      36.668  -8.041  58.001  1.00  6.95           C  \nATOM   1794  OH  TYR B  93      36.297  -8.983  58.924  1.00  8.30           O  \nATOM   1795  N   CYS B  94      38.916  -2.126  54.519  1.00 10.13           N  \nATOM   1796  CA  CYS B  94      39.474  -1.296  53.458  1.00  6.30           C  \nATOM   1797  C   CYS B  94      40.934  -1.012  53.768  1.00  9.34           C  \nATOM   1798  O   CYS B  94      41.413  -1.327  54.855  1.00  9.31           O  \nATOM   1799  CB  CYS B  94      38.720   0.038  53.327  1.00  9.03           C  \nATOM   1800  SG  CYS B  94      39.178   1.336  54.530  1.00  9.87           S  \nATOM   1801  N   ASP B  95      41.650  -0.461  52.793  1.00  8.48           N  \nATOM   1802  CA  ASP B  95      43.035  -0.071  53.012  1.00 10.08           C  \nATOM   1803  C   ASP B  95      43.051   1.444  52.844  1.00 11.80           C  \nATOM   1804  O   ASP B  95      42.013   2.040  52.560  1.00 10.63           O  \nATOM   1805  CB  ASP B  95      44.006  -0.766  52.039  1.00 10.61           C  \nATOM   1806  CG  ASP B  95      43.580  -0.672  50.585  1.00  8.45           C  \nATOM   1807  OD1 ASP B  95      42.664   0.111  50.255  1.00 12.75           O  \nATOM   1808  OD2 ASP B  95      44.191  -1.392  49.765  1.00 11.59           O  \nATOM   1809  N   ASP B  96      44.202   2.080  53.024  1.00 12.83           N  \nATOM   1810  CA  ASP B  96      44.246   3.534  52.912  1.00 12.81           C  \nATOM   1811  C   ASP B  96      43.786   4.116  51.581  1.00 12.83           C  \nATOM   1812  O   ASP B  96      43.073   5.124  51.555  1.00 12.12           O  \nATOM   1813  CB  ASP B  96      45.646   4.051  53.243  1.00 14.63           C  \nATOM   1814  CG  ASP B  96      45.965   3.940  54.717  1.00 18.00           C  \nATOM   1815  OD1 ASP B  96      45.036   4.107  55.539  1.00 20.62           O  \nATOM   1816  OD2 ASP B  96      47.142   3.704  55.055  1.00 20.71           O  \nATOM   1817  N   GLU B  97      44.181   3.493  50.480  1.00 13.53           N  \nATOM   1818  CA  GLU B  97      43.797   3.990  49.165  1.00 16.29           C  \nATOM   1819  C   GLU B  97      42.293   3.999  48.910  1.00 15.06           C  \nATOM   1820  O   GLU B  97      41.811   4.738  48.053  1.00 13.57           O  \nATOM   1821  CB  GLU B  97      44.491   3.177  48.068  1.00 19.19           C  \nATOM   1822  CG  GLU B  97      45.967   3.506  47.915  1.00 33.67           C  \nATOM   1823  CD  GLU B  97      46.597   2.839  46.710  1.00 39.74           C  \nATOM   1824  OE1 GLU B  97      46.065   3.000  45.590  1.00 44.51           O  \nATOM   1825  OE2 GLU B  97      47.631   2.159  46.883  1.00 45.30           O  \nATOM   1826  N   ASN B  98      41.549   3.195  49.661  1.00 12.17           N  \nATOM   1827  CA  ASN B  98      40.107   3.113  49.459  1.00 11.15           C  \nATOM   1828  C   ASN B  98      39.261   3.487  50.674  1.00 11.99           C  \nATOM   1829  O   ASN B  98      38.048   3.275  50.679  1.00 10.72           O  \nATOM   1830  CB  ASN B  98      39.754   1.699  48.991  1.00 11.64           C  \nATOM   1831  CG  ASN B  98      40.408   1.347  47.664  1.00 10.09           C  \nATOM   1832  OD1 ASN B  98      39.992   1.828  46.607  1.00 13.42           O  \nATOM   1833  ND2 ASN B  98      41.447   0.520  47.713  1.00  8.18           N  \nATOM   1834  N   LYS B  99      39.896   4.064  51.689  1.00 10.70           N  \nATOM   1835  CA  LYS B  99      39.202   4.453  52.914  1.00  9.28           C  \nATOM   1836  C   LYS B  99      38.101   5.505  52.754  1.00 10.44           C  \nATOM   1837  O   LYS B  99      37.004   5.350  53.298  1.00  9.09           O  \nATOM   1838  CB  LYS B  99      40.223   4.933  53.946  1.00 14.04           C  \nATOM   1839  CG  LYS B  99      39.622   5.373  55.271  1.00 15.01           C  \nATOM   1840  CD  LYS B  99      40.712   5.559  56.327  1.00 19.90           C  \nATOM   1841  CE  LYS B  99      41.761   6.564  55.878  1.00 26.11           C  \nATOM   1842  NZ  LYS B  99      42.944   6.571  56.785  1.00 26.96           N  \nATOM   1843  N   VAL B 100      38.390   6.580  52.030  1.00  9.93           N  \nATOM   1844  CA  VAL B 100      37.398   7.632  51.838  1.00  7.71           C  \nATOM   1845  C   VAL B 100      36.164   7.083  51.128  1.00  6.80           C  \nATOM   1846  O   VAL B 100      35.033   7.363  51.524  1.00  8.22           O  \nATOM   1847  CB  VAL B 100      37.983   8.805  51.019  1.00  9.27           C  \nATOM   1848  CG1 VAL B 100      36.916   9.865  50.786  1.00 11.14           C  \nATOM   1849  CG2 VAL B 100      39.168   9.414  51.769  1.00 15.69           C  \nATOM   1850  N   PHE B 101      36.398   6.280  50.097  1.00  7.70           N  \nATOM   1851  CA  PHE B 101      35.322   5.675  49.312  1.00  8.14           C  \nATOM   1852  C   PHE B 101      34.479   4.742  50.180  1.00  8.71           C  \nATOM   1853  O   PHE B 101      33.250   4.853  50.224  1.00  7.41           O  \nATOM   1854  CB  PHE B 101      35.927   4.907  48.130  1.00  5.31           C  \nATOM   1855  CG  PHE B 101      34.907   4.246  47.230  1.00  7.28           C  \nATOM   1856  CD1 PHE B 101      33.906   4.989  46.616  1.00  8.36           C  \nATOM   1857  CD2 PHE B 101      34.976   2.880  46.976  1.00  8.23           C  \nATOM   1858  CE1 PHE B 101      32.985   4.381  45.754  1.00 12.37           C  \nATOM   1859  CE2 PHE B 101      34.066   2.261  46.120  1.00  9.85           C  \nATOM   1860  CZ  PHE B 101      33.068   3.012  45.506  1.00 11.79           C  \nHETATM 1861  N   MSE B 102      35.133   3.819  50.878  1.00  8.34           N  \nHETATM 1862  CA  MSE B 102      34.399   2.889  51.728  1.00  7.79           C  \nHETATM 1863  C   MSE B 102      33.624   3.614  52.821  1.00  8.44           C  \nHETATM 1864  O   MSE B 102      32.502   3.230  53.152  1.00  7.89           O  \nHETATM 1865  CB  MSE B 102      35.342   1.866  52.363  1.00  7.74           C  \nHETATM 1866  CG  MSE B 102      34.653   0.952  53.367  1.00  7.13           C  \nHETATM 1867 SE   MSE B 102      33.179  -0.057  52.589  1.00 21.70          SE  \nHETATM 1868  CE  MSE B 102      34.237  -1.244  51.580  1.00  3.62           C  \nATOM   1869  N   SER B 103      34.214   4.667  53.379  1.00 10.25           N  \nATOM   1870  CA  SER B 103      33.543   5.428  54.423  1.00  9.15           C  \nATOM   1871  C   SER B 103      32.213   5.987  53.913  1.00  9.43           C  \nATOM   1872  O   SER B 103      31.223   6.000  54.643  1.00  8.98           O  \nATOM   1873  CB  SER B 103      34.438   6.569  54.911  1.00 12.94           C  \nATOM   1874  OG  SER B 103      35.597   6.055  55.542  1.00 22.39           O  \nATOM   1875  N   LYS B 104      32.194   6.449  52.664  1.00  9.19           N  \nATOM   1876  CA  LYS B 104      30.970   6.986  52.078  1.00  8.57           C  \nATOM   1877  C   LYS B 104      29.930   5.884  51.887  1.00  8.03           C  \nATOM   1878  O   LYS B 104      28.731   6.110  52.064  1.00  8.00           O  \nATOM   1879  CB  LYS B 104      31.268   7.676  50.740  1.00  8.00           C  \nATOM   1880  CG  LYS B 104      31.871   9.067  50.906  1.00  9.99           C  \nATOM   1881  CD  LYS B 104      32.200   9.726  49.569  1.00  7.11           C  \nATOM   1882  CE  LYS B 104      33.320   8.997  48.840  1.00  6.13           C  \nATOM   1883  NZ  LYS B 104      33.713   9.685  47.577  1.00  5.13           N  \nATOM   1884  N   ILE B 105      30.384   4.688  51.531  1.00  6.44           N  \nATOM   1885  CA  ILE B 105      29.462   3.573  51.353  1.00  6.44           C  \nATOM   1886  C   ILE B 105      28.830   3.272  52.708  1.00  6.86           C  \nATOM   1887  O   ILE B 105      27.612   3.161  52.822  1.00  6.84           O  \nATOM   1888  CB  ILE B 105      30.192   2.306  50.833  1.00  7.27           C  \nATOM   1889  CG1 ILE B 105      30.792   2.582  49.447  1.00  6.29           C  \nATOM   1890  CG2 ILE B 105      29.221   1.133  50.772  1.00  8.00           C  \nATOM   1891  CD1 ILE B 105      31.576   1.404  48.858  1.00  7.28           C  \nATOM   1892  N   VAL B 106      29.661   3.163  53.743  1.00  7.24           N  \nATOM   1893  CA  VAL B 106      29.164   2.872  55.084  1.00  9.20           C  \nATOM   1894  C   VAL B 106      28.161   3.927  55.551  1.00  7.38           C  \nATOM   1895  O   VAL B 106      27.119   3.595  56.122  1.00  8.51           O  \nATOM   1896  CB  VAL B 106      30.323   2.788  56.108  1.00  7.67           C  \nATOM   1897  CG1 VAL B 106      29.766   2.577  57.510  1.00 11.73           C  \nATOM   1898  CG2 VAL B 106      31.254   1.633  55.740  1.00 12.47           C  \nATOM   1899  N   ASP B 107      28.473   5.195  55.298  1.00  7.77           N  \nATOM   1900  CA  ASP B 107      27.600   6.297  55.700  1.00  9.68           C  \nATOM   1901  C   ASP B 107      26.195   6.181  55.132  1.00  9.43           C  \nATOM   1902  O   ASP B 107      25.243   6.702  55.715  1.00 10.12           O  \nATOM   1903  CB  ASP B 107      28.160   7.649  55.246  1.00 11.43           C  \nATOM   1904  CG  ASP B 107      29.454   8.021  55.935  1.00 14.81           C  \nATOM   1905  OD1 ASP B 107      29.679   7.575  57.079  1.00 13.62           O  \nATOM   1906  OD2 ASP B 107      30.238   8.783  55.327  1.00 15.91           O  \nATOM   1907  N   ASN B 108      26.071   5.508  53.992  1.00  6.57           N  \nATOM   1908  CA  ASN B 108      24.786   5.373  53.330  1.00  6.46           C  \nATOM   1909  C   ASN B 108      24.078   4.036  53.473  1.00  7.81           C  \nATOM   1910  O   ASN B 108      23.088   3.775  52.787  1.00  6.91           O  \nATOM   1911  CB  ASN B 108      24.944   5.724  51.854  1.00  5.98           C  \nATOM   1912  CG  ASN B 108      25.294   7.180  51.656  1.00 11.56           C  \nATOM   1913  OD1 ASN B 108      26.455   7.536  51.435  1.00 13.06           O  \nATOM   1914  ND2 ASN B 108      24.288   8.038  51.762  1.00  7.03           N  \nATOM   1915  N   LEU B 109      24.574   3.193  54.367  1.00  8.14           N  \nATOM   1916  CA  LEU B 109      23.942   1.902  54.592  1.00  9.38           C  \nATOM   1917  C   LEU B 109      22.630   2.122  55.329  1.00  9.65           C  \nATOM   1918  O   LEU B 109      22.479   3.106  56.056  1.00 11.76           O  \nATOM   1919  CB  LEU B 109      24.843   1.007  55.443  1.00  7.90           C  \nATOM   1920  CG  LEU B 109      26.133   0.519  54.786  1.00  9.37           C  \nATOM   1921  CD1 LEU B 109      27.005  -0.174  55.820  1.00 11.40           C  \nATOM   1922  CD2 LEU B 109      25.797  -0.421  53.642  1.00  9.65           C  \nATOM   1923  N   PRO B 110      21.658   1.219  55.136  1.00  9.50           N  \nATOM   1924  CA  PRO B 110      20.372   1.357  55.826  1.00 11.16           C  \nATOM   1925  C   PRO B 110      20.658   1.400  57.325  1.00 11.60           C  \nATOM   1926  O   PRO B 110      21.537   0.692  57.816  1.00 11.71           O  \nATOM   1927  CB  PRO B 110      19.628   0.090  55.417  1.00  9.96           C  \nATOM   1928  CG  PRO B 110      20.142  -0.164  54.034  1.00 14.79           C  \nATOM   1929  CD  PRO B 110      21.629   0.087  54.192  1.00 12.17           C  \nATOM   1930  N   THR B 111      19.915   2.230  58.045  1.00 10.64           N  \nATOM   1931  CA  THR B 111      20.094   2.385  59.485  1.00 11.86           C  \nATOM   1932  C   THR B 111      20.244   1.077  60.269  1.00 12.74           C  \nATOM   1933  O   THR B 111      21.185   0.923  61.051  1.00 15.22           O  \nATOM   1934  CB  THR B 111      18.921   3.195  60.078  1.00 14.73           C  \nATOM   1935  OG1 THR B 111      18.902   4.497  59.480  1.00 19.58           O  \nATOM   1936  CG2 THR B 111      19.062   3.336  61.581  1.00 15.13           C  \nATOM   1937  N   ALA B 112      19.323   0.142  60.053  1.00 12.23           N  \nATOM   1938  CA  ALA B 112      19.331  -1.141  60.754  1.00 11.14           C  \nATOM   1939  C   ALA B 112      20.574  -1.979  60.483  1.00 12.34           C  \nATOM   1940  O   ALA B 112      21.040  -2.715  61.355  1.00 13.84           O  \nATOM   1941  CB  ALA B 112      18.080  -1.932  60.391  1.00 12.37           C  \nATOM   1942  N   ILE B 113      21.111  -1.869  59.274  1.00  9.34           N  \nATOM   1943  CA  ILE B 113      22.304  -2.621  58.913  1.00  9.05           C  \nATOM   1944  C   ILE B 113      23.555  -1.956  59.482  1.00  7.74           C  \nATOM   1945  O   ILE B 113      24.417  -2.625  60.057  1.00 11.19           O  \nATOM   1946  CB  ILE B 113      22.432  -2.740  57.378  1.00 10.56           C  \nATOM   1947  CG1 ILE B 113      21.304  -3.629  56.844  1.00 10.65           C  \nATOM   1948  CG2 ILE B 113      23.796  -3.307  57.002  1.00 13.59           C  \nATOM   1949  CD1 ILE B 113      21.297  -3.801  55.332  1.00 15.03           C  \nATOM   1950  N   LYS B 114      23.645  -0.639  59.327  1.00 10.63           N  \nATOM   1951  CA  LYS B 114      24.794   0.124  59.815  1.00 11.86           C  \nATOM   1952  C   LYS B 114      24.963  -0.081  61.318  1.00 11.42           C  \nATOM   1953  O   LYS B 114      26.074  -0.212  61.827  1.00 11.28           O  \nATOM   1954  CB  LYS B 114      24.588   1.614  59.527  1.00 14.01           C  \nATOM   1955  CG  LYS B 114      25.802   2.487  59.815  1.00 17.21           C  \nATOM   1956  CD  LYS B 114      25.454   3.972  59.759  1.00 21.95           C  \nATOM   1957  CE  LYS B 114      24.861   4.377  58.417  1.00 22.79           C  \nATOM   1958  NZ  LYS B 114      24.536   5.835  58.380  1.00 25.75           N  \nATOM   1959  N   ARG B 115      23.831  -0.098  62.012  1.00 11.17           N  \nATOM   1960  CA  ARG B 115      23.769  -0.271  63.455  1.00 12.50           C  \nATOM   1961  C   ARG B 115      24.406  -1.587  63.920  1.00 13.03           C  \nATOM   1962  O   ARG B 115      24.989  -1.654  65.005  1.00 12.52           O  \nATOM   1963  CB  ARG B 115      22.293  -0.205  63.865  1.00 17.05           C  \nATOM   1964  CG  ARG B 115      21.964  -0.530  65.299  1.00 24.23           C  \nATOM   1965  CD  ARG B 115      20.478  -0.855  65.396  1.00 17.93           C  \nATOM   1966  NE  ARG B 115      19.625   0.260  64.986  1.00 17.89           N  \nATOM   1967  CZ  ARG B 115      18.384   0.122  64.528  1.00 15.78           C  \nATOM   1968  NH1 ARG B 115      17.848  -1.084  64.406  1.00 18.02           N  \nATOM   1969  NH2 ARG B 115      17.665   1.191  64.219  1.00 16.37           N  \nATOM   1970  N   ASN B 116      24.299  -2.623  63.091  1.00 11.67           N  \nATOM   1971  CA  ASN B 116      24.841  -3.943  63.414  1.00 11.83           C  \nATOM   1972  C   ASN B 116      26.324  -4.121  63.093  1.00 10.94           C  \nATOM   1973  O   ASN B 116      26.787  -5.246  62.882  1.00  8.87           O  \nATOM   1974  CB  ASN B 116      24.043  -5.033  62.688  1.00 16.10           C  \nATOM   1975  CG  ASN B 116      22.639  -5.197  63.240  1.00 25.97           C  \nATOM   1976  OD1 ASN B 116      22.443  -5.273  64.453  1.00 29.95           O  \nATOM   1977  ND2 ASN B 116      21.656  -5.268  62.348  1.00 29.56           N  \nATOM   1978  N   LEU B 117      27.063  -3.018  63.057  1.00 11.88           N  \nATOM   1979  CA  LEU B 117      28.491  -3.063  62.772  1.00 12.36           C  \nATOM   1980  C   LEU B 117      29.195  -3.846  63.874  1.00 14.22           C  \nATOM   1981  O   LEU B 117      29.126  -3.479  65.049  1.00 15.46           O  \nATOM   1982  CB  LEU B 117      29.061  -1.640  62.696  1.00 14.10           C  \nATOM   1983  CG  LEU B 117      30.572  -1.486  62.471  1.00 14.06           C  \nATOM   1984  CD1 LEU B 117      30.963  -2.022  61.099  1.00 11.30           C  \nATOM   1985  CD2 LEU B 117      30.951  -0.014  62.586  1.00 15.66           C  \nATOM   1986  N   ILE B 118      29.860  -4.931  63.487  1.00 11.99           N  \nATOM   1987  CA  ILE B 118      30.584  -5.786  64.424  1.00 14.24           C  \nATOM   1988  C   ILE B 118      32.050  -5.387  64.479  1.00 14.47           C  \nATOM   1989  O   ILE B 118      32.655  -5.317  65.551  1.00 15.41           O  \nATOM   1990  CB  ILE B 118      30.537  -7.271  63.985  1.00 13.78           C  \nATOM   1991  CG1 ILE B 118      29.107  -7.801  64.047  1.00 17.05           C  \nATOM   1992  CG2 ILE B 118      31.464  -8.106  64.863  1.00 21.57           C  \nATOM   1993  CD1 ILE B 118      28.975  -9.211  63.506  1.00 13.64           C  \nATOM   1994  N   LYS B 119      32.617  -5.133  63.307  1.00 12.50           N  \nATOM   1995  CA  LYS B 119      34.020  -4.779  63.206  1.00 13.01           C  \nATOM   1996  C   LYS B 119      34.268  -3.873  62.013  1.00 13.28           C  \nATOM   1997  O   LYS B 119      33.690  -4.068  60.943  1.00 10.47           O  \nATOM   1998  CB  LYS B 119      34.845  -6.058  63.061  1.00 15.90           C  \nATOM   1999  CG  LYS B 119      36.341  -5.859  62.985  1.00 20.79           C  \nATOM   2000  CD  LYS B 119      37.027  -7.195  62.754  1.00 22.35           C  \nATOM   2001  CE  LYS B 119      38.522  -7.087  62.940  1.00 23.28           C  \nATOM   2002  NZ  LYS B 119      38.848  -6.704  64.340  1.00 21.74           N  \nATOM   2003  N   ASP B 120      35.123  -2.875  62.207  1.00 11.74           N  \nATOM   2004  CA  ASP B 120      35.468  -1.949  61.143  1.00 13.09           C  \nATOM   2005  C   ASP B 120      36.980  -1.826  61.068  1.00 15.64           C  \nATOM   2006  O   ASP B 120      37.588  -1.076  61.830  1.00 18.59           O  \nATOM   2007  CB  ASP B 120      34.859  -0.566  61.395  1.00 14.18           C  \nATOM   2008  CG  ASP B 120      35.133   0.406  60.255  1.00 21.36           C  \nATOM   2009  OD1 ASP B 120      36.318   0.667  59.958  1.00 18.80           O  \nATOM   2010  OD2 ASP B 120      34.162   0.905  59.651  1.00 24.72           O  \nATOM   2011  N   PHE B 121      37.586  -2.590  60.165  1.00 10.68           N  \nATOM   2012  CA  PHE B 121      39.028  -2.547  59.977  1.00  8.67           C  \nATOM   2013  C   PHE B 121      39.187  -1.661  58.755  1.00  9.80           C  \nATOM   2014  O   PHE B 121      39.505  -2.131  57.658  1.00 10.45           O  \nATOM   2015  CB  PHE B 121      39.567  -3.948  59.690  1.00 11.06           C  \nATOM   2016  CG  PHE B 121      41.064  -4.048  59.755  1.00  8.57           C  \nATOM   2017  CD1 PHE B 121      41.720  -4.053  60.981  1.00  7.88           C  \nATOM   2018  CD2 PHE B 121      41.819  -4.133  58.589  1.00 11.03           C  \nATOM   2019  CE1 PHE B 121      43.108  -4.144  61.049  1.00  9.29           C  \nATOM   2020  CE2 PHE B 121      43.210  -4.224  58.644  1.00 12.45           C  \nATOM   2021  CZ  PHE B 121      43.857  -4.230  59.876  1.00 11.76           C  \nATOM   2022  N   CYS B 122      38.954  -0.368  58.952  1.00  9.68           N  \nATOM   2023  CA  CYS B 122      39.012   0.558  57.842  1.00 11.76           C  \nATOM   2024  C   CYS B 122      39.164   2.035  58.195  1.00 12.00           C  \nATOM   2025  O   CYS B 122      40.214   2.631  57.964  1.00 11.46           O  \nATOM   2026  CB  CYS B 122      37.749   0.362  56.999  1.00 10.50           C  \nATOM   2027  SG  CYS B 122      37.515   1.575  55.670  1.00 12.06           S  \nATOM   2028  N   ARG B 123      38.109   2.618  58.753  1.00 13.81           N  \nATOM   2029  CA  ARG B 123      38.098   4.038  59.077  1.00 13.54           C  \nATOM   2030  C   ARG B 123      39.199   4.550  60.003  1.00 15.49           C  \nATOM   2031  O   ARG B 123      39.665   5.677  59.835  1.00 15.89           O  \nATOM   2032  CB  ARG B 123      36.724   4.424  59.631  1.00 17.36           C  \nATOM   2033  CG  ARG B 123      35.592   4.061  58.678  1.00 27.63           C  \nATOM   2034  CD  ARG B 123      34.225   4.502  59.180  1.00 35.34           C  \nATOM   2035  NE  ARG B 123      34.042   5.948  59.100  1.00 40.69           N  \nATOM   2036  CZ  ARG B 123      32.965   6.534  58.583  1.00 43.50           C  \nATOM   2037  NH1 ARG B 123      32.876   7.856  58.550  1.00 44.75           N  \nATOM   2038  NH2 ARG B 123      31.979   5.797  58.087  1.00 40.61           N  \nATOM   2039  N   LYS B 124      39.622   3.735  60.964  1.00 12.28           N  \nATOM   2040  CA  LYS B 124      40.664   4.165  61.897  1.00 10.38           C  \nATOM   2041  C   LYS B 124      42.094   3.826  61.471  1.00 11.81           C  \nATOM   2042  O   LYS B 124      43.044   4.116  62.200  1.00 10.66           O  \nATOM   2043  CB  LYS B 124      40.400   3.591  63.293  1.00 12.36           C  \nATOM   2044  CG  LYS B 124      39.249   4.256  64.030  1.00 15.36           C  \nATOM   2045  CD  LYS B 124      39.132   3.712  65.448  1.00 24.54           C  \nATOM   2046  CE  LYS B 124      38.082   4.458  66.251  1.00 31.08           C  \nATOM   2047  NZ  LYS B 124      38.118   4.064  67.691  1.00 36.16           N  \nATOM   2048  N   LEU B 125      42.251   3.215  60.301  1.00 10.78           N  \nATOM   2049  CA  LEU B 125      43.581   2.873  59.807  1.00  9.35           C  \nATOM   2050  C   LEU B 125      44.342   4.140  59.430  1.00 13.02           C  \nATOM   2051  O   LEU B 125      43.768   5.079  58.880  1.00 16.48           O  \nATOM   2052  CB  LEU B 125      43.482   1.964  58.579  1.00 12.38           C  \nATOM   2053  CG  LEU B 125      43.052   0.517  58.828  1.00  9.98           C  \nATOM   2054  CD1 LEU B 125      42.807  -0.166  57.488  1.00 15.34           C  \nATOM   2055  CD2 LEU B 125      44.125  -0.216  59.624  1.00 10.78           C  \nATOM   2056  N   SER B 126      45.634   4.162  59.737  1.00 10.00           N  \nATOM   2057  CA  SER B 126      46.478   5.305  59.416  1.00 14.06           C  \nATOM   2058  C   SER B 126      47.202   5.060  58.094  1.00 16.28           C  \nATOM   2059  O   SER B 126      47.689   6.043  57.498  1.00 15.23           O  \nATOM   2060  CB  SER B 126      47.498   5.546  60.535  1.00 15.40           C  \nATOM   2061  OG  SER B 126      48.333   4.419  60.724  1.00 18.55           O  \nTER    2062      SER B 126                                                      \nHETATM 2063  S   SO4 B 127      48.867 -16.604  52.271  1.00 25.56           S  \nHETATM 2064  O1  SO4 B 127      49.341 -16.224  50.947  1.00 28.92           O  \nHETATM 2065  O2  SO4 B 127      48.593 -18.036  52.303  1.00 28.08           O  \nHETATM 2066  O3  SO4 B 127      47.644 -15.882  52.588  1.00 25.89           O  \nHETATM 2067  O4  SO4 B 127      49.897 -16.287  53.254  1.00 29.35           O  \nHETATM 2068  O   HOH A 127      28.458   6.021  35.670  1.00 18.16           O  \nHETATM 2069  O   HOH A 128      15.890   4.410  18.138  1.00 20.16           O  \nHETATM 2070  O   HOH A 129      27.529   3.101  15.774  1.00 15.18           O  \nHETATM 2071  O   HOH A 130      32.450  11.412  36.797  1.00 19.18           O  \nHETATM 2072  O   HOH A 131       8.531   7.793  20.199  1.00 17.77           O  \nHETATM 2073  O   HOH A 132      14.364   5.265  15.973  1.00 14.05           O  \nHETATM 2074  O   HOH A 133      21.168 -10.826  39.672  1.00 40.57           O  \nHETATM 2075  O   HOH A 134      13.915  13.483  37.608  1.00 27.78           O  \nHETATM 2076  O   HOH A 135      26.790  -7.651  16.405  1.00 24.21           O  \nHETATM 2077  O   HOH A 136       6.144   2.232  31.847  1.00 13.55           O  \nHETATM 2078  O   HOH A 137      23.212   5.252  37.469  1.00 16.16           O  \nHETATM 2079  O   HOH A 138      32.876  14.054  31.321  1.00 14.52           O  \nHETATM 2080  O   HOH A 139      18.750  15.727  36.860  1.00 13.89           O  \nHETATM 2081  O   HOH A 140      20.509  13.974  37.699  1.00 18.12           O  \nHETATM 2082  O   HOH A 141      12.567  16.103  40.950  1.00 47.04           O  \nHETATM 2083  O   HOH A 142       9.021  -9.289  16.267  1.00 17.98           O  \nHETATM 2084  O   HOH A 143      17.666   0.546   9.599  1.00 17.59           O  \nHETATM 2085  O   HOH A 144      20.509  19.781  39.096  1.00 16.70           O  \nHETATM 2086  O   HOH A 145      29.542  14.893  29.222  1.00 19.74           O  \nHETATM 2087  O   HOH A 146      24.207   0.245   8.979  1.00 13.69           O  \nHETATM 2088  O   HOH A 147      19.424  -0.651   7.809  1.00 27.68           O  \nHETATM 2089  O   HOH A 148       9.795   2.207  30.687  1.00 15.45           O  \nHETATM 2090  O   HOH A 149      18.090   5.197  13.129  1.00 16.39           O  \nHETATM 2091  O   HOH A 150      10.390   8.107  40.116  1.00 22.43           O  \nHETATM 2092  O   HOH A 151       9.065  -6.856  18.209  1.00 15.48           O  \nHETATM 2093  O   HOH A 152       0.569   7.297  34.180  1.00 59.53           O  \nHETATM 2094  O   HOH A 153      15.795 -12.274  29.582  1.00 22.45           O  \nHETATM 2095  O   HOH A 154       0.364   8.593  28.085  1.00 32.19           O  \nHETATM 2096  O   HOH A 155      14.526  -6.119  13.878  1.00 17.77           O  \nHETATM 2097  O   HOH A 156      32.185  -6.589  38.208  1.00 18.38           O  \nHETATM 2098  O   HOH A 157       7.829   8.695  37.464  1.00 26.42           O  \nHETATM 2099  O   HOH A 158      34.392  10.333  26.308  1.00 36.60           O  \nHETATM 2100  O   HOH A 159      23.565  -8.918  42.385  1.00 17.23           O  \nHETATM 2101  O   HOH A 160      13.468  -2.601  41.021  1.00 31.02           O  \nHETATM 2102  O   HOH A 161      15.974 -11.974  39.259  1.00 46.44           O  \nHETATM 2103  O   HOH A 162      20.465  -3.746  15.557  1.00 19.08           O  \nHETATM 2104  O   HOH A 163      10.423  -8.380  32.230  1.00 20.38           O  \nHETATM 2105  O   HOH A 164      26.461  20.839  31.209  1.00 31.39           O  \nHETATM 2106  O   HOH A 165      29.295  -9.281  16.094  1.00 23.95           O  \nHETATM 2107  O   HOH A 166      26.125   5.967  38.272  1.00 11.91           O  \nHETATM 2108  O   HOH A 167      29.108   7.237  33.084  1.00 20.47           O  \nHETATM 2109  O   HOH A 168      34.636  11.173  33.949  1.00 30.19           O  \nHETATM 2110  O   HOH A 169       6.420  -3.918  15.489  1.00 25.60           O  \nHETATM 2111  O   HOH A 170      23.472  24.694  26.504  1.00 26.33           O  \nHETATM 2112  O   HOH A 171      34.478  14.634  27.057  1.00 37.21           O  \nHETATM 2113  O   HOH A 172      18.881   4.081  43.149  1.00 24.39           O  \nHETATM 2114  O   HOH A 173      28.866  14.402  22.340  1.00 18.69           O  \nHETATM 2115  O   HOH A 174       4.439   4.023  24.306  1.00 23.70           O  \nHETATM 2116  O   HOH A 175      31.755   2.603  33.263  1.00 16.38           O  \nHETATM 2117  O   HOH A 176      23.200  -4.358  36.680  1.00 31.65           O  \nHETATM 2118  O   HOH A 177      21.150  21.348  36.961  1.00 26.97           O  \nHETATM 2119  O   HOH A 178      11.925  20.572  30.823  1.00 22.88           O  \nHETATM 2120  O   HOH A 179      16.017 -13.071  21.195  1.00 25.75           O  \nHETATM 2121  O   HOH A 180      14.731  -0.038  41.120  1.00 26.44           O  \nHETATM 2122  O   HOH A 181      11.300  -9.182  34.868  1.00 21.65           O  \nHETATM 2123  O   HOH A 182      18.427   8.411  15.853  1.00 38.01           O  \nHETATM 2124  O   HOH A 183      14.795  -4.039  42.949  1.00 21.73           O  \nHETATM 2125  O   HOH A 184      21.308   0.911   6.430  1.00 32.59           O  \nHETATM 2126  O   HOH A 185       4.527   0.507  15.147  1.00 25.41           O  \nHETATM 2127  O   HOH A 186      29.661   0.827  20.631  1.00 25.66           O  \nHETATM 2128  O   HOH A 187      21.751  11.717  19.933  1.00 32.92           O  \nHETATM 2129  O   HOH A 188      21.736  -9.779  17.752  1.00 27.30           O  \nHETATM 2130  O   HOH A 189      11.316 -12.582  27.378  1.00 29.15           O  \nHETATM 2131  O   HOH A 190       9.669   5.484  18.610  1.00 26.69           O  \nHETATM 2132  O   HOH A 191      19.318   3.820  18.119  1.00 38.74           O  \nHETATM 2133  O   HOH A 192      18.070 -13.805  22.871  1.00 25.31           O  \nHETATM 2134  O   HOH A 193      22.731   8.761  14.625  1.00 41.11           O  \nHETATM 2135  O   HOH A 194       4.385   2.690  38.102  1.00 35.23           O  \nHETATM 2136  O   HOH A 195      23.645  19.112  17.947  1.00 46.35           O  \nHETATM 2137  O   HOH A 196      30.774   3.605  16.864  1.00 28.90           O  \nHETATM 2138  O   HOH A 197      19.222 -10.903  33.649  1.00 28.13           O  \nHETATM 2139  O   HOH A 198      17.347   9.215  41.145  1.00 22.51           O  \nHETATM 2140  O   HOH A 199      21.370   8.664  17.154  1.00 38.09           O  \nHETATM 2141  O   HOH A 200      18.365 -12.649  29.262  1.00 33.71           O  \nHETATM 2142  O   HOH A 201       2.634   2.625  18.276  1.00 42.51           O  \nHETATM 2143  O   HOH A 202      13.378  13.206  20.148  1.00 35.17           O  \nHETATM 2144  O   HOH A 203       8.441  -6.718  31.351  1.00 38.20           O  \nHETATM 2145  O   HOH A 204      21.225  -5.776  17.077  1.00 25.88           O  \nHETATM 2146  O   HOH A 205       9.449  -9.504  24.578  1.00 41.50           O  \nHETATM 2147  O   HOH A 206      33.653   8.582  34.021  1.00 37.11           O  \nHETATM 2148  O   HOH A 207      32.071  -2.237  29.668  1.00 38.24           O  \nHETATM 2149  O   HOH A 208      22.846  20.908  31.331  1.00 24.85           O  \nHETATM 2150  O   HOH A 209       9.709  16.523  36.392  1.00 34.23           O  \nHETATM 2151  O   HOH A 210      19.545  -8.901  47.793  1.00 19.93           O  \nHETATM 2152  O   HOH A 211       3.834   1.410  34.546  1.00 29.83           O  \nHETATM 2153  O   HOH A 212       9.928  10.065  19.432  1.00 23.37           O  \nHETATM 2154  O   HOH A 213      17.316   2.456  17.331  1.00 23.33           O  \nHETATM 2155  O   HOH A 214      18.932 -10.214  38.460  1.00 51.98           O  \nHETATM 2156  O   HOH A 215      12.017  14.522  36.271  1.00 20.10           O  \nHETATM 2157  O   HOH A 216      16.337   6.663  14.598  1.00 20.86           O  \nHETATM 2158  O   HOH A 217      11.392  -9.367  14.836  1.00 24.37           O  \nHETATM 2159  O   HOH A 218      24.178  -2.514   8.091  1.00 29.18           O  \nHETATM 2160  O   HOH A 219      19.046   7.405  11.509  1.00 24.46           O  \nHETATM 2161  O   HOH A 220      13.723  -7.995  15.643  1.00 19.27           O  \nHETATM 2162  O   HOH A 221      16.915  -6.210  12.855  1.00 34.03           O  \nHETATM 2163  O   HOH A 222      15.213 -12.334  36.436  1.00 43.21           O  \nHETATM 2164  O   HOH A 223      16.447 -11.679  34.274  1.00 31.98           O  \nHETATM 2165  O   HOH A 224      22.688  -2.690  14.501  1.00 17.55           O  \nHETATM 2166  O   HOH A 225       9.995 -10.442  28.308  1.00 27.23           O  \nHETATM 2167  O   HOH A 226      31.864   6.950  32.720  1.00 21.11           O  \nHETATM 2168  O   HOH A 227       4.229  -2.360  15.587  1.00 23.38           O  \nHETATM 2169  O   HOH A 228       4.505   0.687  30.549  1.00 23.25           O  \nHETATM 2170  O   HOH A 229       6.174   9.648  39.470  1.00 41.45           O  \nHETATM 2171  O   HOH A 230       4.610  12.718  39.742  1.00 35.21           O  \nHETATM 2172  O   HOH A 231      15.402  10.740  42.875  1.00 36.92           O  \nHETATM 2173  O   HOH A 232      16.260  14.730  38.071  1.00 25.76           O  \nHETATM 2174  O   HOH A 233      15.127  16.485  39.592  1.00 30.08           O  \nHETATM 2175  O   HOH A 234      28.618   7.242  38.403  1.00 15.53           O  \nHETATM 2176  O   HOH A 235      28.047  16.891  29.963  1.00 23.89           O  \nHETATM 2177  O   HOH A 236      27.988  19.477  29.092  1.00 28.80           O  \nHETATM 2178  O   HOH A 237      26.753  23.936  32.222  1.00 31.67           O  \nHETATM 2179  O   HOH A 238      28.048  21.800  33.174  1.00 21.45           O  \nHETATM 2180  O   HOH A 239      33.571  13.322  35.119  1.00 15.52           O  \nHETATM 2181  O   HOH A 240      32.541   8.637  36.660  1.00 36.94           O  \nHETATM 2182  O   HOH A 241      34.452  16.574  29.303  1.00 48.18           O  \nHETATM 2183  O   HOH A 242      18.024   5.361  19.430  1.00 47.32           O  \nHETATM 2184  O   HOH A 243      14.592  11.263  14.709  1.00 42.99           O  \nHETATM 2185  O   HOH A 244      14.557  12.387  17.278  1.00 40.04           O  \nHETATM 2186  O   HOH A 245       5.402  11.533  19.367  1.00 37.99           O  \nHETATM 2187  O   HOH A 246       1.547  10.483  34.966  1.00 50.86           O  \nHETATM 2188  O   HOH A 247       8.347  19.301  29.971  1.00 34.22           O  \nHETATM 2189  O   HOH A 248       4.474   5.156  21.778  1.00 35.03           O  \nHETATM 2190  O   HOH A 249       4.468  -6.497  29.200  1.00 55.94           O  \nHETATM 2191  O   HOH A 250      19.651  -5.640  13.417  1.00 36.65           O  \nHETATM 2192  O   HOH A 251      21.605  -7.187  12.499  1.00 40.70           O  \nHETATM 2193  O   HOH A 252      23.453  -4.868  12.762  1.00 29.49           O  \nHETATM 2194  O   HOH A 253      23.477   2.365   7.143  1.00 32.07           O  \nHETATM 2195  O   HOH A 254       9.360 -11.007  35.370  1.00 34.26           O  \nHETATM 2196  O   HOH A 255      13.398 -14.109  27.878  1.00 35.77           O  \nHETATM 2197  O   HOH A 256      21.048 -13.292  21.921  1.00 33.01           O  \nHETATM 2198  O   HOH A 257      33.756  -0.353  28.616  1.00 50.01           O  \nHETATM 2199  O   HOH A 258      23.567 -10.992  38.444  1.00 31.78           O  \nHETATM 2200  O   HOH A 259      17.284 -11.906  42.550  1.00 54.66           O  \nHETATM 2201  O   HOH A 260      30.748  19.823  29.133  1.00 25.39           O  \nHETATM 2202  O   HOH A 261      25.043  -8.497  14.937  1.00 41.33           O  \nHETATM 2203  O   HOH A 262      19.440   8.016  41.932  1.00 35.29           O  \nHETATM 2204  O   HOH A 263      29.159   5.342  11.721  1.00 43.86           O  \nHETATM 2205  O   HOH A 264      10.175  16.614  23.367  1.00 47.96           O  \nHETATM 2206  O   HOH A 265       8.888  19.630  27.509  1.00 45.65           O  \nHETATM 2207  O   HOH A 266      15.171   8.791  13.449  1.00 28.77           O  \nHETATM 2208  O   HOH A 267      17.008   9.159  11.329  1.00 40.73           O  \nHETATM 2209  O   HOH A 268      20.272 -10.986  36.161  1.00 41.24           O  \nHETATM 2210  O   HOH A 269      21.708 -11.083  42.464  1.00 33.85           O  \nHETATM 2211  O   HOH A 270      34.883  19.761  29.704  1.00 42.92           O  \nHETATM 2212  O   HOH A 271      33.870  21.990  30.733  1.00 43.19           O  \nHETATM 2213  O   HOH A 272      10.579 -15.293  33.494  1.00 39.64           O  \nHETATM 2214  O   HOH A 273       9.508 -13.518  35.159  1.00 38.76           O  \nHETATM 2215  O   HOH A 274      12.930 -11.463  37.352  1.00 43.18           O  \nHETATM 2216  O   HOH A 275      16.007 -13.401  32.247  1.00 39.13           O  \nHETATM 2217  O   HOH A 276       9.398 -14.257  28.668  1.00 33.79           O  \nHETATM 2218  O   HOH A 277       1.835  11.932  23.571  1.00 30.16           O  \nHETATM 2219  O   HOH A 278       9.119 -10.573  30.966  1.00 37.25           O  \nHETATM 2220  O   HOH A 279       7.930  -9.110  27.143  1.00 42.11           O  \nHETATM 2221  O   HOH A 280      26.814  17.987  16.451  1.00 51.41           O  \nHETATM 2222  O   HOH A 281       9.758   9.876  16.768  1.00 40.33           O  \nHETATM 2223  O   HOH A 282       7.752  12.854  19.320  1.00 35.83           O  \nHETATM 2224  O   HOH A 283       6.752  15.361  19.555  1.00 39.15           O  \nHETATM 2225  O   HOH A 284      12.304  -3.776  44.474  1.00 42.18           O  \nHETATM 2226  O   HOH B 128      21.749   7.845  52.818  1.00 14.25           O  \nHETATM 2227  O   HOH B 129      35.392 -13.107  35.614  1.00 25.17           O  \nHETATM 2228  O   HOH B 130      35.727   8.326  46.410  1.00 12.99           O  \nHETATM 2229  O   HOH B 131      23.311  -8.504  45.288  1.00 12.61           O  \nHETATM 2230  O   HOH B 132      29.110 -18.789  46.047  1.00 23.45           O  \nHETATM 2231  O   HOH B 133      47.502   1.457  58.755  1.00 14.50           O  \nHETATM 2232  O   HOH B 134      27.493  10.307  51.644  1.00 12.27           O  \nHETATM 2233  O   HOH B 135      24.522  10.723  51.950  1.00 10.99           O  \nHETATM 2234  O   HOH B 136      39.003   6.377  48.604  1.00 14.10           O  \nHETATM 2235  O   HOH B 137      27.459  -7.921  41.927  1.00 18.41           O  \nHETATM 2236  O   HOH B 138      27.538   1.783  63.090  1.00 19.30           O  \nHETATM 2237  O   HOH B 139      24.761  -7.627  47.446  1.00 12.74           O  \nHETATM 2238  O   HOH B 140      39.216   4.896  46.269  1.00 19.66           O  \nHETATM 2239  O   HOH B 141      29.205  10.791  53.689  1.00 15.87           O  \nHETATM 2240  O   HOH B 142      19.940   2.678  45.179  1.00 13.59           O  \nHETATM 2241  O   HOH B 143      29.698 -20.740  49.396  1.00 16.97           O  \nHETATM 2242  O   HOH B 144      41.100   6.919  50.486  1.00 10.64           O  \nHETATM 2243  O   HOH B 145      20.931   5.078  51.843  1.00 29.27           O  \nHETATM 2244  O   HOH B 146      27.235  -1.233  35.422  1.00 19.56           O  \nHETATM 2245  O   HOH B 147      46.212   1.487  50.336  1.00 23.03           O  \nHETATM 2246  O   HOH B 148      22.198 -11.958  48.612  1.00 24.32           O  \nHETATM 2247  O   HOH B 149      29.694 -10.191  41.013  1.00 18.37           O  \nHETATM 2248  O   HOH B 150      33.598 -20.124  45.598  1.00 15.74           O  \nHETATM 2249  O   HOH B 151      36.668   7.905  57.359  1.00 28.27           O  \nHETATM 2250  O   HOH B 152      22.383   3.251  62.407  1.00 21.39           O  \nHETATM 2251  O   HOH B 153      30.112 -16.483  44.979  1.00 20.97           O  \nHETATM 2252  O   HOH B 154      34.356  -5.386  39.413  1.00 16.41           O  \nHETATM 2253  O   HOH B 155      15.656  -4.125  46.248  1.00 18.93           O  \nHETATM 2254  O   HOH B 156      16.874  -4.983  44.105  1.00 17.87           O  \nHETATM 2255  O   HOH B 157      33.806  -0.151  43.682  1.00 16.12           O  \nHETATM 2256  O   HOH B 158      15.326   3.157  46.586  1.00 41.28           O  \nHETATM 2257  O   HOH B 159      32.716   9.399  55.235  1.00 21.01           O  \nHETATM 2258  O   HOH B 160      34.643   9.442  53.256  1.00 16.07           O  \nHETATM 2259  O   HOH B 161      29.968  -0.287  35.588  1.00 19.95           O  \nHETATM 2260  O   HOH B 162      23.577   9.066  55.922  1.00 30.60           O  \nHETATM 2261  O   HOH B 163      29.571  -4.628  36.083  1.00 31.15           O  \nHETATM 2262  O   HOH B 164      28.896 -12.583  41.636  1.00 33.44           O  \nHETATM 2263  O   HOH B 165      46.622   0.764  53.966  1.00 19.11           O  \nHETATM 2264  O   HOH B 166      22.306   5.686  56.691  1.00 29.21           O  \nHETATM 2265  O   HOH B 167      36.992   7.644  39.802  1.00 35.51           O  \nHETATM 2266  O   HOH B 168      25.761  -3.624  36.491  1.00 38.29           O  \nHETATM 2267  O   HOH B 169      18.592   1.549  49.716  1.00 27.31           O  \nHETATM 2268  O   HOH B 170      42.868   7.188  46.987  1.00 35.86           O  \nHETATM 2269  O   HOH B 171      27.292 -14.274  43.160  1.00 37.43           O  \nHETATM 2270  O   HOH B 172      25.362 -15.750  45.104  1.00 30.52           O  \nHETATM 2271  O   HOH B 173      43.076   9.501  56.562  1.00 43.34           O  \nHETATM 2272  O   HOH B 174      32.204   2.950  60.662  1.00 32.82           O  \nHETATM 2273  O   HOH B 175      33.831   1.926  37.009  1.00 29.41           O  \nHETATM 2274  O   HOH B 176      47.425   8.687  58.230  1.00 35.83           O  \nHETATM 2275  O   HOH B 177      43.492   7.252  53.386  1.00 29.73           O  \nHETATM 2276  O   HOH B 178      32.958 -17.842  44.639  1.00 36.54           O  \nHETATM 2277  O   HOH B 179      23.971   6.496  39.400  1.00 31.56           O  \nHETATM 2278  O   HOH B 180      38.250   8.614  47.381  1.00 19.44           O  \nHETATM 2279  O   HOH B 181      21.536 -10.246  46.303  1.00 20.07           O  \nHETATM 2280  O   HOH B 182      30.890 -20.716  46.247  1.00 18.53           O  \nHETATM 2281  O   HOH B 183      26.565 -19.302  45.680  1.00 34.84           O  \nHETATM 2282  O   HOH B 184      46.915  -0.253  56.738  1.00 18.35           O  \nHETATM 2283  O   HOH B 185      45.975  -2.818  56.285  1.00 19.90           O  \nHETATM 2284  O   HOH B 186      25.009   3.263  63.422  1.00 16.72           O  \nHETATM 2285  O   HOH B 187      25.048  -8.829  50.066  1.00 15.00           O  \nHETATM 2286  O   HOH B 188      17.988   2.155  47.022  1.00 26.39           O  \nHETATM 2287  O   HOH B 189      20.881   4.644  46.848  1.00 14.77           O  \nHETATM 2288  O   HOH B 190      23.050   5.646  45.819  1.00 13.73           O  \nHETATM 2289  O   HOH B 191      19.937   4.058  49.511  1.00 15.75           O  \nHETATM 2290  O   HOH B 192      17.160   1.434  51.955  1.00 32.82           O  \nHETATM 2291  O   HOH B 193      48.590  -1.720  48.336  1.00 27.63           O  \nHETATM 2292  O   HOH B 194      47.845  -3.678  44.065  1.00 28.54           O  \nHETATM 2293  O   HOH B 195      44.564  -2.291  42.836  1.00 25.85           O  \nHETATM 2294  O   HOH B 196      40.878  -3.749  43.732  1.00 11.38           O  \nHETATM 2295  O   HOH B 197      38.402  -3.964  46.400  1.00 14.57           O  \nHETATM 2296  O   HOH B 198      18.847  -6.953  56.593  1.00 25.01           O  \nHETATM 2297  O   HOH B 199      17.606  -2.703  54.515  1.00 27.07           O  \nHETATM 2298  O   HOH B 200      35.941 -22.085  49.046  1.00  8.69           O  \nHETATM 2299  O   HOH B 201      36.529   9.884  55.225  1.00 34.94           O  \nHETATM 2300  O   HOH B 202      21.808   7.078  43.858  1.00 15.74           O  \nHETATM 2301  O   HOH B 203      33.310 -10.259  36.870  1.00 28.74           O  \nHETATM 2302  O   HOH B 204      24.861 -18.928  59.731  1.00 19.32           O  \nHETATM 2303  O   HOH B 205      32.609   0.477  35.005  1.00 33.68           O  \nHETATM 2304  O   HOH B 206      25.908  -5.820  34.938  1.00 32.89           O  \nHETATM 2305  O   HOH B 207      25.406  -5.983  66.383  1.00 18.21           O  \nHETATM 2306  O   HOH B 208      22.532 -12.430  65.714  1.00 21.91           O  \nHETATM 2307  O   HOH B 209      36.385   0.150  42.555  1.00 21.29           O  \nHETATM 2308  O   HOH B 210      40.011  -1.866  41.602  1.00 16.46           O  \nHETATM 2309  O   HOH B 211      45.990 -10.409  46.937  1.00 15.14           O  \nHETATM 2310  O   HOH B 212      47.299 -12.855  46.122  1.00 37.65           O  \nHETATM 2311  O   HOH B 213      47.300 -10.021  50.070  1.00 11.57           O  \nHETATM 2312  O   HOH B 214      49.415 -11.742  49.384  1.00 25.56           O  \nHETATM 2313  O   HOH B 215      50.432  -8.592  48.180  1.00 34.76           O  \nHETATM 2314  O   HOH B 216      45.950 -17.117  47.140  1.00 11.91           O  \nHETATM 2315  O   HOH B 217      48.209 -16.855  48.400  1.00 20.67           O  \nHETATM 2316  O   HOH B 218      49.622 -19.497  48.902  1.00 36.91           O  \nHETATM 2317  O   HOH B 219      41.472 -19.513  42.460  1.00 22.18           O  \nHETATM 2318  O   HOH B 220      41.314 -19.608  39.815  1.00 29.27           O  \nHETATM 2319  O   HOH B 221      39.856 -17.844  38.429  1.00 27.86           O  \nHETATM 2320  O   HOH B 222      42.340 -15.231  36.539  1.00 36.18           O  \nHETATM 2321  O   HOH B 223      44.862 -13.117  36.832  1.00 31.70           O  \nHETATM 2322  O   HOH B 224      40.127  -8.641  36.131  1.00 26.48           O  \nHETATM 2323  O   HOH B 225      51.919 -10.132  49.666  1.00 40.48           O  \nHETATM 2324  O   HOH B 226      45.494 -11.393  57.214  1.00 17.13           O  \nHETATM 2325  O   HOH B 227      40.907 -17.643  56.706  1.00 12.60           O  \nHETATM 2326  O   HOH B 228      43.628 -18.106  57.649  1.00 17.39           O  \nHETATM 2327  O   HOH B 229      44.061 -22.668  57.601  1.00 21.34           O  \nHETATM 2328  O   HOH B 230      40.771 -24.364  57.020  1.00 20.20           O  \nHETATM 2329  O   HOH B 231      45.333 -24.598  53.420  1.00 28.40           O  \nHETATM 2330  O   HOH B 232      46.233 -26.590  51.909  1.00 21.65           O  \nHETATM 2331  O   HOH B 233      47.659 -24.550  50.161  1.00 20.60           O  \nHETATM 2332  O   HOH B 234      49.724 -20.577  51.545  1.00 34.06           O  \nHETATM 2333  O   HOH B 235      40.623 -10.464  63.091  1.00 15.64           O  \nHETATM 2334  O   HOH B 236      33.734 -11.034  64.366  1.00 21.79           O  \nHETATM 2335  O   HOH B 237      26.492 -22.373  55.525  1.00 23.99           O  \nHETATM 2336  O   HOH B 238      25.286 -19.773  52.394  1.00 35.79           O  \nHETATM 2337  O   HOH B 239      25.742 -17.045  51.744  1.00 29.50           O  \nHETATM 2338  O   HOH B 240      20.699 -11.436  52.346  1.00 31.96           O  \nHETATM 2339  O   HOH B 241      17.839 -12.847  51.084  1.00 53.96           O  \nHETATM 2340  O   HOH B 242      17.325 -14.512  53.143  1.00 48.01           O  \nHETATM 2341  O   HOH B 243      35.255 -19.515  41.312  1.00 31.47           O  \nHETATM 2342  O   HOH B 244      33.856 -21.721  40.045  1.00 48.42           O  \nHETATM 2343  O   HOH B 245      39.732 -21.420  43.520  1.00 21.00           O  \nHETATM 2344  O   HOH B 246      46.284 -18.521  42.584  1.00 31.72           O  \nHETATM 2345  O   HOH B 247      48.066 -14.706  42.752  1.00 40.32           O  \nHETATM 2346  O   HOH B 248      26.797 -21.029  50.222  1.00 33.09           O  \nHETATM 2347  O   HOH B 249      25.231 -19.819  48.034  1.00 34.56           O  \nHETATM 2348  O   HOH B 250      26.390 -12.057  40.877  1.00 38.86           O  \nHETATM 2349  O   HOH B 251      18.719  -5.241  58.774  1.00 33.80           O  \nHETATM 2350  O   HOH B 252      28.694  -8.590  68.622  1.00 44.04           O  \nHETATM 2351  O   HOH B 253      46.080   7.186  51.268  1.00 44.97           O  \nHETATM 2352  O   HOH B 254      28.373   6.487  59.114  1.00 33.05           O  \nHETATM 2353  O   HOH B 255      27.450  11.405  55.672  1.00 31.86           O  \nHETATM 2354  O   HOH B 256      16.075  -0.438  53.582  1.00 38.00           O  \nHETATM 2355  O   HOH B 257      19.558  -3.430  63.621  1.00 18.86           O  \nHETATM 2356  O   HOH B 258      25.992   0.299  66.754  1.00 27.95           O  \nHETATM 2357  O   HOH B 259      28.314   0.884  65.617  1.00 32.35           O  \nHETATM 2358  O   HOH B 260      38.082   1.529  62.092  1.00 20.93           O  \nHETATM 2359  O   HOH B 261      43.837   6.147  64.045  1.00 24.66           O  \nHETATM 2360  O   HOH B 262      41.759   6.912  65.427  1.00 32.58           O  \nHETATM 2361  O   HOH B 263      36.427   5.947  43.277  1.00 54.89           O  \nHETATM 2362  O   HOH B 264      28.281   6.171  42.732  1.00 30.95           O  \nHETATM 2363  O   HOH B 265      28.532   3.758  42.855  1.00 31.26           O  \nHETATM 2364  O   HOH B 266      26.279   4.488  42.304  1.00 18.18           O  \nHETATM 2365  O   HOH B 267      38.450 -25.374  53.625  1.00 11.50           O  \nHETATM 2366  O   HOH B 268      33.268 -11.967  34.839  1.00 44.52           O  \nHETATM 2367  O   HOH B 269      21.291   7.640  55.382  1.00 37.07           O  \nHETATM 2368  O   HOH B 270      40.543  -6.191  35.086  1.00 46.78           O  \nHETATM 2369  O   HOH B 271      36.278   8.494  43.716  1.00 39.94           O  \nHETATM 2370  O   HOH B 272      38.077   0.885  44.425  1.00 37.70           O  \nHETATM 2371  O   HOH B 273      36.624   2.995  44.072  1.00 44.84           O  \nHETATM 2372  O   HOH B 274      47.680  -3.802  54.241  1.00 29.52           O  \nHETATM 2373  O   HOH B 275      47.542 -25.183  47.426  1.00 44.28           O  \nHETATM 2374  O   HOH B 276      47.958  -0.641  51.434  1.00 41.18           O  \nHETATM 2375  O   HOH B 277      48.773  -1.142  45.731  1.00 47.19           O  \nHETATM 2376  O   HOH B 278      52.432  -3.449  47.286  1.00 34.07           O  \nHETATM 2377  O   HOH B 279      22.927 -20.727  46.764  1.00 43.74           O  \nHETATM 2378  O   HOH B 280      19.895 -12.192  66.540  1.00 37.79           O  \nHETATM 2379  O   HOH B 281      41.198  10.198  58.267  1.00 48.98           O  \nHETATM 2380  O   HOH B 282      44.205  11.703  55.646  1.00 52.92           O  \nHETATM 2381  O   HOH B 283      42.359   7.497  60.196  1.00 46.88           O  \nHETATM 2382  O   HOH B 284      43.862 -18.935  38.363  1.00 32.12           O  \nHETATM 2383  O   HOH B 285      44.692 -12.023  39.188  1.00 33.96           O  \nCONECT  769  996                                                                \nCONECT  821  830                                                                \nCONECT  830  821  831                                                           \nCONECT  831  830  832  834                                                      \nCONECT  832  831  833  838                                                      \nCONECT  833  832                                                                \nCONECT  834  831  835                                                           \nCONECT  835  834  836                                                           \nCONECT  836  835  837                                                           \nCONECT  837  836                                                                \nCONECT  838  832                                                                \nCONECT  996  769                                                                \nCONECT 1800 2027                                                                \nCONECT 1852 1861                                                                \nCONECT 1861 1852 1862                                                           \nCONECT 1862 1861 1863 1865                                                      \nCONECT 1863 1862 1864 1869                                                      \nCONECT 1864 1863                                                                \nCONECT 1865 1862 1866                                                           \nCONECT 1866 1865 1867                                                           \nCONECT 1867 1866 1868                                                           \nCONECT 1868 1867                                                                \nCONECT 1869 1863                                                                \nCONECT 2027 1800                                                                \nCONECT 2063 2064 2065 2066 2067                                                 \nCONECT 2064 2063                                                                \nCONECT 2065 2063                                                                \nCONECT 2066 2063                                                                \nCONECT 2067 2063                                                                \nMASTER      266    0    3   17   10    0    2    6 2381    2   29   20          \nEND                                                                             \n"
  },
  {
    "path": "alphafold/data/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Data pipeline for model features.\"\"\"\n"
  },
  {
    "path": "alphafold/data/feature_processing.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Feature processing logic for multimer data pipeline.\"\"\"\n\nfrom typing import Iterable, MutableMapping, List\n\nfrom alphafold.common import residue_constants\nfrom alphafold.data import msa_pairing\nfrom alphafold.data import pipeline\nimport numpy as np\n\nREQUIRED_FEATURES = frozenset({\n    'aatype', 'all_atom_mask', 'all_atom_positions', 'all_chains_entity_ids',\n    'all_crops_all_chains_mask', 'all_crops_all_chains_positions',\n    'all_crops_all_chains_residue_ids', 'assembly_num_chains', 'asym_id',\n    'bert_mask', 'cluster_bias_mask', 'deletion_matrix', 'deletion_mean',\n    'entity_id', 'entity_mask', 'mem_peak', 'msa', 'msa_mask', 'num_alignments',\n    'num_templates', 'queue_size', 'residue_index', 'resolution',\n    'seq_length', 'seq_mask', 'sym_id', 'template_aatype',\n    'template_all_atom_mask', 'template_all_atom_positions'\n})\n\nMAX_TEMPLATES = 4\nMSA_CROP_SIZE = 2048\n\n\ndef _is_homomer_or_monomer(chains: Iterable[pipeline.FeatureDict]) -> bool:\n  \"\"\"Checks if a list of chains represents a homomer/monomer example.\"\"\"\n  # Note that an entity_id of 0 indicates padding.\n  num_unique_chains = len(np.unique(np.concatenate(\n      [np.unique(chain['entity_id'][chain['entity_id'] > 0]) for\n       chain in chains])))\n  return num_unique_chains == 1\n\n\ndef pair_and_merge(\n    all_chain_features: MutableMapping[str, pipeline.FeatureDict]\n    ) -> pipeline.FeatureDict:\n  \"\"\"Runs processing on features to augment, pair and merge.\n\n  Args:\n    all_chain_features: A MutableMap of dictionaries of features for each chain.\n\n  Returns:\n    A dictionary of features.\n  \"\"\"\n\n  process_unmerged_features(all_chain_features)\n\n  np_chains_list = list(all_chain_features.values())\n\n  pair_msa_sequences = not _is_homomer_or_monomer(np_chains_list)\n\n  if pair_msa_sequences:\n    np_chains_list = msa_pairing.create_paired_features(\n        chains=np_chains_list)\n    np_chains_list = msa_pairing.deduplicate_unpaired_sequences(np_chains_list)\n  np_chains_list = crop_chains(\n      np_chains_list,\n      msa_crop_size=MSA_CROP_SIZE,\n      pair_msa_sequences=pair_msa_sequences,\n      max_templates=MAX_TEMPLATES)\n  np_example = msa_pairing.merge_chain_features(\n      np_chains_list=np_chains_list, pair_msa_sequences=pair_msa_sequences,\n      max_templates=MAX_TEMPLATES)\n  np_example = process_final(np_example)\n  return np_example\n\n\ndef crop_chains(\n    chains_list: List[pipeline.FeatureDict],\n    msa_crop_size: int,\n    pair_msa_sequences: bool,\n    max_templates: int) -> List[pipeline.FeatureDict]:\n  \"\"\"Crops the MSAs for a set of chains.\n\n  Args:\n    chains_list: A list of chains to be cropped.\n    msa_crop_size: The total number of sequences to crop from the MSA.\n    pair_msa_sequences: Whether we are operating in sequence-pairing mode.\n    max_templates: The maximum templates to use per chain.\n\n  Returns:\n    The chains cropped.\n  \"\"\"\n\n  # Apply the cropping.\n  cropped_chains = []\n  for chain in chains_list:\n    cropped_chain = _crop_single_chain(\n        chain,\n        msa_crop_size=msa_crop_size,\n        pair_msa_sequences=pair_msa_sequences,\n        max_templates=max_templates)\n    cropped_chains.append(cropped_chain)\n\n  return cropped_chains\n\n\ndef _crop_single_chain(chain: pipeline.FeatureDict,\n                       msa_crop_size: int,\n                       pair_msa_sequences: bool,\n                       max_templates: int) -> pipeline.FeatureDict:\n  \"\"\"Crops msa sequences to `msa_crop_size`.\"\"\"\n  msa_size = chain['num_alignments']\n\n  if pair_msa_sequences:\n    msa_size_all_seq = chain['num_alignments_all_seq']\n    msa_crop_size_all_seq = np.minimum(msa_size_all_seq, msa_crop_size // 2)\n\n    # We reduce the number of un-paired sequences, by the number of times a\n    # sequence from this chain's MSA is included in the paired MSA.  This keeps\n    # the MSA size for each chain roughly constant.\n    msa_all_seq = chain['msa_all_seq'][:msa_crop_size_all_seq, :]\n    num_non_gapped_pairs = np.sum(\n        np.any(msa_all_seq != msa_pairing.MSA_GAP_IDX, axis=1))\n    num_non_gapped_pairs = np.minimum(num_non_gapped_pairs,\n                                      msa_crop_size_all_seq)\n\n    # Restrict the unpaired crop size so that paired+unpaired sequences do not\n    # exceed msa_seqs_per_chain for each chain.\n    max_msa_crop_size = np.maximum(msa_crop_size - num_non_gapped_pairs, 0)\n    msa_crop_size = np.minimum(msa_size, max_msa_crop_size)\n  else:\n    msa_crop_size = np.minimum(msa_size, msa_crop_size)\n\n  include_templates = 'template_aatype' in chain and max_templates\n  if include_templates:\n    num_templates = chain['template_aatype'].shape[0]\n    templates_crop_size = np.minimum(num_templates, max_templates)\n\n  for k in chain:\n    k_split = k.split('_all_seq')[0]\n    if k_split in msa_pairing.TEMPLATE_FEATURES:\n      chain[k] = chain[k][:templates_crop_size, :]\n    elif k_split in msa_pairing.MSA_FEATURES:\n      if '_all_seq' in k and pair_msa_sequences:\n        chain[k] = chain[k][:msa_crop_size_all_seq, :]\n      else:\n        chain[k] = chain[k][:msa_crop_size, :]\n\n  chain['num_alignments'] = np.asarray(msa_crop_size, dtype=np.int32)\n  if include_templates:\n    chain['num_templates'] = np.asarray(templates_crop_size, dtype=np.int32)\n  if pair_msa_sequences:\n    chain['num_alignments_all_seq'] = np.asarray(\n        msa_crop_size_all_seq, dtype=np.int32)\n  return chain\n\n\ndef process_final(np_example: pipeline.FeatureDict) -> pipeline.FeatureDict:\n  \"\"\"Final processing steps in data pipeline, after merging and pairing.\"\"\"\n  np_example = _correct_msa_restypes(np_example)\n  np_example = _make_seq_mask(np_example)\n  np_example = _make_msa_mask(np_example)\n  np_example = _filter_features(np_example)\n  return np_example\n\n\ndef _correct_msa_restypes(np_example):\n  \"\"\"Correct MSA restype to have the same order as residue_constants.\"\"\"\n  new_order_list = residue_constants.MAP_HHBLITS_AATYPE_TO_OUR_AATYPE\n  np_example['msa'] = np.take(new_order_list, np_example['msa'], axis=0)\n  np_example['msa'] = np_example['msa'].astype(np.int32)\n  return np_example\n\n\ndef _make_seq_mask(np_example):\n  np_example['seq_mask'] = (np_example['entity_id'] > 0).astype(np.float32)\n  return np_example\n\n\ndef _make_msa_mask(np_example):\n  \"\"\"Mask features are all ones, but will later be zero-padded.\"\"\"\n\n  np_example['msa_mask'] = np.ones_like(np_example['msa'], dtype=np.float32)\n\n  seq_mask = (np_example['entity_id'] > 0).astype(np.float32)\n  np_example['msa_mask'] *= seq_mask[None]\n\n  return np_example\n\n\ndef _filter_features(np_example: pipeline.FeatureDict) -> pipeline.FeatureDict:\n  \"\"\"Filters features of example to only those requested.\"\"\"\n  return {k: v for (k, v) in np_example.items() if k in REQUIRED_FEATURES}\n\n\ndef process_unmerged_features(\n    all_chain_features: MutableMapping[str, pipeline.FeatureDict]):\n  \"\"\"Postprocessing stage for per-chain features before merging.\"\"\"\n  num_chains = len(all_chain_features)\n  for chain_features in all_chain_features.values():\n    # Convert deletion matrices to float.\n    chain_features['deletion_matrix'] = np.asarray(\n        chain_features.pop('deletion_matrix_int'), dtype=np.float32)\n    if 'deletion_matrix_int_all_seq' in chain_features:\n      chain_features['deletion_matrix_all_seq'] = np.asarray(\n          chain_features.pop('deletion_matrix_int_all_seq'), dtype=np.float32)\n\n    chain_features['deletion_mean'] = np.mean(\n        chain_features['deletion_matrix'], axis=0)\n\n    # Add all_atom_mask and dummy all_atom_positions based on aatype.\n    all_atom_mask = residue_constants.STANDARD_ATOM_MASK[\n        chain_features['aatype']]\n    chain_features['all_atom_mask'] = all_atom_mask\n    chain_features['all_atom_positions'] = np.zeros(\n        list(all_atom_mask.shape) + [3])\n\n    # Add assembly_num_chains.\n    chain_features['assembly_num_chains'] = np.asarray(num_chains)\n\n  # Add entity_mask.\n  for chain_features in all_chain_features.values():\n    chain_features['entity_mask'] = (\n        chain_features['entity_id'] != 0).astype(np.int32)\n"
  },
  {
    "path": "alphafold/data/mmcif_parsing.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Parses the mmCIF file format.\"\"\"\nimport collections\nimport dataclasses\nimport functools\nimport io\nfrom typing import Any, Mapping, Optional, Sequence, Tuple\n\nfrom absl import logging\nfrom Bio import PDB\nfrom Bio.Data import SCOPData\n\n# Type aliases:\nChainId = str\nPdbHeader = Mapping[str, Any]\nPdbStructure = PDB.Structure.Structure\nSeqRes = str\nMmCIFDict = Mapping[str, Sequence[str]]\n\n\n@dataclasses.dataclass(frozen=True)\nclass Monomer:\n  id: str\n  num: int\n\n\n# Note - mmCIF format provides no guarantees on the type of author-assigned\n# sequence numbers. They need not be integers.\n@dataclasses.dataclass(frozen=True)\nclass AtomSite:\n  residue_name: str\n  author_chain_id: str\n  mmcif_chain_id: str\n  author_seq_num: str\n  mmcif_seq_num: int\n  insertion_code: str\n  hetatm_atom: str\n  model_num: int\n\n\n# Used to map SEQRES index to a residue in the structure.\n@dataclasses.dataclass(frozen=True)\nclass ResiduePosition:\n  chain_id: str\n  residue_number: int\n  insertion_code: str\n\n\n@dataclasses.dataclass(frozen=True)\nclass ResidueAtPosition:\n  position: Optional[ResiduePosition]\n  name: str\n  is_missing: bool\n  hetflag: str\n\n\n@dataclasses.dataclass(frozen=True)\nclass MmcifObject:\n  \"\"\"Representation of a parsed mmCIF file.\n\n  Contains:\n    file_id: A meaningful name, e.g. a pdb_id. Should be unique amongst all\n      files being processed.\n    header: Biopython header.\n    structure: Biopython structure.\n    chain_to_seqres: Dict mapping chain_id to 1 letter amino acid sequence. E.g.\n      {'A': 'ABCDEFG'}\n    seqres_to_structure: Dict; for each chain_id contains a mapping between\n      SEQRES index and a ResidueAtPosition. e.g. {'A': {0: ResidueAtPosition,\n                                                        1: ResidueAtPosition,\n                                                        ...}}\n    raw_string: The raw string used to construct the MmcifObject.\n  \"\"\"\n  file_id: str\n  header: PdbHeader\n  structure: PdbStructure\n  chain_to_seqres: Mapping[ChainId, SeqRes]\n  seqres_to_structure: Mapping[ChainId, Mapping[int, ResidueAtPosition]]\n  raw_string: Any\n\n\n@dataclasses.dataclass(frozen=True)\nclass ParsingResult:\n  \"\"\"Returned by the parse function.\n\n  Contains:\n    mmcif_object: A MmcifObject, may be None if no chain could be successfully\n      parsed.\n    errors: A dict mapping (file_id, chain_id) to any exception generated.\n  \"\"\"\n  mmcif_object: Optional[MmcifObject]\n  errors: Mapping[Tuple[str, str], Any]\n\n\nclass ParseError(Exception):\n  \"\"\"An error indicating that an mmCIF file could not be parsed.\"\"\"\n\n\ndef mmcif_loop_to_list(prefix: str,\n                       parsed_info: MmCIFDict) -> Sequence[Mapping[str, str]]:\n  \"\"\"Extracts loop associated with a prefix from mmCIF data as a list.\n\n  Reference for loop_ in mmCIF:\n    http://mmcif.wwpdb.org/docs/tutorials/mechanics/pdbx-mmcif-syntax.html\n\n  Args:\n    prefix: Prefix shared by each of the data items in the loop.\n      e.g. '_entity_poly_seq.', where the data items are _entity_poly_seq.num,\n      _entity_poly_seq.mon_id. Should include the trailing period.\n    parsed_info: A dict of parsed mmCIF data, e.g. _mmcif_dict from a Biopython\n      parser.\n\n  Returns:\n    Returns a list of dicts; each dict represents 1 entry from an mmCIF loop.\n  \"\"\"\n  cols = []\n  data = []\n  for key, value in parsed_info.items():\n    if key.startswith(prefix):\n      cols.append(key)\n      data.append(value)\n\n  assert all([len(xs) == len(data[0]) for xs in data]), (\n      'mmCIF error: Not all loops are the same length: %s' % cols)\n\n  return [dict(zip(cols, xs)) for xs in zip(*data)]\n\n\ndef mmcif_loop_to_dict(prefix: str,\n                       index: str,\n                       parsed_info: MmCIFDict,\n                       ) -> Mapping[str, Mapping[str, str]]:\n  \"\"\"Extracts loop associated with a prefix from mmCIF data as a dictionary.\n\n  Args:\n    prefix: Prefix shared by each of the data items in the loop.\n      e.g. '_entity_poly_seq.', where the data items are _entity_poly_seq.num,\n      _entity_poly_seq.mon_id. Should include the trailing period.\n    index: Which item of loop data should serve as the key.\n    parsed_info: A dict of parsed mmCIF data, e.g. _mmcif_dict from a Biopython\n      parser.\n\n  Returns:\n    Returns a dict of dicts; each dict represents 1 entry from an mmCIF loop,\n    indexed by the index column.\n  \"\"\"\n  entries = mmcif_loop_to_list(prefix, parsed_info)\n  return {entry[index]: entry for entry in entries}\n\n\n@functools.lru_cache(16, typed=False)\ndef parse(*,\n          file_id: str,\n          mmcif_string: str,\n          catch_all_errors: bool = True) -> ParsingResult:\n  \"\"\"Entry point, parses an mmcif_string.\n\n  Args:\n    file_id: A string identifier for this file. Should be unique within the\n      collection of files being processed.\n    mmcif_string: Contents of an mmCIF file.\n    catch_all_errors: If True, all exceptions are caught and error messages are\n      returned as part of the ParsingResult. If False exceptions will be allowed\n      to propagate.\n\n  Returns:\n    A ParsingResult.\n  \"\"\"\n  errors = {}\n  try:\n    parser = PDB.MMCIFParser(QUIET=True)\n    handle = io.StringIO(mmcif_string)\n    full_structure = parser.get_structure('', handle)\n    first_model_structure = _get_first_model(full_structure)\n    # Extract the _mmcif_dict from the parser, which contains useful fields not\n    # reflected in the Biopython structure.\n    parsed_info = parser._mmcif_dict  # pylint:disable=protected-access\n\n    # Ensure all values are lists, even if singletons.\n    for key, value in parsed_info.items():\n      if not isinstance(value, list):\n        parsed_info[key] = [value]\n\n    header = _get_header(parsed_info)\n\n    # Determine the protein chains, and their start numbers according to the\n    # internal mmCIF numbering scheme (likely but not guaranteed to be 1).\n    valid_chains = _get_protein_chains(parsed_info=parsed_info)\n    if not valid_chains:\n      return ParsingResult(\n          None, {(file_id, ''): 'No protein chains found in this file.'})\n    seq_start_num = {chain_id: min([monomer.num for monomer in seq])\n                     for chain_id, seq in valid_chains.items()}\n\n    # Loop over the atoms for which we have coordinates. Populate two mappings:\n    # -mmcif_to_author_chain_id (maps internal mmCIF chain ids to chain ids used\n    # the authors / Biopython).\n    # -seq_to_structure_mappings (maps idx into sequence to ResidueAtPosition).\n    mmcif_to_author_chain_id = {}\n    seq_to_structure_mappings = {}\n    for atom in _get_atom_site_list(parsed_info):\n      if atom.model_num != '1':\n        # We only process the first model at the moment.\n        continue\n\n      mmcif_to_author_chain_id[atom.mmcif_chain_id] = atom.author_chain_id\n\n      if atom.mmcif_chain_id in valid_chains:\n        hetflag = ' '\n        if atom.hetatm_atom == 'HETATM':\n          # Water atoms are assigned a special hetflag of W in Biopython. We\n          # need to do the same, so that this hetflag can be used to fetch\n          # a residue from the Biopython structure by id.\n          if atom.residue_name in ('HOH', 'WAT'):\n            hetflag = 'W'\n          else:\n            hetflag = 'H_' + atom.residue_name\n        insertion_code = atom.insertion_code\n        if not _is_set(atom.insertion_code):\n          insertion_code = ' '\n        position = ResiduePosition(chain_id=atom.author_chain_id,\n                                   residue_number=int(atom.author_seq_num),\n                                   insertion_code=insertion_code)\n        seq_idx = int(atom.mmcif_seq_num) - seq_start_num[atom.mmcif_chain_id]\n        current = seq_to_structure_mappings.get(atom.author_chain_id, {})\n        current[seq_idx] = ResidueAtPosition(position=position,\n                                             name=atom.residue_name,\n                                             is_missing=False,\n                                             hetflag=hetflag)\n        seq_to_structure_mappings[atom.author_chain_id] = current\n\n    # Add missing residue information to seq_to_structure_mappings.\n    for chain_id, seq_info in valid_chains.items():\n      author_chain = mmcif_to_author_chain_id[chain_id]\n      current_mapping = seq_to_structure_mappings[author_chain]\n      for idx, monomer in enumerate(seq_info):\n        if idx not in current_mapping:\n          current_mapping[idx] = ResidueAtPosition(position=None,\n                                                   name=monomer.id,\n                                                   is_missing=True,\n                                                   hetflag=' ')\n\n    author_chain_to_sequence = {}\n    for chain_id, seq_info in valid_chains.items():\n      author_chain = mmcif_to_author_chain_id[chain_id]\n      seq = []\n      for monomer in seq_info:\n        code = SCOPData.protein_letters_3to1.get(monomer.id, 'X')\n        seq.append(code if len(code) == 1 else 'X')\n      seq = ''.join(seq)\n      author_chain_to_sequence[author_chain] = seq\n\n    mmcif_object = MmcifObject(\n        file_id=file_id,\n        header=header,\n        structure=first_model_structure,\n        chain_to_seqres=author_chain_to_sequence,\n        seqres_to_structure=seq_to_structure_mappings,\n        raw_string=parsed_info)\n\n    return ParsingResult(mmcif_object=mmcif_object, errors=errors)\n  except Exception as e:  # pylint:disable=broad-except\n    errors[(file_id, '')] = e\n    if not catch_all_errors:\n      raise\n    return ParsingResult(mmcif_object=None, errors=errors)\n\n\ndef _get_first_model(structure: PdbStructure) -> PdbStructure:\n  \"\"\"Returns the first model in a Biopython structure.\"\"\"\n  return next(structure.get_models())\n\n_MIN_LENGTH_OF_CHAIN_TO_BE_COUNTED_AS_PEPTIDE = 21\n\n\ndef get_release_date(parsed_info: MmCIFDict) -> str:\n  \"\"\"Returns the oldest revision date.\"\"\"\n  revision_dates = parsed_info['_pdbx_audit_revision_history.revision_date']\n  return min(revision_dates)\n\n\ndef _get_header(parsed_info: MmCIFDict) -> PdbHeader:\n  \"\"\"Returns a basic header containing method, release date and resolution.\"\"\"\n  header = {}\n\n  experiments = mmcif_loop_to_list('_exptl.', parsed_info)\n  header['structure_method'] = ','.join([\n      experiment['_exptl.method'].lower() for experiment in experiments])\n\n  # Note: The release_date here corresponds to the oldest revision. We prefer to\n  # use this for dataset filtering over the deposition_date.\n  if '_pdbx_audit_revision_history.revision_date' in parsed_info:\n    header['release_date'] = get_release_date(parsed_info)\n  else:\n    logging.warning('Could not determine release_date: %s',\n                    parsed_info['_entry.id'])\n\n  header['resolution'] = 0.00\n  for res_key in ('_refine.ls_d_res_high', '_em_3d_reconstruction.resolution',\n                  '_reflns.d_resolution_high'):\n    if res_key in parsed_info:\n      try:\n        raw_resolution = parsed_info[res_key][0]\n        header['resolution'] = float(raw_resolution)\n      except ValueError:\n        logging.debug('Invalid resolution format: %s', parsed_info[res_key])\n\n  return header\n\n\ndef _get_atom_site_list(parsed_info: MmCIFDict) -> Sequence[AtomSite]:\n  \"\"\"Returns list of atom sites; contains data not present in the structure.\"\"\"\n  return [AtomSite(*site) for site in zip(  # pylint:disable=g-complex-comprehension\n      parsed_info['_atom_site.label_comp_id'],\n      parsed_info['_atom_site.auth_asym_id'],\n      parsed_info['_atom_site.label_asym_id'],\n      parsed_info['_atom_site.auth_seq_id'],\n      parsed_info['_atom_site.label_seq_id'],\n      parsed_info['_atom_site.pdbx_PDB_ins_code'],\n      parsed_info['_atom_site.group_PDB'],\n      parsed_info['_atom_site.pdbx_PDB_model_num'],\n      )]\n\n\ndef _get_protein_chains(\n    *, parsed_info: Mapping[str, Any]) -> Mapping[ChainId, Sequence[Monomer]]:\n  \"\"\"Extracts polymer information for protein chains only.\n\n  Args:\n    parsed_info: _mmcif_dict produced by the Biopython parser.\n\n  Returns:\n    A dict mapping mmcif chain id to a list of Monomers.\n  \"\"\"\n  # Get polymer information for each entity in the structure.\n  entity_poly_seqs = mmcif_loop_to_list('_entity_poly_seq.', parsed_info)\n\n  polymers = collections.defaultdict(list)\n  for entity_poly_seq in entity_poly_seqs:\n    polymers[entity_poly_seq['_entity_poly_seq.entity_id']].append(\n        Monomer(id=entity_poly_seq['_entity_poly_seq.mon_id'],\n                num=int(entity_poly_seq['_entity_poly_seq.num'])))\n\n  # Get chemical compositions. Will allow us to identify which of these polymers\n  # are proteins.\n  chem_comps = mmcif_loop_to_dict('_chem_comp.', '_chem_comp.id', parsed_info)\n\n  # Get chains information for each entity. Necessary so that we can return a\n  # dict keyed on chain id rather than entity.\n  struct_asyms = mmcif_loop_to_list('_struct_asym.', parsed_info)\n\n  entity_to_mmcif_chains = collections.defaultdict(list)\n  for struct_asym in struct_asyms:\n    chain_id = struct_asym['_struct_asym.id']\n    entity_id = struct_asym['_struct_asym.entity_id']\n    entity_to_mmcif_chains[entity_id].append(chain_id)\n\n  # Identify and return the valid protein chains.\n  valid_chains = {}\n  for entity_id, seq_info in polymers.items():\n    chain_ids = entity_to_mmcif_chains[entity_id]\n\n    # Reject polymers without any peptide-like components, such as DNA/RNA.\n    if any(['peptide' in chem_comps[monomer.id]['_chem_comp.type']\n            for monomer in seq_info]):\n      for chain_id in chain_ids:\n        valid_chains[chain_id] = seq_info\n  return valid_chains\n\n\ndef _is_set(data: str) -> bool:\n  \"\"\"Returns False if data is a special mmCIF character indicating 'unset'.\"\"\"\n  return data not in ('.', '?')\n"
  },
  {
    "path": "alphafold/data/msa_identifiers.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Utilities for extracting identifiers from MSA sequence descriptions.\"\"\"\n\nimport dataclasses\nimport re\nfrom typing import Optional\n\n\n# Sequences coming from UniProtKB database come in the\n# `db|UniqueIdentifier|EntryName` format, e.g. `tr|A0A146SKV9|A0A146SKV9_FUNHE`\n# or `sp|P0C2L1|A3X1_LOXLA` (for TREMBL/Swiss-Prot respectively).\n_UNIPROT_PATTERN = re.compile(\n    r\"\"\"\n    ^\n    # UniProtKB/TrEMBL or UniProtKB/Swiss-Prot\n    (?:tr|sp)\n    \\|\n    # A primary accession number of the UniProtKB entry.\n    (?P<AccessionIdentifier>[A-Za-z0-9]{6,10})\n    # Occasionally there is a _0 or _1 isoform suffix, which we ignore.\n    (?:_\\d)?\n    \\|\n    # TREMBL repeats the accession ID here. Swiss-Prot has a mnemonic\n    # protein ID code.\n    (?:[A-Za-z0-9]+)\n    _\n    # A mnemonic species identification code.\n    (?P<SpeciesIdentifier>([A-Za-z0-9]){1,5})\n    # Small BFD uses a final value after an underscore, which we ignore.\n    (?:_\\d+)?\n    $\n    \"\"\",\n    re.VERBOSE)\n\n\n@dataclasses.dataclass(frozen=True)\nclass Identifiers:\n  species_id: str = ''\n\n\ndef _parse_sequence_identifier(msa_sequence_identifier: str) -> Identifiers:\n  \"\"\"Gets species from an msa sequence identifier.\n\n  The sequence identifier has the format specified by\n  _UNIPROT_TREMBL_ENTRY_NAME_PATTERN or _UNIPROT_SWISSPROT_ENTRY_NAME_PATTERN.\n  An example of a sequence identifier: `tr|A0A146SKV9|A0A146SKV9_FUNHE`\n\n  Args:\n    msa_sequence_identifier: a sequence identifier.\n\n  Returns:\n    An `Identifiers` instance with species_id. These\n    can be empty in the case where no identifier was found.\n  \"\"\"\n  matches = re.search(_UNIPROT_PATTERN, msa_sequence_identifier.strip())\n  if matches:\n    return Identifiers(\n        species_id=matches.group('SpeciesIdentifier'))\n  return Identifiers()\n\n\ndef _extract_sequence_identifier(description: str) -> Optional[str]:\n  \"\"\"Extracts sequence identifier from description. Returns None if no match.\"\"\"\n  split_description = description.split()\n  if split_description:\n    return split_description[0].partition('/')[0]\n  else:\n    return None\n\n\ndef get_identifiers(description: str) -> Identifiers:\n  \"\"\"Computes extra MSA features from the description.\"\"\"\n  sequence_identifier = _extract_sequence_identifier(description)\n  if sequence_identifier is None:\n    return Identifiers()\n  else:\n    return _parse_sequence_identifier(sequence_identifier)\n"
  },
  {
    "path": "alphafold/data/msa_pairing.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Pairing logic for multimer data pipeline.\"\"\"\n\nimport collections\nimport functools\nimport string\nfrom typing import Any, Dict, Iterable, List, Sequence\n\nfrom alphafold.common import residue_constants\nfrom alphafold.data import pipeline\nimport numpy as np\nimport pandas as pd\nimport scipy.linalg\n\nMSA_GAP_IDX = residue_constants.restypes_with_x_and_gap.index('-')\nSEQUENCE_GAP_CUTOFF = 0.5\nSEQUENCE_SIMILARITY_CUTOFF = 0.9\n\nMSA_PAD_VALUES = {'msa_all_seq': MSA_GAP_IDX,\n                  'msa_mask_all_seq': 1,\n                  'deletion_matrix_all_seq': 0,\n                  'deletion_matrix_int_all_seq': 0,\n                  'msa': MSA_GAP_IDX,\n                  'msa_mask': 1,\n                  'deletion_matrix': 0,\n                  'deletion_matrix_int': 0}\n\nMSA_FEATURES = ('msa', 'msa_mask', 'deletion_matrix', 'deletion_matrix_int')\nSEQ_FEATURES = ('residue_index', 'aatype', 'all_atom_positions',\n                'all_atom_mask', 'seq_mask', 'between_segment_residues',\n                'has_alt_locations', 'has_hetatoms', 'asym_id', 'entity_id',\n                'sym_id', 'entity_mask', 'deletion_mean',\n                'prediction_atom_mask',\n                'literature_positions', 'atom_indices_to_group_indices',\n                'rigid_group_default_frame')\nTEMPLATE_FEATURES = ('template_aatype', 'template_all_atom_positions',\n                     'template_all_atom_mask')\nCHAIN_FEATURES = ('num_alignments', 'seq_length')\n\n\ndef create_paired_features(\n    chains: Iterable[pipeline.FeatureDict]) ->  List[pipeline.FeatureDict]:\n  \"\"\"Returns the original chains with paired NUM_SEQ features.\n\n  Args:\n    chains:  A list of feature dictionaries for each chain.\n\n  Returns:\n    A list of feature dictionaries with sequence features including only\n    rows to be paired.\n  \"\"\"\n  chains = list(chains)\n  chain_keys = chains[0].keys()\n\n  if len(chains) < 2:\n    return chains\n  else:\n    updated_chains = []\n    paired_chains_to_paired_row_indices = pair_sequences(chains)\n    paired_rows = reorder_paired_rows(\n        paired_chains_to_paired_row_indices)\n\n    for chain_num, chain in enumerate(chains):\n      new_chain = {k: v for k, v in chain.items() if '_all_seq' not in k}\n      for feature_name in chain_keys:\n        if feature_name.endswith('_all_seq'):\n          feats_padded = pad_features(chain[feature_name], feature_name)\n          new_chain[feature_name] = feats_padded[paired_rows[:, chain_num]]\n      new_chain['num_alignments_all_seq'] = np.asarray(\n          len(paired_rows[:, chain_num]))\n      updated_chains.append(new_chain)\n    return updated_chains\n\n\ndef pad_features(feature: np.ndarray, feature_name: str) -> np.ndarray:\n  \"\"\"Add a 'padding' row at the end of the features list.\n\n  The padding row will be selected as a 'paired' row in the case of partial\n  alignment - for the chain that doesn't have paired alignment.\n\n  Args:\n    feature: The feature to be padded.\n    feature_name: The name of the feature to be padded.\n\n  Returns:\n    The feature with an additional padding row.\n  \"\"\"\n  assert feature.dtype != np.dtype(np.string_)\n  if feature_name in ('msa_all_seq', 'msa_mask_all_seq',\n                      'deletion_matrix_all_seq', 'deletion_matrix_int_all_seq'):\n    num_res = feature.shape[1]\n    padding = MSA_PAD_VALUES[feature_name] * np.ones([1, num_res],\n                                                     feature.dtype)\n  elif feature_name == 'msa_species_identifiers_all_seq':\n    padding = [b'']\n  else:\n    return feature\n  feats_padded = np.concatenate([feature, padding], axis=0)\n  return feats_padded\n\n\ndef _make_msa_df(chain_features: pipeline.FeatureDict) -> pd.DataFrame:\n  \"\"\"Makes dataframe with msa features needed for msa pairing.\"\"\"\n  chain_msa = chain_features['msa_all_seq']\n  query_seq = chain_msa[0]\n  per_seq_similarity = np.sum(\n      query_seq[None] == chain_msa, axis=-1) / float(len(query_seq))\n  per_seq_gap = np.sum(chain_msa == 21, axis=-1) / float(len(query_seq))\n  msa_df = pd.DataFrame({\n      'msa_species_identifiers':\n          chain_features['msa_species_identifiers_all_seq'],\n      'msa_row':\n          np.arange(len(\n              chain_features['msa_species_identifiers_all_seq'])),\n      'msa_similarity': per_seq_similarity,\n      'gap': per_seq_gap\n  })\n  return msa_df\n\n\ndef _create_species_dict(msa_df: pd.DataFrame) -> Dict[bytes, pd.DataFrame]:\n  \"\"\"Creates mapping from species to msa dataframe of that species.\"\"\"\n  species_lookup = {}\n  for species, species_df in msa_df.groupby('msa_species_identifiers'):\n    species_lookup[species] = species_df\n  return species_lookup\n\n\ndef _match_rows_by_sequence_similarity(this_species_msa_dfs: List[pd.DataFrame]\n                                       ) -> List[List[int]]:\n  \"\"\"Finds MSA sequence pairings across chains based on sequence similarity.\n\n  Each chain's MSA sequences are first sorted by their sequence similarity to\n  their respective target sequence. The sequences are then paired, starting\n  from the sequences most similar to their target sequence.\n\n  Args:\n    this_species_msa_dfs: a list of dataframes containing MSA features for\n      sequences for a specific species.\n\n  Returns:\n   A list of lists, each containing M indices corresponding to paired MSA rows,\n   where M is the number of chains.\n  \"\"\"\n  all_paired_msa_rows = []\n\n  num_seqs = [len(species_df) for species_df in this_species_msa_dfs\n              if species_df is not None]\n  take_num_seqs = np.min(num_seqs)\n\n  sort_by_similarity = (\n      lambda x: x.sort_values('msa_similarity', axis=0, ascending=False))\n\n  for species_df in this_species_msa_dfs:\n    if species_df is not None:\n      species_df_sorted = sort_by_similarity(species_df)\n      msa_rows = species_df_sorted.msa_row.iloc[:take_num_seqs].values\n    else:\n      msa_rows = [-1] * take_num_seqs  # take the last 'padding' row\n    all_paired_msa_rows.append(msa_rows)\n  all_paired_msa_rows = list(np.array(all_paired_msa_rows).transpose())\n  return all_paired_msa_rows\n\n\ndef pair_sequences(examples: List[pipeline.FeatureDict]\n                   ) -> Dict[int, np.ndarray]:\n  \"\"\"Returns indices for paired MSA sequences across chains.\"\"\"\n\n  num_examples = len(examples)\n\n  all_chain_species_dict = []\n  common_species = set()\n  for chain_features in examples:\n    msa_df = _make_msa_df(chain_features)\n    species_dict = _create_species_dict(msa_df)\n    all_chain_species_dict.append(species_dict)\n    common_species.update(set(species_dict))\n\n  common_species = sorted(common_species)\n  common_species.remove(b'')  # Remove target sequence species.\n\n  all_paired_msa_rows = [np.zeros(len(examples), int)]\n  all_paired_msa_rows_dict = {k: [] for k in range(num_examples)}\n  all_paired_msa_rows_dict[num_examples] = [np.zeros(len(examples), int)]\n\n  for species in common_species:\n    if not species:\n      continue\n    this_species_msa_dfs = []\n    species_dfs_present = 0\n    for species_dict in all_chain_species_dict:\n      if species in species_dict:\n        this_species_msa_dfs.append(species_dict[species])\n        species_dfs_present += 1\n      else:\n        this_species_msa_dfs.append(None)\n\n    # Skip species that are present in only one chain.\n    if species_dfs_present <= 1:\n      continue\n\n    if np.any(\n        np.array([len(species_df) for species_df in\n                  this_species_msa_dfs if\n                  isinstance(species_df, pd.DataFrame)]) > 600):\n      continue\n\n    paired_msa_rows = _match_rows_by_sequence_similarity(this_species_msa_dfs)\n    all_paired_msa_rows.extend(paired_msa_rows)\n    all_paired_msa_rows_dict[species_dfs_present].extend(paired_msa_rows)\n  all_paired_msa_rows_dict = {\n      num_examples: np.array(paired_msa_rows) for\n      num_examples, paired_msa_rows in all_paired_msa_rows_dict.items()\n  }\n  return all_paired_msa_rows_dict\n\n\ndef reorder_paired_rows(all_paired_msa_rows_dict: Dict[int, np.ndarray]\n                        ) -> np.ndarray:\n  \"\"\"Creates a list of indices of paired MSA rows across chains.\n\n  Args:\n    all_paired_msa_rows_dict: a mapping from the number of paired chains to the\n      paired indices.\n\n  Returns:\n    a list of lists, each containing indices of paired MSA rows across chains.\n    The paired-index lists are ordered by:\n      1) the number of chains in the paired alignment, i.e, all-chain pairings\n         will come first.\n      2) e-values\n  \"\"\"\n  all_paired_msa_rows = []\n\n  for num_pairings in sorted(all_paired_msa_rows_dict, reverse=True):\n    paired_rows = all_paired_msa_rows_dict[num_pairings]\n    paired_rows_product = abs(np.array([np.prod(rows) for rows in paired_rows]))\n    paired_rows_sort_index = np.argsort(paired_rows_product)\n    all_paired_msa_rows.extend(paired_rows[paired_rows_sort_index])\n\n  return np.array(all_paired_msa_rows)\n\n\ndef block_diag(*arrs: np.ndarray, pad_value: float = 0.0) -> np.ndarray:\n  \"\"\"Like scipy.linalg.block_diag but with an optional padding value.\"\"\"\n  ones_arrs = [np.ones_like(x) for x in arrs]\n  off_diag_mask = 1.0 - scipy.linalg.block_diag(*ones_arrs)\n  diag = scipy.linalg.block_diag(*arrs)\n  diag += (off_diag_mask * pad_value).astype(diag.dtype)\n  return diag\n\n\ndef _correct_post_merged_feats(\n    np_example: pipeline.FeatureDict,\n    np_chains_list: Sequence[pipeline.FeatureDict],\n    pair_msa_sequences: bool) -> pipeline.FeatureDict:\n  \"\"\"Adds features that need to be computed/recomputed post merging.\"\"\"\n\n  np_example['seq_length'] = np.asarray(np_example['aatype'].shape[0],\n                                        dtype=np.int32)\n  np_example['num_alignments'] = np.asarray(np_example['msa'].shape[0],\n                                            dtype=np.int32)\n\n  if not pair_msa_sequences:\n    # Generate a bias that is 1 for the first row of every block in the\n    # block diagonal MSA - i.e. make sure the cluster stack always includes\n    # the query sequences for each chain (since the first row is the query\n    # sequence).\n    cluster_bias_masks = []\n    for chain in np_chains_list:\n      mask = np.zeros(chain['msa'].shape[0])\n      mask[0] = 1\n      cluster_bias_masks.append(mask)\n    np_example['cluster_bias_mask'] = np.concatenate(cluster_bias_masks)\n\n    # Initialize Bert mask with masked out off diagonals.\n    msa_masks = [np.ones(x['msa'].shape, dtype=np.float32)\n                 for x in np_chains_list]\n\n    np_example['bert_mask'] = block_diag(\n        *msa_masks, pad_value=0)\n  else:\n    np_example['cluster_bias_mask'] = np.zeros(np_example['msa'].shape[0])\n    np_example['cluster_bias_mask'][0] = 1\n\n    # Initialize Bert mask with masked out off diagonals.\n    msa_masks = [np.ones(x['msa'].shape, dtype=np.float32) for\n                 x in np_chains_list]\n    msa_masks_all_seq = [np.ones(x['msa_all_seq'].shape, dtype=np.float32) for\n                         x in np_chains_list]\n\n    msa_mask_block_diag = block_diag(\n        *msa_masks, pad_value=0)\n    msa_mask_all_seq = np.concatenate(msa_masks_all_seq, axis=1)\n    np_example['bert_mask'] = np.concatenate(\n        [msa_mask_all_seq, msa_mask_block_diag], axis=0)\n  return np_example\n\n\ndef _pad_templates(chains: Sequence[pipeline.FeatureDict],\n                   max_templates: int) -> Sequence[pipeline.FeatureDict]:\n  \"\"\"For each chain pad the number of templates to a fixed size.\n\n  Args:\n    chains: A list of protein chains.\n    max_templates: Each chain will be padded to have this many templates.\n\n  Returns:\n    The list of chains, updated to have template features padded to\n    max_templates.\n  \"\"\"\n  for chain in chains:\n    for k, v in chain.items():\n      if k in TEMPLATE_FEATURES:\n        padding = np.zeros_like(v.shape)\n        padding[0] = max_templates - v.shape[0]\n        padding = [(0, p) for p in padding]\n        chain[k] = np.pad(v, padding, mode='constant')\n  return chains\n\n\ndef _merge_features_from_multiple_chains(\n    chains: Sequence[pipeline.FeatureDict],\n    pair_msa_sequences: bool) -> pipeline.FeatureDict:\n  \"\"\"Merge features from multiple chains.\n\n  Args:\n    chains: A list of feature dictionaries that we want to merge.\n    pair_msa_sequences: Whether to concatenate MSA features along the\n      num_res dimension (if True), or to block diagonalize them (if False).\n\n  Returns:\n    A feature dictionary for the merged example.\n  \"\"\"\n  merged_example = {}\n  for feature_name in chains[0]:\n    feats = [x[feature_name] for x in chains]\n    feature_name_split = feature_name.split('_all_seq')[0]\n    if feature_name_split in MSA_FEATURES:\n      if pair_msa_sequences or '_all_seq' in feature_name:\n        merged_example[feature_name] = np.concatenate(feats, axis=1)\n      else:\n        merged_example[feature_name] = block_diag(\n            *feats, pad_value=MSA_PAD_VALUES[feature_name])\n    elif feature_name_split in SEQ_FEATURES:\n      merged_example[feature_name] = np.concatenate(feats, axis=0)\n    elif feature_name_split in TEMPLATE_FEATURES:\n      merged_example[feature_name] = np.concatenate(feats, axis=1)\n    elif feature_name_split in CHAIN_FEATURES:\n      merged_example[feature_name] = np.sum(x for x in feats).astype(np.int32)\n    else:\n      merged_example[feature_name] = feats[0]\n  return merged_example\n\n\ndef _merge_homomers_dense_msa(\n    chains: Iterable[pipeline.FeatureDict]) -> Sequence[pipeline.FeatureDict]:\n  \"\"\"Merge all identical chains, making the resulting MSA dense.\n\n  Args:\n    chains: An iterable of features for each chain.\n\n  Returns:\n    A list of feature dictionaries.  All features with the same entity_id\n    will be merged - MSA features will be concatenated along the num_res\n    dimension - making them dense.\n  \"\"\"\n  entity_chains = collections.defaultdict(list)\n  for chain in chains:\n    entity_id = chain['entity_id'][0]\n    entity_chains[entity_id].append(chain)\n\n  grouped_chains = []\n  for entity_id in sorted(entity_chains):\n    chains = entity_chains[entity_id]\n    grouped_chains.append(chains)\n  chains = [\n      _merge_features_from_multiple_chains(chains, pair_msa_sequences=True)\n      for chains in grouped_chains]\n  return chains\n\n\ndef _concatenate_paired_and_unpaired_features(\n    example: pipeline.FeatureDict) -> pipeline.FeatureDict:\n  \"\"\"Merges paired and block-diagonalised features.\"\"\"\n  features = MSA_FEATURES\n  for feature_name in features:\n    if feature_name in example:\n      feat = example[feature_name]\n      feat_all_seq = example[feature_name + '_all_seq']\n      merged_feat = np.concatenate([feat_all_seq, feat], axis=0)\n      example[feature_name] = merged_feat\n  example['num_alignments'] = np.array(example['msa'].shape[0],\n                                       dtype=np.int32)\n  return example\n\n\ndef merge_chain_features(np_chains_list: List[pipeline.FeatureDict],\n                         pair_msa_sequences: bool,\n                         max_templates: int) -> pipeline.FeatureDict:\n  \"\"\"Merges features for multiple chains to single FeatureDict.\n\n  Args:\n    np_chains_list: List of FeatureDicts for each chain.\n    pair_msa_sequences: Whether to merge paired MSAs.\n    max_templates: The maximum number of templates to include.\n\n  Returns:\n    Single FeatureDict for entire complex.\n  \"\"\"\n  np_chains_list = _pad_templates(\n      np_chains_list, max_templates=max_templates)\n  np_chains_list = _merge_homomers_dense_msa(np_chains_list)\n  # Unpaired MSA features will be always block-diagonalised; paired MSA\n  # features will be concatenated.\n  np_example = _merge_features_from_multiple_chains(\n      np_chains_list, pair_msa_sequences=False)\n  if pair_msa_sequences:\n    np_example = _concatenate_paired_and_unpaired_features(np_example)\n  np_example = _correct_post_merged_feats(\n      np_example=np_example,\n      np_chains_list=np_chains_list,\n      pair_msa_sequences=pair_msa_sequences)\n\n  return np_example\n\n\ndef deduplicate_unpaired_sequences(\n    np_chains: List[pipeline.FeatureDict]) -> List[pipeline.FeatureDict]:\n  \"\"\"Removes unpaired sequences which duplicate a paired sequence.\"\"\"\n\n  feature_names = np_chains[0].keys()\n  msa_features = MSA_FEATURES\n\n  for chain in np_chains:\n    # Convert the msa_all_seq numpy array to a tuple for hashing.\n    sequence_set = set(tuple(s) for s in chain['msa_all_seq'])\n    keep_rows = []\n    # Go through unpaired MSA seqs and remove any rows that correspond to the\n    # sequences that are already present in the paired MSA.\n    for row_num, seq in enumerate(chain['msa']):\n      if tuple(seq) not in sequence_set:\n        keep_rows.append(row_num)\n    for feature_name in feature_names:\n      if feature_name in msa_features:\n        chain[feature_name] = chain[feature_name][keep_rows]\n    chain['num_alignments'] = np.array(chain['msa'].shape[0], dtype=np.int32)\n  return np_chains\n"
  },
  {
    "path": "alphafold/data/parsers.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Functions for parsing various file formats.\"\"\"\nimport collections\nimport dataclasses\nimport itertools\nimport re\nimport string\nfrom typing import Dict, Iterable, List, Optional, Sequence, Tuple, Set\n\n# Internal import (7716).\n\n\nDeletionMatrix = Sequence[Sequence[int]]\n\n\n@dataclasses.dataclass(frozen=True)\nclass Msa:\n  \"\"\"Class representing a parsed MSA file.\"\"\"\n  sequences: Sequence[str]\n  deletion_matrix: DeletionMatrix\n  descriptions: Sequence[str]\n\n  def __post_init__(self):\n    if not (len(self.sequences) ==\n            len(self.deletion_matrix) ==\n            len(self.descriptions)):\n      raise ValueError(\n          'All fields for an MSA must have the same length. '\n          f'Got {len(self.sequences)} sequences, '\n          f'{len(self.deletion_matrix)} rows in the deletion matrix and '\n          f'{len(self.descriptions)} descriptions.')\n\n  def __len__(self):\n    return len(self.sequences)\n\n  def truncate(self, max_seqs: int):\n    return Msa(sequences=self.sequences[:max_seqs],\n               deletion_matrix=self.deletion_matrix[:max_seqs],\n               descriptions=self.descriptions[:max_seqs])\n\n\n@dataclasses.dataclass(frozen=True)\nclass TemplateHit:\n  \"\"\"Class representing a template hit.\"\"\"\n  index: int\n  name: str\n  aligned_cols: int\n  sum_probs: Optional[float]\n  query: str\n  hit_sequence: str\n  indices_query: List[int]\n  indices_hit: List[int]\n\n\ndef parse_fasta(fasta_string: str) -> Tuple[Sequence[str], Sequence[str]]:\n  \"\"\"Parses FASTA string and returns list of strings with amino-acid sequences.\n\n  Arguments:\n    fasta_string: The string contents of a FASTA file.\n\n  Returns:\n    A tuple of two lists:\n    * A list of sequences.\n    * A list of sequence descriptions taken from the comment lines. In the\n      same order as the sequences.\n  \"\"\"\n  sequences = []\n  descriptions = []\n  index = -1\n  for line in fasta_string.splitlines():\n    line = line.strip()\n    if line.startswith('>'):\n      index += 1\n      descriptions.append(line[1:])  # Remove the '>' at the beginning.\n      sequences.append('')\n      continue\n    elif not line:\n      continue  # Skip blank lines.\n    sequences[index] += line\n\n  return sequences, descriptions\n\n\ndef parse_stockholm(stockholm_string: str) -> Msa:\n  \"\"\"Parses sequences and deletion matrix from stockholm format alignment.\n\n  Args:\n    stockholm_string: The string contents of a stockholm file. The first\n      sequence in the file should be the query sequence.\n\n  Returns:\n    A tuple of:\n      * A list of sequences that have been aligned to the query. These\n        might contain duplicates.\n      * The deletion matrix for the alignment as a list of lists. The element\n        at `deletion_matrix[i][j]` is the number of residues deleted from\n        the aligned sequence i at residue position j.\n      * The names of the targets matched, including the jackhmmer subsequence\n        suffix.\n  \"\"\"\n  name_to_sequence = collections.OrderedDict()\n  for line in stockholm_string.splitlines():\n    line = line.strip()\n    if not line or line.startswith(('#', '//')):\n      continue\n    name, sequence = line.split()\n    if name not in name_to_sequence:\n      name_to_sequence[name] = ''\n    name_to_sequence[name] += sequence\n\n  msa = []\n  deletion_matrix = []\n\n  query = ''\n  keep_columns = []\n  for seq_index, sequence in enumerate(name_to_sequence.values()):\n    if seq_index == 0:\n      # Gather the columns with gaps from the query\n      query = sequence\n      keep_columns = [i for i, res in enumerate(query) if res != '-']\n\n    # Remove the columns with gaps in the query from all sequences.\n    aligned_sequence = ''.join([sequence[c] for c in keep_columns])\n\n    msa.append(aligned_sequence)\n\n    # Count the number of deletions w.r.t. query.\n    deletion_vec = []\n    deletion_count = 0\n    for seq_res, query_res in zip(sequence, query):\n      if seq_res != '-' or query_res != '-':\n        if query_res == '-':\n          deletion_count += 1\n        else:\n          deletion_vec.append(deletion_count)\n          deletion_count = 0\n    deletion_matrix.append(deletion_vec)\n\n  return Msa(sequences=msa,\n             deletion_matrix=deletion_matrix,\n             descriptions=list(name_to_sequence.keys()))\n\n\ndef parse_a3m(a3m_string: str) -> Msa:\n  \"\"\"Parses sequences and deletion matrix from a3m format alignment.\n\n  Args:\n    a3m_string: The string contents of a a3m file. The first sequence in the\n      file should be the query sequence.\n\n  Returns:\n    A tuple of:\n      * A list of sequences that have been aligned to the query. These\n        might contain duplicates.\n      * The deletion matrix for the alignment as a list of lists. The element\n        at `deletion_matrix[i][j]` is the number of residues deleted from\n        the aligned sequence i at residue position j.\n      * A list of descriptions, one per sequence, from the a3m file.\n  \"\"\"\n  sequences, descriptions = parse_fasta(a3m_string)\n  deletion_matrix = []\n  for msa_sequence in sequences:\n    deletion_vec = []\n    deletion_count = 0\n    for j in msa_sequence:\n      if j.islower():\n        deletion_count += 1\n      else:\n        deletion_vec.append(deletion_count)\n        deletion_count = 0\n    deletion_matrix.append(deletion_vec)\n\n  # Make the MSA matrix out of aligned (deletion-free) sequences.\n  deletion_table = str.maketrans('', '', string.ascii_lowercase)\n  aligned_sequences = [s.translate(deletion_table) for s in sequences]\n  return Msa(sequences=aligned_sequences,\n             deletion_matrix=deletion_matrix,\n             descriptions=descriptions)\n\n\ndef _convert_sto_seq_to_a3m(\n    query_non_gaps: Sequence[bool], sto_seq: str) -> Iterable[str]:\n  for is_query_res_non_gap, sequence_res in zip(query_non_gaps, sto_seq):\n    if is_query_res_non_gap:\n      yield sequence_res\n    elif sequence_res != '-':\n      yield sequence_res.lower()\n\n\ndef convert_stockholm_to_a3m(stockholm_format: str,\n                             max_sequences: Optional[int] = None,\n                             remove_first_row_gaps: bool = True) -> str:\n  \"\"\"Converts MSA in Stockholm format to the A3M format.\"\"\"\n  descriptions = {}\n  sequences = {}\n  reached_max_sequences = False\n\n  for line in stockholm_format.splitlines():\n    reached_max_sequences = max_sequences and len(sequences) >= max_sequences\n    if line.strip() and not line.startswith(('#', '//')):\n      # Ignore blank lines, markup and end symbols - remainder are alignment\n      # sequence parts.\n      seqname, aligned_seq = line.split(maxsplit=1)\n      if seqname not in sequences:\n        if reached_max_sequences:\n          continue\n        sequences[seqname] = ''\n      sequences[seqname] += aligned_seq\n\n  for line in stockholm_format.splitlines():\n    if line[:4] == '#=GS':\n      # Description row - example format is:\n      # #=GS UniRef90_Q9H5Z4/4-78            DE [subseq from] cDNA: FLJ22755 ...\n      columns = line.split(maxsplit=3)\n      seqname, feature = columns[1:3]\n      value = columns[3] if len(columns) == 4 else ''\n      if feature != 'DE':\n        continue\n      if reached_max_sequences and seqname not in sequences:\n        continue\n      descriptions[seqname] = value\n      if len(descriptions) == len(sequences):\n        break\n\n  # Convert sto format to a3m line by line\n  a3m_sequences = {}\n  if remove_first_row_gaps:\n    # query_sequence is assumed to be the first sequence\n    query_sequence = next(iter(sequences.values()))\n    query_non_gaps = [res != '-' for res in query_sequence]\n  for seqname, sto_sequence in sequences.items():\n    # Dots are optional in a3m format and are commonly removed.\n    out_sequence = sto_sequence.replace('.', '')\n    if remove_first_row_gaps:\n      out_sequence = ''.join(\n          _convert_sto_seq_to_a3m(query_non_gaps, out_sequence))\n    a3m_sequences[seqname] = out_sequence\n\n  fasta_chunks = (f\">{k} {descriptions.get(k, '')}\\n{a3m_sequences[k]}\"\n                  for k in a3m_sequences)\n  return '\\n'.join(fasta_chunks) + '\\n'  # Include terminating newline.\n\n\ndef _keep_line(line: str, seqnames: Set[str]) -> bool:\n  \"\"\"Function to decide which lines to keep.\"\"\"\n  if not line.strip():\n    return True\n  if line.strip() == '//':  # End tag\n    return True\n  if line.startswith('# STOCKHOLM'):  # Start tag\n    return True\n  if line.startswith('#=GC RF'):  # Reference Annotation Line\n    return True\n  if line[:4] == '#=GS':  # Description lines - keep if sequence in list.\n    _, seqname, _ = line.split(maxsplit=2)\n    return seqname in seqnames\n  elif line.startswith('#'):  # Other markup - filter out\n    return False\n  else:  # Alignment data - keep if sequence in list.\n    seqname = line.partition(' ')[0]\n    return seqname in seqnames\n\n\ndef truncate_stockholm_msa(stockholm_msa_path: str, max_sequences: int) -> str:\n  \"\"\"Reads + truncates a Stockholm file while preventing excessive RAM usage.\"\"\"\n  seqnames = set()\n  filtered_lines = []\n\n  with open(stockholm_msa_path) as f:\n    for line in f:\n      if line.strip() and not line.startswith(('#', '//')):\n        # Ignore blank lines, markup and end symbols - remainder are alignment\n        # sequence parts.\n        seqname = line.partition(' ')[0]\n        seqnames.add(seqname)\n        if len(seqnames) >= max_sequences:\n          break\n\n    f.seek(0)\n    for line in f:\n      if _keep_line(line, seqnames):\n        filtered_lines.append(line)\n\n  return ''.join(filtered_lines)\n\n\ndef remove_empty_columns_from_stockholm_msa(stockholm_msa: str) -> str:\n  \"\"\"Removes empty columns (dashes-only) from a Stockholm MSA.\"\"\"\n  processed_lines = {}\n  unprocessed_lines = {}\n  for i, line in enumerate(stockholm_msa.splitlines()):\n    if line.startswith('#=GC RF'):\n      reference_annotation_i = i\n      reference_annotation_line = line\n      # Reached the end of this chunk of the alignment. Process chunk.\n      _, _, first_alignment = line.rpartition(' ')\n      mask = []\n      for j in range(len(first_alignment)):\n        for _, unprocessed_line in unprocessed_lines.items():\n          prefix, _, alignment = unprocessed_line.rpartition(' ')\n          if alignment[j] != '-':\n            mask.append(True)\n            break\n        else:  # Every row contained a hyphen - empty column.\n          mask.append(False)\n      # Add reference annotation for processing with mask.\n      unprocessed_lines[reference_annotation_i] = reference_annotation_line\n\n      if not any(mask):  # All columns were empty. Output empty lines for chunk.\n        for line_index in unprocessed_lines:\n          processed_lines[line_index] = ''\n      else:\n        for line_index, unprocessed_line in unprocessed_lines.items():\n          prefix, _, alignment = unprocessed_line.rpartition(' ')\n          masked_alignment = ''.join(itertools.compress(alignment, mask))\n          processed_lines[line_index] = f'{prefix} {masked_alignment}'\n\n      # Clear raw_alignments.\n      unprocessed_lines = {}\n    elif line.strip() and not line.startswith(('#', '//')):\n      unprocessed_lines[i] = line\n    else:\n      processed_lines[i] = line\n  return '\\n'.join((processed_lines[i] for i in range(len(processed_lines))))\n\n\ndef deduplicate_stockholm_msa(stockholm_msa: str) -> str:\n  \"\"\"Remove duplicate sequences (ignoring insertions wrt query).\"\"\"\n  sequence_dict = collections.defaultdict(str)\n\n  # First we must extract all sequences from the MSA.\n  for line in stockholm_msa.splitlines():\n    # Only consider the alignments - ignore reference annotation, empty lines,\n    # descriptions or markup.\n    if line.strip() and not line.startswith(('#', '//')):\n      line = line.strip()\n      seqname, alignment = line.split()\n      sequence_dict[seqname] += alignment\n\n  seen_sequences = set()\n  seqnames = set()\n  # First alignment is the query.\n  query_align = next(iter(sequence_dict.values()))\n  mask = [c != '-' for c in query_align]  # Mask is False for insertions.\n  for seqname, alignment in sequence_dict.items():\n    # Apply mask to remove all insertions from the string.\n    masked_alignment = ''.join(itertools.compress(alignment, mask))\n    if masked_alignment in seen_sequences:\n      continue\n    else:\n      seen_sequences.add(masked_alignment)\n      seqnames.add(seqname)\n\n  filtered_lines = []\n  for line in stockholm_msa.splitlines():\n    if _keep_line(line, seqnames):\n      filtered_lines.append(line)\n\n  return '\\n'.join(filtered_lines) + '\\n'\n\n\ndef _get_hhr_line_regex_groups(\n    regex_pattern: str, line: str) -> Sequence[Optional[str]]:\n  match = re.match(regex_pattern, line)\n  if match is None:\n    raise RuntimeError(f'Could not parse query line {line}')\n  return match.groups()\n\n\ndef _update_hhr_residue_indices_list(\n    sequence: str, start_index: int, indices_list: List[int]):\n  \"\"\"Computes the relative indices for each residue with respect to the original sequence.\"\"\"\n  counter = start_index\n  for symbol in sequence:\n    if symbol == '-':\n      indices_list.append(-1)\n    else:\n      indices_list.append(counter)\n      counter += 1\n\n\ndef _parse_hhr_hit(detailed_lines: Sequence[str]) -> TemplateHit:\n  \"\"\"Parses the detailed HMM HMM comparison section for a single Hit.\n\n  This works on .hhr files generated from both HHBlits and HHSearch.\n\n  Args:\n    detailed_lines: A list of lines from a single comparison section between 2\n      sequences (which each have their own HMM's)\n\n  Returns:\n    A dictionary with the information from that detailed comparison section\n\n  Raises:\n    RuntimeError: If a certain line cannot be processed\n  \"\"\"\n  # Parse first 2 lines.\n  number_of_hit = int(detailed_lines[0].split()[-1])\n  name_hit = detailed_lines[1][1:]\n\n  # Parse the summary line.\n  pattern = (\n      'Probab=(.*)[\\t ]*E-value=(.*)[\\t ]*Score=(.*)[\\t ]*Aligned_cols=(.*)[\\t'\n      ' ]*Identities=(.*)%[\\t ]*Similarity=(.*)[\\t ]*Sum_probs=(.*)[\\t '\n      ']*Template_Neff=(.*)')\n  match = re.match(pattern, detailed_lines[2])\n  if match is None:\n    raise RuntimeError(\n        'Could not parse section: %s. Expected this: \\n%s to contain summary.' %\n        (detailed_lines, detailed_lines[2]))\n  (_, _, _, aligned_cols, _, _, sum_probs, _) = [float(x)\n                                                 for x in match.groups()]\n\n  # The next section reads the detailed comparisons. These are in a 'human\n  # readable' format which has a fixed length. The strategy employed is to\n  # assume that each block starts with the query sequence line, and to parse\n  # that with a regexp in order to deduce the fixed length used for that block.\n  query = ''\n  hit_sequence = ''\n  indices_query = []\n  indices_hit = []\n  length_block = None\n\n  for line in detailed_lines[3:]:\n    # Parse the query sequence line\n    if (line.startswith('Q ') and not line.startswith('Q ss_dssp') and\n        not line.startswith('Q ss_pred') and\n        not line.startswith('Q Consensus')):\n      # Thus the first 17 characters must be 'Q <query_name> ', and we can parse\n      # everything after that.\n      #              start    sequence       end       total_sequence_length\n      patt = r'[\\t ]*([0-9]*) ([A-Z-]*)[\\t ]*([0-9]*) \\([0-9]*\\)'\n      groups = _get_hhr_line_regex_groups(patt, line[17:])\n\n      # Get the length of the parsed block using the start and finish indices,\n      # and ensure it is the same as the actual block length.\n      start = int(groups[0]) - 1  # Make index zero based.\n      delta_query = groups[1]\n      end = int(groups[2])\n      num_insertions = len([x for x in delta_query if x == '-'])\n      length_block = end - start + num_insertions\n      assert length_block == len(delta_query)\n\n      # Update the query sequence and indices list.\n      query += delta_query\n      _update_hhr_residue_indices_list(delta_query, start, indices_query)\n\n    elif line.startswith('T '):\n      # Parse the hit sequence.\n      if (not line.startswith('T ss_dssp') and\n          not line.startswith('T ss_pred') and\n          not line.startswith('T Consensus')):\n        # Thus the first 17 characters must be 'T <hit_name> ', and we can\n        # parse everything after that.\n        #              start    sequence       end     total_sequence_length\n        patt = r'[\\t ]*([0-9]*) ([A-Z-]*)[\\t ]*[0-9]* \\([0-9]*\\)'\n        groups = _get_hhr_line_regex_groups(patt, line[17:])\n        start = int(groups[0]) - 1  # Make index zero based.\n        delta_hit_sequence = groups[1]\n        assert length_block == len(delta_hit_sequence)\n\n        # Update the hit sequence and indices list.\n        hit_sequence += delta_hit_sequence\n        _update_hhr_residue_indices_list(delta_hit_sequence, start, indices_hit)\n\n  return TemplateHit(\n      index=number_of_hit,\n      name=name_hit,\n      aligned_cols=int(aligned_cols),\n      sum_probs=sum_probs,\n      query=query,\n      hit_sequence=hit_sequence,\n      indices_query=indices_query,\n      indices_hit=indices_hit,\n  )\n\n\ndef parse_hhr(hhr_string: str) -> Sequence[TemplateHit]:\n  \"\"\"Parses the content of an entire HHR file.\"\"\"\n  lines = hhr_string.splitlines()\n\n  # Each .hhr file starts with a results table, then has a sequence of hit\n  # \"paragraphs\", each paragraph starting with a line 'No <hit number>'. We\n  # iterate through each paragraph to parse each hit.\n\n  block_starts = [i for i, line in enumerate(lines) if line.startswith('No ')]\n\n  hits = []\n  if block_starts:\n    block_starts.append(len(lines))  # Add the end of the final block.\n    for i in range(len(block_starts) - 1):\n      hits.append(_parse_hhr_hit(lines[block_starts[i]:block_starts[i + 1]]))\n  return hits\n\n\ndef parse_e_values_from_tblout(tblout: str) -> Dict[str, float]:\n  \"\"\"Parse target to e-value mapping parsed from Jackhmmer tblout string.\"\"\"\n  e_values = {'query': 0}\n  lines = [line for line in tblout.splitlines() if line[0] != '#']\n  # As per http://eddylab.org/software/hmmer/Userguide.pdf fields are\n  # space-delimited. Relevant fields are (1) target name:  and\n  # (5) E-value (full sequence) (numbering from 1).\n  for line in lines:\n    fields = line.split()\n    e_value = fields[4]\n    target_name = fields[0]\n    e_values[target_name] = float(e_value)\n  return e_values\n\n\ndef _get_indices(sequence: str, start: int) -> List[int]:\n  \"\"\"Returns indices for non-gap/insert residues starting at the given index.\"\"\"\n  indices = []\n  counter = start\n  for symbol in sequence:\n    # Skip gaps but add a placeholder so that the alignment is preserved.\n    if symbol == '-':\n      indices.append(-1)\n    # Skip deleted residues, but increase the counter.\n    elif symbol.islower():\n      counter += 1\n    # Normal aligned residue. Increase the counter and append to indices.\n    else:\n      indices.append(counter)\n      counter += 1\n  return indices\n\n\n@dataclasses.dataclass(frozen=True)\nclass HitMetadata:\n  pdb_id: str\n  chain: str\n  start: int\n  end: int\n  length: int\n  text: str\n\n\ndef _parse_hmmsearch_description(description: str) -> HitMetadata:\n  \"\"\"Parses the hmmsearch A3M sequence description line.\"\"\"\n  # Example 1: >4pqx_A/2-217 [subseq from] mol:protein length:217  Free text\n  # Example 2: >5g3r_A/1-55 [subseq from] mol:protein length:352\n  match = re.match(\n      r'^>?([a-z0-9]+)_(\\w+)/([0-9]+)-([0-9]+).*protein length:([0-9]+) *(.*)$',\n      description.strip())\n\n  if not match:\n    raise ValueError(f'Could not parse description: \"{description}\".')\n\n  return HitMetadata(\n      pdb_id=match[1],\n      chain=match[2],\n      start=int(match[3]),\n      end=int(match[4]),\n      length=int(match[5]),\n      text=match[6])\n\n\ndef parse_hmmsearch_a3m(query_sequence: str,\n                        a3m_string: str,\n                        skip_first: bool = True) -> Sequence[TemplateHit]:\n  \"\"\"Parses an a3m string produced by hmmsearch.\n\n  Args:\n    query_sequence: The query sequence.\n    a3m_string: The a3m string produced by hmmsearch.\n    skip_first: Whether to skip the first sequence in the a3m string.\n\n  Returns:\n    A sequence of `TemplateHit` results.\n  \"\"\"\n  # Zip the descriptions and MSAs together, skip the first query sequence.\n  parsed_a3m = list(zip(*parse_fasta(a3m_string)))\n  if skip_first:\n    parsed_a3m = parsed_a3m[1:]\n\n  indices_query = _get_indices(query_sequence, start=0)\n\n  hits = []\n  for i, (hit_sequence, hit_description) in enumerate(parsed_a3m, start=1):\n    if 'mol:protein' not in hit_description:\n      continue  # Skip non-protein chains.\n    metadata = _parse_hmmsearch_description(hit_description)\n    # Aligned columns are only the match states.\n    aligned_cols = sum([r.isupper() and r != '-' for r in hit_sequence])\n    indices_hit = _get_indices(hit_sequence, start=metadata.start - 1)\n\n    hit = TemplateHit(\n        index=i,\n        name=f'{metadata.pdb_id}_{metadata.chain}',\n        aligned_cols=aligned_cols,\n        sum_probs=None,\n        query=query_sequence,\n        hit_sequence=hit_sequence.upper(),\n        indices_query=indices_query,\n        indices_hit=indices_hit,\n    )\n    hits.append(hit)\n\n  return hits\n"
  },
  {
    "path": "alphafold/data/pipeline.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Functions for building the input features for the AlphaFold model.\"\"\"\n\nimport os\nfrom typing import Any, Mapping, MutableMapping, Optional, Sequence, Union\nfrom absl import logging\nfrom alphafold.common import residue_constants\nfrom alphafold.data import msa_identifiers\nfrom alphafold.data import parsers\nfrom alphafold.data import templates\nfrom alphafold.data.tools import hhblits\nfrom alphafold.data.tools import hhsearch\nfrom alphafold.data.tools import hmmsearch\nfrom alphafold.data.tools import jackhmmer\nimport numpy as np\n\n# Internal import (7716).\n\nFeatureDict = MutableMapping[str, np.ndarray]\nTemplateSearcher = Union[hhsearch.HHSearch, hmmsearch.Hmmsearch]\n\n\ndef make_sequence_features(\n    sequence: str, description: str, num_res: int) -> FeatureDict:\n  \"\"\"Constructs a feature dict of sequence features.\"\"\"\n  features = {}\n  features['aatype'] = residue_constants.sequence_to_onehot(\n      sequence=sequence,\n      mapping=residue_constants.restype_order_with_x,\n      map_unknown_to_x=True)\n  features['between_segment_residues'] = np.zeros((num_res,), dtype=np.int32)\n  features['domain_name'] = np.array([description.encode('utf-8')],\n                                     dtype=np.object_)\n  features['residue_index'] = np.array(range(num_res), dtype=np.int32)\n  features['seq_length'] = np.array([num_res] * num_res, dtype=np.int32)\n  features['sequence'] = np.array([sequence.encode('utf-8')], dtype=np.object_)\n  return features\n\n\ndef make_msa_features(msas: Sequence[parsers.Msa]) -> FeatureDict:\n  \"\"\"Constructs a feature dict of MSA features.\"\"\"\n  if not msas:\n    raise ValueError('At least one MSA must be provided.')\n\n  int_msa = []\n  deletion_matrix = []\n  species_ids = []\n  seen_sequences = set()\n  for msa_index, msa in enumerate(msas):\n    if not msa:\n      raise ValueError(f'MSA {msa_index} must contain at least one sequence.')\n    for sequence_index, sequence in enumerate(msa.sequences):\n      if sequence in seen_sequences:\n        continue\n      seen_sequences.add(sequence)\n      int_msa.append(\n          [residue_constants.HHBLITS_AA_TO_ID[res] for res in sequence])\n      deletion_matrix.append(msa.deletion_matrix[sequence_index])\n      identifiers = msa_identifiers.get_identifiers(\n          msa.descriptions[sequence_index])\n      species_ids.append(identifiers.species_id.encode('utf-8'))\n\n  num_res = len(msas[0].sequences[0])\n  num_alignments = len(int_msa)\n  features = {}\n  features['deletion_matrix_int'] = np.array(deletion_matrix, dtype=np.int32)\n  features['msa'] = np.array(int_msa, dtype=np.int32)\n  features['num_alignments'] = np.array(\n      [num_alignments] * num_res, dtype=np.int32)\n  features['msa_species_identifiers'] = np.array(species_ids, dtype=np.object_)\n  return features\n\n\ndef run_msa_tool(msa_runner, input_fasta_path: str, msa_out_path: str,\n                 msa_format: str, use_precomputed_msas: bool,\n                 max_sto_sequences: Optional[int] = None\n                 ) -> Mapping[str, Any]:\n  \"\"\"Runs an MSA tool, checking if output already exists first.\"\"\"\n  if not use_precomputed_msas or not os.path.exists(msa_out_path):\n    if msa_format == 'sto' and max_sto_sequences is not None:\n      result = msa_runner.query(input_fasta_path, max_sto_sequences)[0]  # pytype: disable=wrong-arg-count\n    else:\n      result = msa_runner.query(input_fasta_path)[0]\n    with open(msa_out_path, 'w') as f:\n      f.write(result[msa_format])\n  else:\n    logging.warning('Reading MSA from file %s', msa_out_path)\n    if msa_format == 'sto' and max_sto_sequences is not None:\n      precomputed_msa = parsers.truncate_stockholm_msa(\n          msa_out_path, max_sto_sequences)\n      result = {'sto': precomputed_msa}\n    else:\n      with open(msa_out_path, 'r') as f:\n        result = {msa_format: f.read()}\n  return result\n\n\nclass DataPipeline:\n  \"\"\"Runs the alignment tools and assembles the input features.\"\"\"\n\n  def __init__(self,\n               jackhmmer_binary_path: str,\n               hhblits_binary_path: str,\n               uniref90_database_path: str,\n               mgnify_database_path: str,\n               bfd_database_path: Optional[str],\n               uniref30_database_path: Optional[str],\n               small_bfd_database_path: Optional[str],\n               template_searcher: TemplateSearcher,\n               template_featurizer: templates.TemplateHitFeaturizer,\n               use_small_bfd: bool,\n               mgnify_max_hits: int = 501,\n               uniref_max_hits: int = 10000,\n               use_precomputed_msas: bool = False):\n    \"\"\"Initializes the data pipeline.\"\"\"\n    self._use_small_bfd = use_small_bfd\n    self.jackhmmer_uniref90_runner = jackhmmer.Jackhmmer(\n        binary_path=jackhmmer_binary_path,\n        database_path=uniref90_database_path)\n    if use_small_bfd:\n      self.jackhmmer_small_bfd_runner = jackhmmer.Jackhmmer(\n          binary_path=jackhmmer_binary_path,\n          database_path=small_bfd_database_path)\n    else:\n      self.hhblits_bfd_uniref_runner = hhblits.HHBlits(\n          binary_path=hhblits_binary_path,\n          databases=[bfd_database_path, uniref30_database_path])\n    self.jackhmmer_mgnify_runner = jackhmmer.Jackhmmer(\n        binary_path=jackhmmer_binary_path,\n        database_path=mgnify_database_path)\n    self.template_searcher = template_searcher\n    self.template_featurizer = template_featurizer\n    self.mgnify_max_hits = mgnify_max_hits\n    self.uniref_max_hits = uniref_max_hits\n    self.use_precomputed_msas = use_precomputed_msas\n\n  def process(self, input_fasta_path: str, msa_output_dir: str) -> FeatureDict:\n    \"\"\"Runs alignment tools on the input sequence and creates features.\"\"\"\n    with open(input_fasta_path) as f:\n      input_fasta_str = f.read()\n    input_seqs, input_descs = parsers.parse_fasta(input_fasta_str)\n    if len(input_seqs) != 1:\n      raise ValueError(\n          f'More than one input sequence found in {input_fasta_path}.')\n    input_sequence = input_seqs[0]\n    input_description = input_descs[0]\n    num_res = len(input_sequence)\n\n    uniref90_out_path = os.path.join(msa_output_dir, 'uniref90_hits.sto')\n    jackhmmer_uniref90_result = run_msa_tool(\n        msa_runner=self.jackhmmer_uniref90_runner,\n        input_fasta_path=input_fasta_path,\n        msa_out_path=uniref90_out_path,\n        msa_format='sto',\n        use_precomputed_msas=self.use_precomputed_msas,\n        max_sto_sequences=self.uniref_max_hits)\n    mgnify_out_path = os.path.join(msa_output_dir, 'mgnify_hits.sto')\n    jackhmmer_mgnify_result = run_msa_tool(\n        msa_runner=self.jackhmmer_mgnify_runner,\n        input_fasta_path=input_fasta_path,\n        msa_out_path=mgnify_out_path,\n        msa_format='sto',\n        use_precomputed_msas=self.use_precomputed_msas,\n        max_sto_sequences=self.mgnify_max_hits)\n\n    msa_for_templates = jackhmmer_uniref90_result['sto']\n    msa_for_templates = parsers.deduplicate_stockholm_msa(msa_for_templates)\n    msa_for_templates = parsers.remove_empty_columns_from_stockholm_msa(\n        msa_for_templates)\n\n    if self.template_searcher.input_format == 'sto':\n      pdb_templates_result = self.template_searcher.query(msa_for_templates)\n    elif self.template_searcher.input_format == 'a3m':\n      uniref90_msa_as_a3m = parsers.convert_stockholm_to_a3m(msa_for_templates)\n      pdb_templates_result = self.template_searcher.query(uniref90_msa_as_a3m)\n    else:\n      raise ValueError('Unrecognized template input format: '\n                       f'{self.template_searcher.input_format}')\n\n    pdb_hits_out_path = os.path.join(\n        msa_output_dir, f'pdb_hits.{self.template_searcher.output_format}')\n    with open(pdb_hits_out_path, 'w') as f:\n      f.write(pdb_templates_result)\n\n    uniref90_msa = parsers.parse_stockholm(jackhmmer_uniref90_result['sto'])\n    mgnify_msa = parsers.parse_stockholm(jackhmmer_mgnify_result['sto'])\n\n    pdb_template_hits = self.template_searcher.get_template_hits(\n        output_string=pdb_templates_result, input_sequence=input_sequence)\n\n    if self._use_small_bfd:\n      bfd_out_path = os.path.join(msa_output_dir, 'small_bfd_hits.sto')\n      jackhmmer_small_bfd_result = run_msa_tool(\n          msa_runner=self.jackhmmer_small_bfd_runner,\n          input_fasta_path=input_fasta_path,\n          msa_out_path=bfd_out_path,\n          msa_format='sto',\n          use_precomputed_msas=self.use_precomputed_msas)\n      bfd_msa = parsers.parse_stockholm(jackhmmer_small_bfd_result['sto'])\n    else:\n      bfd_out_path = os.path.join(msa_output_dir, 'bfd_uniref_hits.a3m')\n      hhblits_bfd_uniref_result = run_msa_tool(\n          msa_runner=self.hhblits_bfd_uniref_runner,\n          input_fasta_path=input_fasta_path,\n          msa_out_path=bfd_out_path,\n          msa_format='a3m',\n          use_precomputed_msas=self.use_precomputed_msas)\n      bfd_msa = parsers.parse_a3m(hhblits_bfd_uniref_result['a3m'])\n\n    templates_result = self.template_featurizer.get_templates(\n        query_sequence=input_sequence,\n        hits=pdb_template_hits)\n\n    sequence_features = make_sequence_features(\n        sequence=input_sequence,\n        description=input_description,\n        num_res=num_res)\n\n    msa_features = make_msa_features((uniref90_msa, bfd_msa, mgnify_msa))\n\n    logging.info('Uniref90 MSA size: %d sequences.', len(uniref90_msa))\n    logging.info('BFD MSA size: %d sequences.', len(bfd_msa))\n    logging.info('MGnify MSA size: %d sequences.', len(mgnify_msa))\n    logging.info('Final (deduplicated) MSA size: %d sequences.',\n                 msa_features['num_alignments'][0])\n    logging.info('Total number of templates (NB: this can include bad '\n                 'templates and is later filtered to top 4): %d.',\n                 templates_result.features['template_domain_names'].shape[0])\n\n    return {**sequence_features, **msa_features, **templates_result.features}\n"
  },
  {
    "path": "alphafold/data/pipeline_multimer.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Functions for building the features for the AlphaFold multimer model.\"\"\"\n\nimport collections\nimport contextlib\nimport copy\nimport dataclasses\nimport json\nimport os\nimport tempfile\nfrom typing import Mapping, MutableMapping, Sequence\n\nfrom absl import logging\nfrom alphafold.common import protein\nfrom alphafold.common import residue_constants\nfrom alphafold.data import feature_processing\nfrom alphafold.data import msa_pairing\nfrom alphafold.data import parsers\nfrom alphafold.data import pipeline\nfrom alphafold.data.tools import jackhmmer\nimport numpy as np\n\n# Internal import (7716).\n\n\n@dataclasses.dataclass(frozen=True)\nclass _FastaChain:\n  sequence: str\n  description: str\n\n\ndef _make_chain_id_map(*,\n                       sequences: Sequence[str],\n                       descriptions: Sequence[str],\n                       ) -> Mapping[str, _FastaChain]:\n  \"\"\"Makes a mapping from PDB-format chain ID to sequence and description.\"\"\"\n  if len(sequences) != len(descriptions):\n    raise ValueError('sequences and descriptions must have equal length. '\n                     f'Got {len(sequences)} != {len(descriptions)}.')\n  if len(sequences) > protein.PDB_MAX_CHAINS:\n    raise ValueError('Cannot process more chains than the PDB format supports. '\n                     f'Got {len(sequences)} chains.')\n  chain_id_map = {}\n  for chain_id, sequence, description in zip(\n      protein.PDB_CHAIN_IDS, sequences, descriptions):\n    chain_id_map[chain_id] = _FastaChain(\n        sequence=sequence, description=description)\n  return chain_id_map\n\n\n@contextlib.contextmanager\ndef temp_fasta_file(fasta_str: str):\n  with tempfile.NamedTemporaryFile('w', suffix='.fasta') as fasta_file:\n    fasta_file.write(fasta_str)\n    fasta_file.seek(0)\n    yield fasta_file.name\n\n\ndef convert_monomer_features(\n    monomer_features: pipeline.FeatureDict,\n    chain_id: str) -> pipeline.FeatureDict:\n  \"\"\"Reshapes and modifies monomer features for multimer models.\"\"\"\n  converted = {}\n  converted['auth_chain_id'] = np.asarray(chain_id, dtype=np.object_)\n  unnecessary_leading_dim_feats = {\n      'sequence', 'domain_name', 'num_alignments', 'seq_length'}\n  for feature_name, feature in monomer_features.items():\n    if feature_name in unnecessary_leading_dim_feats:\n      # asarray ensures it's a np.ndarray.\n      feature = np.asarray(feature[0], dtype=feature.dtype)\n    elif feature_name == 'aatype':\n      # The multimer model performs the one-hot operation itself.\n      feature = np.argmax(feature, axis=-1).astype(np.int32)\n    elif feature_name == 'template_aatype':\n      feature = np.argmax(feature, axis=-1).astype(np.int32)\n      new_order_list = residue_constants.MAP_HHBLITS_AATYPE_TO_OUR_AATYPE\n      feature = np.take(new_order_list, feature.astype(np.int32), axis=0)\n    elif feature_name == 'template_all_atom_masks':\n      feature_name = 'template_all_atom_mask'\n    converted[feature_name] = feature\n  return converted\n\n\ndef int_id_to_str_id(num: int) -> str:\n  \"\"\"Encodes a number as a string, using reverse spreadsheet style naming.\n\n  Args:\n    num: A positive integer.\n\n  Returns:\n    A string that encodes the positive integer using reverse spreadsheet style,\n    naming e.g. 1 = A, 2 = B, ..., 27 = AA, 28 = BA, 29 = CA, ... This is the\n    usual way to encode chain IDs in mmCIF files.\n  \"\"\"\n  if num <= 0:\n    raise ValueError(f'Only positive integers allowed, got {num}.')\n\n  num = num - 1  # 1-based indexing.\n  output = []\n  while num >= 0:\n    output.append(chr(num % 26 + ord('A')))\n    num = num // 26 - 1\n  return ''.join(output)\n\n\ndef add_assembly_features(\n    all_chain_features: MutableMapping[str, pipeline.FeatureDict],\n    ) -> MutableMapping[str, pipeline.FeatureDict]:\n  \"\"\"Add features to distinguish between chains.\n\n  Args:\n    all_chain_features: A dictionary which maps chain_id to a dictionary of\n      features for each chain.\n\n  Returns:\n    all_chain_features: A dictionary which maps strings of the form\n      `<seq_id>_<sym_id>` to the corresponding chain features. E.g. two\n      chains from a homodimer would have keys A_1 and A_2. Two chains from a\n      heterodimer would have keys A_1 and B_1.\n  \"\"\"\n  # Group the chains by sequence\n  seq_to_entity_id = {}\n  grouped_chains = collections.defaultdict(list)\n  for chain_id, chain_features in all_chain_features.items():\n    seq = str(chain_features['sequence'])\n    if seq not in seq_to_entity_id:\n      seq_to_entity_id[seq] = len(seq_to_entity_id) + 1\n    grouped_chains[seq_to_entity_id[seq]].append(chain_features)\n\n  new_all_chain_features = {}\n  chain_id = 1\n  for entity_id, group_chain_features in grouped_chains.items():\n    for sym_id, chain_features in enumerate(group_chain_features, start=1):\n      new_all_chain_features[\n          f'{int_id_to_str_id(entity_id)}_{sym_id}'] = chain_features\n      seq_length = chain_features['seq_length']\n      chain_features['asym_id'] = chain_id * np.ones(seq_length)\n      chain_features['sym_id'] = sym_id * np.ones(seq_length)\n      chain_features['entity_id'] = entity_id * np.ones(seq_length)\n      chain_id += 1\n\n  return new_all_chain_features\n\n\ndef pad_msa(np_example, min_num_seq):\n  np_example = dict(np_example)\n  num_seq = np_example['msa'].shape[0]\n  if num_seq < min_num_seq:\n    for feat in ('msa', 'deletion_matrix', 'bert_mask', 'msa_mask'):\n      np_example[feat] = np.pad(\n          np_example[feat], ((0, min_num_seq - num_seq), (0, 0)))\n    np_example['cluster_bias_mask'] = np.pad(\n        np_example['cluster_bias_mask'], ((0, min_num_seq - num_seq),))\n  return np_example\n\n\nclass DataPipeline:\n  \"\"\"Runs the alignment tools and assembles the input features.\"\"\"\n\n  def __init__(self,\n               monomer_data_pipeline: pipeline.DataPipeline,\n               jackhmmer_binary_path: str,\n               uniprot_database_path: str,\n               max_uniprot_hits: int = 50000,\n               use_precomputed_msas: bool = False):\n    \"\"\"Initializes the data pipeline.\n\n    Args:\n      monomer_data_pipeline: An instance of pipeline.DataPipeline - that runs\n        the data pipeline for the monomer AlphaFold system.\n      jackhmmer_binary_path: Location of the jackhmmer binary.\n      uniprot_database_path: Location of the unclustered uniprot sequences, that\n        will be searched with jackhmmer and used for MSA pairing.\n      max_uniprot_hits: The maximum number of hits to return from uniprot.\n      use_precomputed_msas: Whether to use pre-existing MSAs; see run_alphafold.\n    \"\"\"\n    self._monomer_data_pipeline = monomer_data_pipeline\n    self._uniprot_msa_runner = jackhmmer.Jackhmmer(\n        binary_path=jackhmmer_binary_path,\n        database_path=uniprot_database_path)\n    self._max_uniprot_hits = max_uniprot_hits\n    self.use_precomputed_msas = use_precomputed_msas\n\n  def _process_single_chain(\n      self,\n      chain_id: str,\n      sequence: str,\n      description: str,\n      msa_output_dir: str,\n      is_homomer_or_monomer: bool) -> pipeline.FeatureDict:\n    \"\"\"Runs the monomer pipeline on a single chain.\"\"\"\n    chain_fasta_str = f'>chain_{chain_id}\\n{sequence}\\n'\n    chain_msa_output_dir = os.path.join(msa_output_dir, chain_id)\n    if not os.path.exists(chain_msa_output_dir):\n      os.makedirs(chain_msa_output_dir)\n    with temp_fasta_file(chain_fasta_str) as chain_fasta_path:\n      logging.info('Running monomer pipeline on chain %s: %s',\n                   chain_id, description)\n      chain_features = self._monomer_data_pipeline.process(\n          input_fasta_path=chain_fasta_path,\n          msa_output_dir=chain_msa_output_dir)\n\n      # We only construct the pairing features if there are 2 or more unique\n      # sequences.\n      if not is_homomer_or_monomer:\n        all_seq_msa_features = self._all_seq_msa_features(chain_fasta_path,\n                                                          chain_msa_output_dir)\n        chain_features.update(all_seq_msa_features)\n    return chain_features\n\n  def _all_seq_msa_features(self, input_fasta_path, msa_output_dir):\n    \"\"\"Get MSA features for unclustered uniprot, for pairing.\"\"\"\n    out_path = os.path.join(msa_output_dir, 'uniprot_hits.sto')\n    result = pipeline.run_msa_tool(\n        self._uniprot_msa_runner, input_fasta_path, out_path, 'sto',\n        self.use_precomputed_msas)\n    msa = parsers.parse_stockholm(result['sto'])\n    msa = msa.truncate(max_seqs=self._max_uniprot_hits)\n    all_seq_features = pipeline.make_msa_features([msa])\n    valid_feats = msa_pairing.MSA_FEATURES + (\n        'msa_species_identifiers',\n    )\n    feats = {f'{k}_all_seq': v for k, v in all_seq_features.items()\n             if k in valid_feats}\n    return feats\n\n  def process(self,\n              input_fasta_path: str,\n              msa_output_dir: str) -> pipeline.FeatureDict:\n    \"\"\"Runs alignment tools on the input sequences and creates features.\"\"\"\n    with open(input_fasta_path) as f:\n      input_fasta_str = f.read()\n    input_seqs, input_descs = parsers.parse_fasta(input_fasta_str)\n\n    chain_id_map = _make_chain_id_map(sequences=input_seqs,\n                                      descriptions=input_descs)\n    chain_id_map_path = os.path.join(msa_output_dir, 'chain_id_map.json')\n    with open(chain_id_map_path, 'w') as f:\n      chain_id_map_dict = {chain_id: dataclasses.asdict(fasta_chain)\n                           for chain_id, fasta_chain in chain_id_map.items()}\n      json.dump(chain_id_map_dict, f, indent=4, sort_keys=True)\n\n    all_chain_features = {}\n    sequence_features = {}\n    is_homomer_or_monomer = len(set(input_seqs)) == 1\n    for chain_id, fasta_chain in chain_id_map.items():\n      if fasta_chain.sequence in sequence_features:\n        all_chain_features[chain_id] = copy.deepcopy(\n            sequence_features[fasta_chain.sequence])\n        continue\n      chain_features = self._process_single_chain(\n          chain_id=chain_id,\n          sequence=fasta_chain.sequence,\n          description=fasta_chain.description,\n          msa_output_dir=msa_output_dir,\n          is_homomer_or_monomer=is_homomer_or_monomer)\n\n      chain_features = convert_monomer_features(chain_features,\n                                                chain_id=chain_id)\n      all_chain_features[chain_id] = chain_features\n      sequence_features[fasta_chain.sequence] = chain_features\n\n    all_chain_features = add_assembly_features(all_chain_features)\n\n    np_example = feature_processing.pair_and_merge(\n        all_chain_features=all_chain_features)\n\n    # Pad MSA to avoid zero-sized extra_msa.\n    np_example = pad_msa(np_example, 512)\n\n    return np_example\n"
  },
  {
    "path": "alphafold/data/templates.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Functions for getting templates and calculating template features.\"\"\"\nimport abc\nimport dataclasses\nimport datetime\nimport functools\nimport glob\nimport os\nimport re\nfrom typing import Any, Dict, Mapping, Optional, Sequence, Tuple\n\nfrom absl import logging\nfrom alphafold.common import residue_constants\nfrom alphafold.data import mmcif_parsing\nfrom alphafold.data import parsers\nfrom alphafold.data.tools import kalign\nimport numpy as np\n\n# Internal import (7716).\n\n\nclass Error(Exception):\n  \"\"\"Base class for exceptions.\"\"\"\n\n\nclass NoChainsError(Error):\n  \"\"\"An error indicating that template mmCIF didn't have any chains.\"\"\"\n\n\nclass SequenceNotInTemplateError(Error):\n  \"\"\"An error indicating that template mmCIF didn't contain the sequence.\"\"\"\n\n\nclass NoAtomDataInTemplateError(Error):\n  \"\"\"An error indicating that template mmCIF didn't contain atom positions.\"\"\"\n\n\nclass TemplateAtomMaskAllZerosError(Error):\n  \"\"\"An error indicating that template mmCIF had all atom positions masked.\"\"\"\n\n\nclass QueryToTemplateAlignError(Error):\n  \"\"\"An error indicating that the query can't be aligned to the template.\"\"\"\n\n\nclass CaDistanceError(Error):\n  \"\"\"An error indicating that a CA atom distance exceeds a threshold.\"\"\"\n\n\nclass MultipleChainsError(Error):\n  \"\"\"An error indicating that multiple chains were found for a given ID.\"\"\"\n\n\n# Prefilter exceptions.\nclass PrefilterError(Exception):\n  \"\"\"A base class for template prefilter exceptions.\"\"\"\n\n\nclass DateError(PrefilterError):\n  \"\"\"An error indicating that the hit date was after the max allowed date.\"\"\"\n\n\nclass AlignRatioError(PrefilterError):\n  \"\"\"An error indicating that the hit align ratio to the query was too small.\"\"\"\n\n\nclass DuplicateError(PrefilterError):\n  \"\"\"An error indicating that the hit was an exact subsequence of the query.\"\"\"\n\n\nclass LengthError(PrefilterError):\n  \"\"\"An error indicating that the hit was too short.\"\"\"\n\n\nTEMPLATE_FEATURES = {\n    'template_aatype': np.float32,\n    'template_all_atom_masks': np.float32,\n    'template_all_atom_positions': np.float32,\n    'template_domain_names': object,\n    'template_sequence': object,\n    'template_sum_probs': np.float32,\n}\n\n\ndef _get_pdb_id_and_chain(hit: parsers.TemplateHit) -> Tuple[str, str]:\n  \"\"\"Returns PDB id and chain id for an HHSearch Hit.\"\"\"\n  # PDB ID: 4 letters. Chain ID: 1+ alphanumeric letters or \".\" if unknown.\n  id_match = re.match(r'[a-zA-Z\\d]{4}_[a-zA-Z0-9.]+', hit.name)\n  if not id_match:\n    raise ValueError(f'hit.name did not start with PDBID_chain: {hit.name}')\n  pdb_id, chain_id = id_match.group(0).split('_')\n  return pdb_id.lower(), chain_id\n\n\ndef _is_after_cutoff(\n    pdb_id: str,\n    release_dates: Mapping[str, datetime.datetime],\n    release_date_cutoff: Optional[datetime.datetime]) -> bool:\n  \"\"\"Checks if the template date is after the release date cutoff.\n\n  Args:\n    pdb_id: 4 letter pdb code.\n    release_dates: Dictionary mapping PDB ids to their structure release dates.\n    release_date_cutoff: Max release date that is valid for this query.\n\n  Returns:\n    True if the template release date is after the cutoff, False otherwise.\n  \"\"\"\n  if release_date_cutoff is None:\n    raise ValueError('The release_date_cutoff must not be None.')\n  if pdb_id in release_dates:\n    return release_dates[pdb_id] > release_date_cutoff\n  else:\n    # Since this is just a quick prefilter to reduce the number of mmCIF files\n    # we need to parse, we don't have to worry about returning True here.\n    return False\n\n\ndef _parse_obsolete(obsolete_file_path: str) -> Mapping[str, Optional[str]]:\n  \"\"\"Parses the data file from PDB that lists which pdb_ids are obsolete.\"\"\"\n  with open(obsolete_file_path) as f:\n    result = {}\n    for line in f:\n      line = line.strip()\n      # Format:    Date      From     To\n      # 'OBSLTE    06-NOV-19 6G9Y'                - Removed, rare\n      # 'OBSLTE    31-JUL-94 116L     216L'       - Replaced, common\n      # 'OBSLTE    26-SEP-06 2H33     2JM5 2OWI'  - Replaced by multiple, rare\n      if line.startswith('OBSLTE'):\n        if len(line) > 30:\n          # Replaced by at least one structure.\n          from_id = line[20:24].lower()\n          to_id = line[29:33].lower()\n          result[from_id] = to_id\n        elif len(line) == 24:\n          # Removed.\n          from_id = line[20:24].lower()\n          result[from_id] = None\n    return result\n\n\ndef _parse_release_dates(path: str) -> Mapping[str, datetime.datetime]:\n  \"\"\"Parses release dates file, returns a mapping from PDBs to release dates.\"\"\"\n  if path.endswith('txt'):\n    release_dates = {}\n    with open(path, 'r') as f:\n      for line in f:\n        pdb_id, date = line.split(':')\n        date = date.strip()\n        # Python 3.6 doesn't have datetime.date.fromisoformat() which is about\n        # 90x faster than strptime. However, splitting the string manually is\n        # about 10x faster than strptime.\n        release_dates[pdb_id.strip()] = datetime.datetime(\n            year=int(date[:4]), month=int(date[5:7]), day=int(date[8:10]))\n    return release_dates\n  else:\n    raise ValueError('Invalid format of the release date file %s.' % path)\n\n\ndef _assess_hhsearch_hit(\n    hit: parsers.TemplateHit,\n    hit_pdb_code: str,\n    query_sequence: str,\n    release_dates: Mapping[str, datetime.datetime],\n    release_date_cutoff: datetime.datetime,\n    max_subsequence_ratio: float = 0.95,\n    min_align_ratio: float = 0.1) -> bool:\n  \"\"\"Determines if template is valid (without parsing the template mmcif file).\n\n  Args:\n    hit: HhrHit for the template.\n    hit_pdb_code: The 4 letter pdb code of the template hit. This might be\n      different from the value in the actual hit since the original pdb might\n      have become obsolete.\n    query_sequence: Amino acid sequence of the query.\n    release_dates: Dictionary mapping pdb codes to their structure release\n      dates.\n    release_date_cutoff: Max release date that is valid for this query.\n    max_subsequence_ratio: Exclude any exact matches with this much overlap.\n    min_align_ratio: Minimum overlap between the template and query.\n\n  Returns:\n    True if the hit passed the prefilter. Raises an exception otherwise.\n\n  Raises:\n    DateError: If the hit date was after the max allowed date.\n    AlignRatioError: If the hit align ratio to the query was too small.\n    DuplicateError: If the hit was an exact subsequence of the query.\n    LengthError: If the hit was too short.\n  \"\"\"\n  aligned_cols = hit.aligned_cols\n  align_ratio = aligned_cols / len(query_sequence)\n\n  template_sequence = hit.hit_sequence.replace('-', '')\n  length_ratio = float(len(template_sequence)) / len(query_sequence)\n\n  # Check whether the template is a large subsequence or duplicate of original\n  # query. This can happen due to duplicate entries in the PDB database.\n  duplicate = (template_sequence in query_sequence and\n               length_ratio > max_subsequence_ratio)\n\n  if _is_after_cutoff(hit_pdb_code, release_dates, release_date_cutoff):\n    raise DateError(f'Date ({release_dates[hit_pdb_code]}) > max template date '\n                    f'({release_date_cutoff}).')\n\n  if align_ratio <= min_align_ratio:\n    raise AlignRatioError('Proportion of residues aligned to query too small. '\n                          f'Align ratio: {align_ratio}.')\n\n  if duplicate:\n    raise DuplicateError('Template is an exact subsequence of query with large '\n                         f'coverage. Length ratio: {length_ratio}.')\n\n  if len(template_sequence) < 10:\n    raise LengthError(f'Template too short. Length: {len(template_sequence)}.')\n\n  return True\n\n\ndef _find_template_in_pdb(\n    template_chain_id: str,\n    template_sequence: str,\n    mmcif_object: mmcif_parsing.MmcifObject) -> Tuple[str, str, int]:\n  \"\"\"Tries to find the template chain in the given pdb file.\n\n  This method tries the three following things in order:\n    1. Tries if there is an exact match in both the chain ID and the sequence.\n       If yes, the chain sequence is returned. Otherwise:\n    2. Tries if there is an exact match only in the sequence.\n       If yes, the chain sequence is returned. Otherwise:\n    3. Tries if there is a fuzzy match (X = wildcard) in the sequence.\n       If yes, the chain sequence is returned.\n  If none of these succeed, a SequenceNotInTemplateError is thrown.\n\n  Args:\n    template_chain_id: The template chain ID.\n    template_sequence: The template chain sequence.\n    mmcif_object: The PDB object to search for the template in.\n\n  Returns:\n    A tuple with:\n    * The chain sequence that was found to match the template in the PDB object.\n    * The ID of the chain that is being returned.\n    * The offset where the template sequence starts in the chain sequence.\n\n  Raises:\n    SequenceNotInTemplateError: If no match is found after the steps described\n      above.\n  \"\"\"\n  # Try if there is an exact match in both the chain ID and the (sub)sequence.\n  pdb_id = mmcif_object.file_id\n  chain_sequence = mmcif_object.chain_to_seqres.get(template_chain_id)\n  if chain_sequence and (template_sequence in chain_sequence):\n    logging.info(\n        'Found an exact template match %s_%s.', pdb_id, template_chain_id)\n    mapping_offset = chain_sequence.find(template_sequence)\n    return chain_sequence, template_chain_id, mapping_offset\n\n  # Try if there is an exact match in the (sub)sequence only.\n  for chain_id, chain_sequence in mmcif_object.chain_to_seqres.items():\n    if chain_sequence and (template_sequence in chain_sequence):\n      logging.info('Found a sequence-only match %s_%s.', pdb_id, chain_id)\n      mapping_offset = chain_sequence.find(template_sequence)\n      return chain_sequence, chain_id, mapping_offset\n\n  # Return a chain sequence that fuzzy matches (X = wildcard) the template.\n  # Make parentheses unnamed groups (?:_) to avoid the 100 named groups limit.\n  regex = ['.' if aa == 'X' else '(?:%s|X)' % aa for aa in template_sequence]\n  regex = re.compile(''.join(regex))\n  for chain_id, chain_sequence in mmcif_object.chain_to_seqres.items():\n    match = re.search(regex, chain_sequence)\n    if match:\n      logging.info('Found a fuzzy sequence-only match %s_%s.', pdb_id, chain_id)\n      mapping_offset = match.start()\n      return chain_sequence, chain_id, mapping_offset\n\n  # No hits, raise an error.\n  raise SequenceNotInTemplateError(\n      'Could not find the template sequence in %s_%s. Template sequence: %s, '\n      'chain_to_seqres: %s' % (pdb_id, template_chain_id, template_sequence,\n                               mmcif_object.chain_to_seqres))\n\n\ndef _realign_pdb_template_to_query(\n    old_template_sequence: str,\n    template_chain_id: str,\n    mmcif_object: mmcif_parsing.MmcifObject,\n    old_mapping: Mapping[int, int],\n    kalign_binary_path: str) -> Tuple[str, Mapping[int, int]]:\n  \"\"\"Aligns template from the mmcif_object to the query.\n\n  In case PDB70 contains a different version of the template sequence, we need\n  to perform a realignment to the actual sequence that is in the mmCIF file.\n  This method performs such realignment, but returns the new sequence and\n  mapping only if the sequence in the mmCIF file is 90% identical to the old\n  sequence.\n\n  Note that the old_template_sequence comes from the hit, and contains only that\n  part of the chain that matches with the query while the new_template_sequence\n  is the full chain.\n\n  Args:\n    old_template_sequence: The template sequence that was returned by the PDB\n      template search (typically done using HHSearch).\n    template_chain_id: The template chain id was returned by the PDB template\n      search (typically done using HHSearch). This is used to find the right\n      chain in the mmcif_object chain_to_seqres mapping.\n    mmcif_object: A mmcif_object which holds the actual template data.\n    old_mapping: A mapping from the query sequence to the template sequence.\n      This mapping will be used to compute the new mapping from the query\n      sequence to the actual mmcif_object template sequence by aligning the\n      old_template_sequence and the actual template sequence.\n    kalign_binary_path: The path to a kalign executable.\n\n  Returns:\n    A tuple (new_template_sequence, new_query_to_template_mapping) where:\n    * new_template_sequence is the actual template sequence that was found in\n      the mmcif_object.\n    * new_query_to_template_mapping is the new mapping from the query to the\n      actual template found in the mmcif_object.\n\n  Raises:\n    QueryToTemplateAlignError:\n    * If there was an error thrown by the alignment tool.\n    * Or if the actual template sequence differs by more than 10% from the\n      old_template_sequence.\n  \"\"\"\n  aligner = kalign.Kalign(binary_path=kalign_binary_path)\n  new_template_sequence = mmcif_object.chain_to_seqres.get(\n      template_chain_id, '')\n\n  # Sometimes the template chain id is unknown. But if there is only a single\n  # sequence within the mmcif_object, it is safe to assume it is that one.\n  if not new_template_sequence:\n    if len(mmcif_object.chain_to_seqres) == 1:\n      logging.info('Could not find %s in %s, but there is only 1 sequence, so '\n                   'using that one.',\n                   template_chain_id,\n                   mmcif_object.file_id)\n      new_template_sequence = list(mmcif_object.chain_to_seqres.values())[0]\n    else:\n      raise QueryToTemplateAlignError(\n          f'Could not find chain {template_chain_id} in {mmcif_object.file_id}. '\n          'If there are no mmCIF parsing errors, it is possible it was not a '\n          'protein chain.')\n\n  try:\n    parsed_a3m = parsers.parse_a3m(\n        aligner.align([old_template_sequence, new_template_sequence]))\n    old_aligned_template, new_aligned_template = parsed_a3m.sequences\n  except Exception as e:\n    raise QueryToTemplateAlignError(\n        'Could not align old template %s to template %s (%s_%s). Error: %s' %\n        (old_template_sequence, new_template_sequence, mmcif_object.file_id,\n         template_chain_id, str(e)))\n\n  logging.info('Old aligned template: %s\\nNew aligned template: %s',\n               old_aligned_template, new_aligned_template)\n\n  old_to_new_template_mapping = {}\n  old_template_index = -1\n  new_template_index = -1\n  num_same = 0\n  for old_template_aa, new_template_aa in zip(\n      old_aligned_template, new_aligned_template):\n    if old_template_aa != '-':\n      old_template_index += 1\n    if new_template_aa != '-':\n      new_template_index += 1\n    if old_template_aa != '-' and new_template_aa != '-':\n      old_to_new_template_mapping[old_template_index] = new_template_index\n      if old_template_aa == new_template_aa:\n        num_same += 1\n\n  # Require at least 90 % sequence identity wrt to the shorter of the sequences.\n  if float(num_same) / min(\n      len(old_template_sequence), len(new_template_sequence)) < 0.9:\n    raise QueryToTemplateAlignError(\n        'Insufficient similarity of the sequence in the database: %s to the '\n        'actual sequence in the mmCIF file %s_%s: %s. We require at least '\n        '90 %% similarity wrt to the shorter of the sequences. This is not a '\n        'problem unless you think this is a template that should be included.' %\n        (old_template_sequence, mmcif_object.file_id, template_chain_id,\n         new_template_sequence))\n\n  new_query_to_template_mapping = {}\n  for query_index, old_template_index in old_mapping.items():\n    new_query_to_template_mapping[query_index] = (\n        old_to_new_template_mapping.get(old_template_index, -1))\n\n  new_template_sequence = new_template_sequence.replace('-', '')\n\n  return new_template_sequence, new_query_to_template_mapping\n\n\ndef _check_residue_distances(all_positions: np.ndarray,\n                             all_positions_mask: np.ndarray,\n                             max_ca_ca_distance: float):\n  \"\"\"Checks if the distance between unmasked neighbor residues is ok.\"\"\"\n  ca_position = residue_constants.atom_order['CA']\n  prev_is_unmasked = False\n  prev_calpha = None\n  for i, (coords, mask) in enumerate(zip(all_positions, all_positions_mask)):\n    this_is_unmasked = bool(mask[ca_position])\n    if this_is_unmasked:\n      this_calpha = coords[ca_position]\n      if prev_is_unmasked:\n        distance = np.linalg.norm(this_calpha - prev_calpha)\n        if distance > max_ca_ca_distance:\n          raise CaDistanceError(\n              'The distance between residues %d and %d is %f > limit %f.' % (\n                  i, i + 1, distance, max_ca_ca_distance))\n      prev_calpha = this_calpha\n    prev_is_unmasked = this_is_unmasked\n\n\ndef _get_atom_positions(\n    mmcif_object: mmcif_parsing.MmcifObject,\n    auth_chain_id: str,\n    max_ca_ca_distance: float) -> Tuple[np.ndarray, np.ndarray]:\n  \"\"\"Gets atom positions and mask from a list of Biopython Residues.\"\"\"\n  num_res = len(mmcif_object.chain_to_seqres[auth_chain_id])\n\n  relevant_chains = [c for c in mmcif_object.structure.get_chains()\n                     if c.id == auth_chain_id]\n  if len(relevant_chains) != 1:\n    raise MultipleChainsError(\n        f'Expected exactly one chain in structure with id {auth_chain_id}.')\n  chain = relevant_chains[0]\n\n  all_positions = np.zeros([num_res, residue_constants.atom_type_num, 3])\n  all_positions_mask = np.zeros([num_res, residue_constants.atom_type_num],\n                                dtype=np.int64)\n  for res_index in range(num_res):\n    pos = np.zeros([residue_constants.atom_type_num, 3], dtype=np.float32)\n    mask = np.zeros([residue_constants.atom_type_num], dtype=np.float32)\n    res_at_position = mmcif_object.seqres_to_structure[auth_chain_id][res_index]\n    if not res_at_position.is_missing:\n      res = chain[(res_at_position.hetflag,\n                   res_at_position.position.residue_number,\n                   res_at_position.position.insertion_code)]\n      for atom in res.get_atoms():\n        atom_name = atom.get_name()\n        x, y, z = atom.get_coord()\n        if atom_name in residue_constants.atom_order.keys():\n          pos[residue_constants.atom_order[atom_name]] = [x, y, z]\n          mask[residue_constants.atom_order[atom_name]] = 1.0\n        elif atom_name.upper() == 'SE' and res.get_resname() == 'MSE':\n          # Put the coordinates of the selenium atom in the sulphur column.\n          pos[residue_constants.atom_order['SD']] = [x, y, z]\n          mask[residue_constants.atom_order['SD']] = 1.0\n\n      # Fix naming errors in arginine residues where NH2 is incorrectly\n      # assigned to be closer to CD than NH1.\n      cd = residue_constants.atom_order['CD']\n      nh1 = residue_constants.atom_order['NH1']\n      nh2 = residue_constants.atom_order['NH2']\n      if (res.get_resname() == 'ARG' and\n          all(mask[atom_index] for atom_index in (cd, nh1, nh2)) and\n          (np.linalg.norm(pos[nh1] - pos[cd]) >\n           np.linalg.norm(pos[nh2] - pos[cd]))):\n        pos[nh1], pos[nh2] = pos[nh2].copy(), pos[nh1].copy()\n        mask[nh1], mask[nh2] = mask[nh2].copy(), mask[nh1].copy()\n\n    all_positions[res_index] = pos\n    all_positions_mask[res_index] = mask\n  _check_residue_distances(\n      all_positions, all_positions_mask, max_ca_ca_distance)\n  return all_positions, all_positions_mask\n\n\ndef _extract_template_features(\n    mmcif_object: mmcif_parsing.MmcifObject,\n    pdb_id: str,\n    mapping: Mapping[int, int],\n    template_sequence: str,\n    query_sequence: str,\n    template_chain_id: str,\n    kalign_binary_path: str) -> Tuple[Dict[str, Any], Optional[str]]:\n  \"\"\"Parses atom positions in the target structure and aligns with the query.\n\n  Atoms for each residue in the template structure are indexed to coincide\n  with their corresponding residue in the query sequence, according to the\n  alignment mapping provided.\n\n  Args:\n    mmcif_object: mmcif_parsing.MmcifObject representing the template.\n    pdb_id: PDB code for the template.\n    mapping: Dictionary mapping indices in the query sequence to indices in\n      the template sequence.\n    template_sequence: String describing the amino acid sequence for the\n      template protein.\n    query_sequence: String describing the amino acid sequence for the query\n      protein.\n    template_chain_id: String ID describing which chain in the structure proto\n      should be used.\n    kalign_binary_path: The path to a kalign executable used for template\n        realignment.\n\n  Returns:\n    A tuple with:\n    * A dictionary containing the extra features derived from the template\n      protein structure.\n    * A warning message if the hit was realigned to the actual mmCIF sequence.\n      Otherwise None.\n\n  Raises:\n    NoChainsError: If the mmcif object doesn't contain any chains.\n    SequenceNotInTemplateError: If the given chain id / sequence can't\n      be found in the mmcif object.\n    QueryToTemplateAlignError: If the actual template in the mmCIF file\n      can't be aligned to the query.\n    NoAtomDataInTemplateError: If the mmcif object doesn't contain\n      atom positions.\n    TemplateAtomMaskAllZerosError: If the mmcif object doesn't have any\n      unmasked residues.\n  \"\"\"\n  if mmcif_object is None or not mmcif_object.chain_to_seqres:\n    raise NoChainsError('No chains in PDB: %s_%s' % (pdb_id, template_chain_id))\n\n  warning = None\n  try:\n    seqres, chain_id, mapping_offset = _find_template_in_pdb(\n        template_chain_id=template_chain_id,\n        template_sequence=template_sequence,\n        mmcif_object=mmcif_object)\n  except SequenceNotInTemplateError:\n    # If PDB70 contains a different version of the template, we use the sequence\n    # from the mmcif_object.\n    chain_id = template_chain_id\n    warning = (\n        f'The exact sequence {template_sequence} was not found in '\n        f'{pdb_id}_{chain_id}. Realigning the template to the actual sequence.')\n    logging.warning(warning)\n    # This throws an exception if it fails to realign the hit.\n    seqres, mapping = _realign_pdb_template_to_query(\n        old_template_sequence=template_sequence,\n        template_chain_id=template_chain_id,\n        mmcif_object=mmcif_object,\n        old_mapping=mapping,\n        kalign_binary_path=kalign_binary_path)\n    logging.info('Sequence in %s_%s: %s successfully realigned to %s',\n                 pdb_id, chain_id, template_sequence, seqres)\n    # The template sequence changed.\n    template_sequence = seqres\n    # No mapping offset, the query is aligned to the actual sequence.\n    mapping_offset = 0\n\n  try:\n    # Essentially set to infinity - we don't want to reject templates unless\n    # they're really really bad.\n    all_atom_positions, all_atom_mask = _get_atom_positions(\n        mmcif_object, chain_id, max_ca_ca_distance=150.0)\n  except (CaDistanceError, KeyError) as ex:\n    raise NoAtomDataInTemplateError(\n        'Could not get atom data (%s_%s): %s' % (pdb_id, chain_id, str(ex))\n        ) from ex\n\n  all_atom_positions = np.split(all_atom_positions, all_atom_positions.shape[0])\n  all_atom_masks = np.split(all_atom_mask, all_atom_mask.shape[0])\n\n  output_templates_sequence = []\n  templates_all_atom_positions = []\n  templates_all_atom_masks = []\n\n  for _ in query_sequence:\n    # Residues in the query_sequence that are not in the template_sequence:\n    templates_all_atom_positions.append(\n        np.zeros((residue_constants.atom_type_num, 3)))\n    templates_all_atom_masks.append(np.zeros(residue_constants.atom_type_num))\n    output_templates_sequence.append('-')\n\n  for k, v in mapping.items():\n    template_index = v + mapping_offset\n    templates_all_atom_positions[k] = all_atom_positions[template_index][0]\n    templates_all_atom_masks[k] = all_atom_masks[template_index][0]\n    output_templates_sequence[k] = template_sequence[v]\n\n  # Alanine (AA with the lowest number of atoms) has 5 atoms (C, CA, CB, N, O).\n  if np.sum(templates_all_atom_masks) < 5:\n    raise TemplateAtomMaskAllZerosError(\n        'Template all atom mask was all zeros: %s_%s. Residue range: %d-%d' %\n        (pdb_id, chain_id, min(mapping.values()) + mapping_offset,\n         max(mapping.values()) + mapping_offset))\n\n  output_templates_sequence = ''.join(output_templates_sequence)\n\n  templates_aatype = residue_constants.sequence_to_onehot(\n      output_templates_sequence, residue_constants.HHBLITS_AA_TO_ID)\n\n  return (\n      {\n          'template_all_atom_positions': np.array(templates_all_atom_positions),\n          'template_all_atom_masks': np.array(templates_all_atom_masks),\n          'template_sequence': output_templates_sequence.encode(),\n          'template_aatype': np.array(templates_aatype),\n          'template_domain_names': f'{pdb_id.lower()}_{chain_id}'.encode(),\n      },\n      warning)\n\n\ndef _build_query_to_hit_index_mapping(\n    hit_query_sequence: str,\n    hit_sequence: str,\n    indices_hit: Sequence[int],\n    indices_query: Sequence[int],\n    original_query_sequence: str) -> Mapping[int, int]:\n  \"\"\"Gets mapping from indices in original query sequence to indices in the hit.\n\n  hit_query_sequence and hit_sequence are two aligned sequences containing gap\n  characters. hit_query_sequence contains only the part of the original query\n  sequence that matched the hit. When interpreting the indices from the .hhr, we\n  need to correct for this to recover a mapping from original query sequence to\n  the hit sequence.\n\n  Args:\n    hit_query_sequence: The portion of the query sequence that is in the .hhr\n      hit\n    hit_sequence: The portion of the hit sequence that is in the .hhr\n    indices_hit: The indices for each aminoacid relative to the hit sequence\n    indices_query: The indices for each aminoacid relative to the original query\n      sequence\n    original_query_sequence: String describing the original query sequence.\n\n  Returns:\n    Dictionary with indices in the original query sequence as keys and indices\n    in the hit sequence as values.\n  \"\"\"\n  # If the hit is empty (no aligned residues), return empty mapping\n  if not hit_query_sequence:\n    return {}\n\n  # Remove gaps and find the offset of hit.query relative to original query.\n  hhsearch_query_sequence = hit_query_sequence.replace('-', '')\n  hit_sequence = hit_sequence.replace('-', '')\n  hhsearch_query_offset = original_query_sequence.find(hhsearch_query_sequence)\n\n  # Index of -1 used for gap characters. Subtract the min index ignoring gaps.\n  min_idx = min(x for x in indices_hit if x > -1)\n  fixed_indices_hit = [\n      x - min_idx if x > -1 else -1 for x in indices_hit\n  ]\n\n  min_idx = min(x for x in indices_query if x > -1)\n  fixed_indices_query = [x - min_idx if x > -1 else -1 for x in indices_query]\n\n  # Zip the corrected indices, ignore case where both seqs have gap characters.\n  mapping = {}\n  for q_i, q_t in zip(fixed_indices_query, fixed_indices_hit):\n    if q_t != -1 and q_i != -1:\n      if (q_t >= len(hit_sequence) or\n          q_i + hhsearch_query_offset >= len(original_query_sequence)):\n        continue\n      mapping[q_i + hhsearch_query_offset] = q_t\n\n  return mapping\n\n\n@dataclasses.dataclass(frozen=True)\nclass SingleHitResult:\n  features: Optional[Mapping[str, Any]]\n  error: Optional[str]\n  warning: Optional[str]\n\n\n@functools.lru_cache(16, typed=False)\ndef _read_file(path):\n  with open(path, 'r') as f:\n    file_data = f.read()\n  return file_data\n\n\ndef _process_single_hit(\n    query_sequence: str,\n    hit: parsers.TemplateHit,\n    mmcif_dir: str,\n    max_template_date: datetime.datetime,\n    release_dates: Mapping[str, datetime.datetime],\n    obsolete_pdbs: Mapping[str, Optional[str]],\n    kalign_binary_path: str,\n    strict_error_check: bool = False) -> SingleHitResult:\n  \"\"\"Tries to extract template features from a single HHSearch hit.\"\"\"\n  # Fail hard if we can't get the PDB ID and chain name from the hit.\n  hit_pdb_code, hit_chain_id = _get_pdb_id_and_chain(hit)\n\n  # This hit has been removed (obsoleted) from PDB, skip it.\n  if hit_pdb_code in obsolete_pdbs and obsolete_pdbs[hit_pdb_code] is None:\n    return SingleHitResult(\n        features=None, error=None, warning=f'Hit {hit_pdb_code} is obsolete.')\n\n  if hit_pdb_code not in release_dates:\n    if hit_pdb_code in obsolete_pdbs:\n      hit_pdb_code = obsolete_pdbs[hit_pdb_code]\n\n  # Pass hit_pdb_code since it might have changed due to the pdb being obsolete.\n  try:\n    _assess_hhsearch_hit(\n        hit=hit,\n        hit_pdb_code=hit_pdb_code,\n        query_sequence=query_sequence,\n        release_dates=release_dates,\n        release_date_cutoff=max_template_date)\n  except PrefilterError as e:\n    msg = f'hit {hit_pdb_code}_{hit_chain_id} did not pass prefilter: {str(e)}'\n    logging.info(msg)\n    if strict_error_check and isinstance(e, (DateError, DuplicateError)):\n      # In strict mode we treat some prefilter cases as errors.\n      return SingleHitResult(features=None, error=msg, warning=None)\n\n    return SingleHitResult(features=None, error=None, warning=None)\n\n  mapping = _build_query_to_hit_index_mapping(\n      hit.query, hit.hit_sequence, hit.indices_hit, hit.indices_query,\n      query_sequence)\n\n  # The mapping is from the query to the actual hit sequence, so we need to\n  # remove gaps (which regardless have a missing confidence score).\n  template_sequence = hit.hit_sequence.replace('-', '')\n\n  cif_path = os.path.join(mmcif_dir, hit_pdb_code + '.cif')\n  logging.debug('Reading PDB entry from %s. Query: %s, template: %s', cif_path,\n                query_sequence, template_sequence)\n  # Fail if we can't find the mmCIF file.\n  cif_string = _read_file(cif_path)\n\n  parsing_result = mmcif_parsing.parse(\n      file_id=hit_pdb_code, mmcif_string=cif_string)\n\n  if parsing_result.mmcif_object is not None:\n    hit_release_date = datetime.datetime.strptime(\n        parsing_result.mmcif_object.header['release_date'], '%Y-%m-%d')\n    if hit_release_date > max_template_date:\n      error = ('Template %s date (%s) > max template date (%s).' %\n               (hit_pdb_code, hit_release_date, max_template_date))\n      if strict_error_check:\n        return SingleHitResult(features=None, error=error, warning=None)\n      else:\n        logging.debug(error)\n        return SingleHitResult(features=None, error=None, warning=None)\n\n  try:\n    features, realign_warning = _extract_template_features(\n        mmcif_object=parsing_result.mmcif_object,\n        pdb_id=hit_pdb_code,\n        mapping=mapping,\n        template_sequence=template_sequence,\n        query_sequence=query_sequence,\n        template_chain_id=hit_chain_id,\n        kalign_binary_path=kalign_binary_path)\n    if hit.sum_probs is None:\n      features['template_sum_probs'] = [0]\n    else:\n      features['template_sum_probs'] = [hit.sum_probs]\n\n    # It is possible there were some errors when parsing the other chains in the\n    # mmCIF file, but the template features for the chain we want were still\n    # computed. In such case the mmCIF parsing errors are not relevant.\n    return SingleHitResult(\n        features=features, error=None, warning=realign_warning)\n  except (NoChainsError, NoAtomDataInTemplateError,\n          TemplateAtomMaskAllZerosError) as e:\n    # These 3 errors indicate missing mmCIF experimental data rather than a\n    # problem with the template search, so turn them into warnings.\n    warning = ('%s_%s (sum_probs: %s, rank: %s): feature extracting errors: '\n               '%s, mmCIF parsing errors: %s'\n               % (hit_pdb_code, hit_chain_id, hit.sum_probs, hit.index,\n                  str(e), parsing_result.errors))\n    if strict_error_check:\n      return SingleHitResult(features=None, error=warning, warning=None)\n    else:\n      return SingleHitResult(features=None, error=None, warning=warning)\n  except Error as e:\n    error = ('%s_%s (sum_probs: %.2f, rank: %d): feature extracting errors: '\n             '%s, mmCIF parsing errors: %s'\n             % (hit_pdb_code, hit_chain_id, hit.sum_probs, hit.index,\n                str(e), parsing_result.errors))\n    return SingleHitResult(features=None, error=error, warning=None)\n\n\n@dataclasses.dataclass(frozen=True)\nclass TemplateSearchResult:\n  features: Mapping[str, Any]\n  errors: Sequence[str]\n  warnings: Sequence[str]\n\n\nclass TemplateHitFeaturizer(abc.ABC):\n  \"\"\"An abstract base class for turning template hits to template features.\"\"\"\n\n  def __init__(\n      self,\n      mmcif_dir: str,\n      max_template_date: str,\n      max_hits: int,\n      kalign_binary_path: str,\n      release_dates_path: Optional[str],\n      obsolete_pdbs_path: Optional[str],\n      strict_error_check: bool = False):\n    \"\"\"Initializes the Template Search.\n\n    Args:\n      mmcif_dir: Path to a directory with mmCIF structures. Once a template ID\n        is found by HHSearch, this directory is used to retrieve the template\n        data.\n      max_template_date: The maximum date permitted for template structures. No\n        template with date higher than this date will be returned. In ISO8601\n        date format, YYYY-MM-DD.\n      max_hits: The maximum number of templates that will be returned.\n      kalign_binary_path: The path to a kalign executable used for template\n        realignment.\n      release_dates_path: An optional path to a file with a mapping from PDB IDs\n        to their release dates. Thanks to this we don't have to redundantly\n        parse mmCIF files to get that information.\n      obsolete_pdbs_path: An optional path to a file containing a mapping from\n        obsolete PDB IDs to the PDB IDs of their replacements.\n      strict_error_check: If True, then the following will be treated as errors:\n        * If any template date is after the max_template_date.\n        * If any template has identical PDB ID to the query.\n        * If any template is a duplicate of the query.\n        * Any feature computation errors.\n    \"\"\"\n    self._mmcif_dir = mmcif_dir\n    if not glob.glob(os.path.join(self._mmcif_dir, '*.cif')):\n      logging.error('Could not find CIFs in %s', self._mmcif_dir)\n      raise ValueError(f'Could not find CIFs in {self._mmcif_dir}')\n\n    try:\n      self._max_template_date = datetime.datetime.strptime(\n          max_template_date, '%Y-%m-%d')\n    except ValueError:\n      raise ValueError(\n          'max_template_date must be set and have format YYYY-MM-DD.')\n    self._max_hits = max_hits\n    self._kalign_binary_path = kalign_binary_path\n    self._strict_error_check = strict_error_check\n\n    if release_dates_path:\n      logging.info('Using precomputed release dates %s.', release_dates_path)\n      self._release_dates = _parse_release_dates(release_dates_path)\n    else:\n      self._release_dates = {}\n\n    if obsolete_pdbs_path:\n      logging.info('Using precomputed obsolete pdbs %s.', obsolete_pdbs_path)\n      self._obsolete_pdbs = _parse_obsolete(obsolete_pdbs_path)\n    else:\n      self._obsolete_pdbs = {}\n\n  @abc.abstractmethod\n  def get_templates(\n      self,\n      query_sequence: str,\n      hits: Sequence[parsers.TemplateHit]) -> TemplateSearchResult:\n    \"\"\"Computes the templates for given query sequence.\"\"\"\n\n\nclass HhsearchHitFeaturizer(TemplateHitFeaturizer):\n  \"\"\"A class for turning a3m hits from hhsearch to template features.\"\"\"\n\n  def get_templates(\n      self,\n      query_sequence: str,\n      hits: Sequence[parsers.TemplateHit]) -> TemplateSearchResult:\n    \"\"\"Computes the templates for given query sequence (more details above).\"\"\"\n    logging.info('Searching for template for: %s', query_sequence)\n\n    template_features = {}\n    for template_feature_name in TEMPLATE_FEATURES:\n      template_features[template_feature_name] = []\n\n    num_hits = 0\n    errors = []\n    warnings = []\n\n    for hit in sorted(hits, key=lambda x: x.sum_probs, reverse=True):\n      # We got all the templates we wanted, stop processing hits.\n      if num_hits >= self._max_hits:\n        break\n\n      result = _process_single_hit(\n          query_sequence=query_sequence,\n          hit=hit,\n          mmcif_dir=self._mmcif_dir,\n          max_template_date=self._max_template_date,\n          release_dates=self._release_dates,\n          obsolete_pdbs=self._obsolete_pdbs,\n          strict_error_check=self._strict_error_check,\n          kalign_binary_path=self._kalign_binary_path)\n\n      if result.error:\n        errors.append(result.error)\n\n      # There could be an error even if there are some results, e.g. thrown by\n      # other unparsable chains in the same mmCIF file.\n      if result.warning:\n        warnings.append(result.warning)\n\n      if result.features is None:\n        logging.info('Skipped invalid hit %s, error: %s, warning: %s',\n                     hit.name, result.error, result.warning)\n      else:\n        # Increment the hit counter, since we got features out of this hit.\n        num_hits += 1\n        for k in template_features:\n          template_features[k].append(result.features[k])\n\n    for name in template_features:\n      if num_hits > 0:\n        template_features[name] = np.stack(\n            template_features[name], axis=0).astype(TEMPLATE_FEATURES[name])\n      else:\n        # Make sure the feature has correct dtype even if empty.\n        template_features[name] = np.array([], dtype=TEMPLATE_FEATURES[name])\n\n    return TemplateSearchResult(\n        features=template_features, errors=errors, warnings=warnings)\n\n\nclass HmmsearchHitFeaturizer(TemplateHitFeaturizer):\n  \"\"\"A class for turning a3m hits from hmmsearch to template features.\"\"\"\n\n  def get_templates(\n      self,\n      query_sequence: str,\n      hits: Sequence[parsers.TemplateHit]) -> TemplateSearchResult:\n    \"\"\"Computes the templates for given query sequence (more details above).\"\"\"\n    logging.info('Searching for template for: %s', query_sequence)\n\n    template_features = {}\n    for template_feature_name in TEMPLATE_FEATURES:\n      template_features[template_feature_name] = []\n\n    already_seen = set()\n    errors = []\n    warnings = []\n\n    if not hits or hits[0].sum_probs is None:\n      sorted_hits = hits\n    else:\n      sorted_hits = sorted(hits, key=lambda x: x.sum_probs, reverse=True)\n\n    for hit in sorted_hits:\n      # We got all the templates we wanted, stop processing hits.\n      if len(already_seen) >= self._max_hits:\n        break\n\n      result = _process_single_hit(\n          query_sequence=query_sequence,\n          hit=hit,\n          mmcif_dir=self._mmcif_dir,\n          max_template_date=self._max_template_date,\n          release_dates=self._release_dates,\n          obsolete_pdbs=self._obsolete_pdbs,\n          strict_error_check=self._strict_error_check,\n          kalign_binary_path=self._kalign_binary_path)\n\n      if result.error:\n        errors.append(result.error)\n\n      # There could be an error even if there are some results, e.g. thrown by\n      # other unparsable chains in the same mmCIF file.\n      if result.warning:\n        warnings.append(result.warning)\n\n      if result.features is None:\n        logging.debug('Skipped invalid hit %s, error: %s, warning: %s',\n                      hit.name, result.error, result.warning)\n      else:\n        already_seen_key = result.features['template_sequence']\n        if already_seen_key in already_seen:\n          continue\n        # Increment the hit counter, since we got features out of this hit.\n        already_seen.add(already_seen_key)\n        for k in template_features:\n          template_features[k].append(result.features[k])\n\n    if already_seen:\n      for name in template_features:\n        template_features[name] = np.stack(\n            template_features[name], axis=0).astype(TEMPLATE_FEATURES[name])\n    else:\n      num_res = len(query_sequence)\n      # Construct a default template with all zeros.\n      template_features = {\n          'template_aatype': np.zeros(\n              (1, num_res, len(residue_constants.restypes_with_x_and_gap)),\n              np.float32),\n          'template_all_atom_masks': np.zeros(\n              (1, num_res, residue_constants.atom_type_num), np.float32),\n          'template_all_atom_positions': np.zeros(\n              (1, num_res, residue_constants.atom_type_num, 3), np.float32),\n          'template_domain_names': np.array([''.encode()], dtype=object),\n          'template_sequence': np.array([''.encode()], dtype=object),\n          'template_sum_probs': np.array([0], dtype=np.float32)\n      }\n    return TemplateSearchResult(\n        features=template_features, errors=errors, warnings=warnings)\n"
  },
  {
    "path": "alphafold/data/tools/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Python wrappers for third party tools.\"\"\"\n"
  },
  {
    "path": "alphafold/data/tools/hhblits.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Library to run HHblits from Python.\"\"\"\n\nimport glob\nimport os\nimport subprocess\nfrom typing import Any, List, Mapping, Optional, Sequence\n\nfrom absl import logging\nfrom alphafold.data.tools import utils\n# Internal import (7716).\n\n\n_HHBLITS_DEFAULT_P = 20\n_HHBLITS_DEFAULT_Z = 500\n\n\nclass HHBlits:\n  \"\"\"Python wrapper of the HHblits binary.\"\"\"\n\n  def __init__(self,\n               *,\n               binary_path: str,\n               databases: Sequence[str],\n               n_cpu: int = 4,\n               n_iter: int = 3,\n               e_value: float = 0.001,\n               maxseq: int = 1_000_000,\n               realign_max: int = 100_000,\n               maxfilt: int = 100_000,\n               min_prefilter_hits: int = 1000,\n               all_seqs: bool = False,\n               alt: Optional[int] = None,\n               p: int = _HHBLITS_DEFAULT_P,\n               z: int = _HHBLITS_DEFAULT_Z):\n    \"\"\"Initializes the Python HHblits wrapper.\n\n    Args:\n      binary_path: The path to the HHblits executable.\n      databases: A sequence of HHblits database paths. This should be the\n        common prefix for the database files (i.e. up to but not including\n        _hhm.ffindex etc.)\n      n_cpu: The number of CPUs to give HHblits.\n      n_iter: The number of HHblits iterations.\n      e_value: The E-value, see HHblits docs for more details.\n      maxseq: The maximum number of rows in an input alignment. Note that this\n        parameter is only supported in HHBlits version 3.1 and higher.\n      realign_max: Max number of HMM-HMM hits to realign. HHblits default: 500.\n      maxfilt: Max number of hits allowed to pass the 2nd prefilter.\n        HHblits default: 20000.\n      min_prefilter_hits: Min number of hits to pass prefilter.\n        HHblits default: 100.\n      all_seqs: Return all sequences in the MSA / Do not filter the result MSA.\n        HHblits default: False.\n      alt: Show up to this many alternative alignments.\n      p: Minimum Prob for a hit to be included in the output hhr file.\n        HHblits default: 20.\n      z: Hard cap on number of hits reported in the hhr file.\n        HHblits default: 500. NB: The relevant HHblits flag is -Z not -z.\n\n    Raises:\n      RuntimeError: If HHblits binary not found within the path.\n    \"\"\"\n    self.binary_path = binary_path\n    self.databases = databases\n\n    for database_path in self.databases:\n      if not glob.glob(database_path + '_*'):\n        logging.error('Could not find HHBlits database %s', database_path)\n        raise ValueError(f'Could not find HHBlits database {database_path}')\n\n    self.n_cpu = n_cpu\n    self.n_iter = n_iter\n    self.e_value = e_value\n    self.maxseq = maxseq\n    self.realign_max = realign_max\n    self.maxfilt = maxfilt\n    self.min_prefilter_hits = min_prefilter_hits\n    self.all_seqs = all_seqs\n    self.alt = alt\n    self.p = p\n    self.z = z\n\n  def query(self, input_fasta_path: str) -> List[Mapping[str, Any]]:\n    \"\"\"Queries the database using HHblits.\"\"\"\n    with utils.tmpdir_manager() as query_tmp_dir:\n      a3m_path = os.path.join(query_tmp_dir, 'output.a3m')\n\n      db_cmd = []\n      for db_path in self.databases:\n        db_cmd.append('-d')\n        db_cmd.append(db_path)\n      cmd = [\n          self.binary_path,\n          '-i', input_fasta_path,\n          '-cpu', str(self.n_cpu),\n          '-oa3m', a3m_path,\n          '-o', '/dev/null',\n          '-n', str(self.n_iter),\n          '-e', str(self.e_value),\n          '-maxseq', str(self.maxseq),\n          '-realign_max', str(self.realign_max),\n          '-maxfilt', str(self.maxfilt),\n          '-min_prefilter_hits', str(self.min_prefilter_hits)]\n      if self.all_seqs:\n        cmd += ['-all']\n      if self.alt:\n        cmd += ['-alt', str(self.alt)]\n      if self.p != _HHBLITS_DEFAULT_P:\n        cmd += ['-p', str(self.p)]\n      if self.z != _HHBLITS_DEFAULT_Z:\n        cmd += ['-Z', str(self.z)]\n      cmd += db_cmd\n\n      logging.info('Launching subprocess \"%s\"', ' '.join(cmd))\n      process = subprocess.Popen(\n          cmd, stdout=subprocess.PIPE, stderr=subprocess.PIPE)\n\n      with utils.timing('HHblits query'):\n        stdout, stderr = process.communicate()\n        retcode = process.wait()\n\n      if retcode:\n        # Logs have a 15k character limit, so log HHblits error line by line.\n        logging.error('HHblits failed. HHblits stderr begin:')\n        for error_line in stderr.decode('utf-8').splitlines():\n          if error_line.strip():\n            logging.error(error_line.strip())\n        logging.error('HHblits stderr end')\n        raise RuntimeError('HHblits failed\\nstdout:\\n%s\\n\\nstderr:\\n%s\\n' % (\n            stdout.decode('utf-8'), stderr[:500_000].decode('utf-8')))\n\n      with open(a3m_path) as f:\n        a3m = f.read()\n\n    raw_output = dict(\n        a3m=a3m,\n        output=stdout,\n        stderr=stderr,\n        n_iter=self.n_iter,\n        e_value=self.e_value)\n    return [raw_output]\n"
  },
  {
    "path": "alphafold/data/tools/hhsearch.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Library to run HHsearch from Python.\"\"\"\n\nimport glob\nimport os\nimport subprocess\nfrom typing import Sequence\n\nfrom absl import logging\n\nfrom alphafold.data import parsers\nfrom alphafold.data.tools import utils\n# Internal import (7716).\n\n\nclass HHSearch:\n  \"\"\"Python wrapper of the HHsearch binary.\"\"\"\n\n  def __init__(self,\n               *,\n               binary_path: str,\n               databases: Sequence[str],\n               maxseq: int = 1_000_000):\n    \"\"\"Initializes the Python HHsearch wrapper.\n\n    Args:\n      binary_path: The path to the HHsearch executable.\n      databases: A sequence of HHsearch database paths. This should be the\n        common prefix for the database files (i.e. up to but not including\n        _hhm.ffindex etc.)\n      maxseq: The maximum number of rows in an input alignment. Note that this\n        parameter is only supported in HHBlits version 3.1 and higher.\n\n    Raises:\n      RuntimeError: If HHsearch binary not found within the path.\n    \"\"\"\n    self.binary_path = binary_path\n    self.databases = databases\n    self.maxseq = maxseq\n\n    for database_path in self.databases:\n      if not glob.glob(database_path + '_*'):\n        logging.error('Could not find HHsearch database %s', database_path)\n        raise ValueError(f'Could not find HHsearch database {database_path}')\n\n  @property\n  def output_format(self) -> str:\n    return 'hhr'\n\n  @property\n  def input_format(self) -> str:\n    return 'a3m'\n\n  def query(self, a3m: str) -> str:\n    \"\"\"Queries the database using HHsearch using a given a3m.\"\"\"\n    with utils.tmpdir_manager() as query_tmp_dir:\n      input_path = os.path.join(query_tmp_dir, 'query.a3m')\n      hhr_path = os.path.join(query_tmp_dir, 'output.hhr')\n      with open(input_path, 'w') as f:\n        f.write(a3m)\n\n      db_cmd = []\n      for db_path in self.databases:\n        db_cmd.append('-d')\n        db_cmd.append(db_path)\n      cmd = [self.binary_path,\n             '-i', input_path,\n             '-o', hhr_path,\n             '-maxseq', str(self.maxseq)\n             ] + db_cmd\n\n      logging.info('Launching subprocess \"%s\"', ' '.join(cmd))\n      process = subprocess.Popen(\n          cmd, stdout=subprocess.PIPE, stderr=subprocess.PIPE)\n      with utils.timing('HHsearch query'):\n        stdout, stderr = process.communicate()\n        retcode = process.wait()\n\n      if retcode:\n        # Stderr is truncated to prevent proto size errors in Beam.\n        raise RuntimeError(\n            'HHSearch failed:\\nstdout:\\n%s\\n\\nstderr:\\n%s\\n' % (\n                stdout.decode('utf-8'), stderr[:100_000].decode('utf-8')))\n\n      with open(hhr_path) as f:\n        hhr = f.read()\n    return hhr\n\n  def get_template_hits(self,\n                        output_string: str,\n                        input_sequence: str) -> Sequence[parsers.TemplateHit]:\n    \"\"\"Gets parsed template hits from the raw string output by the tool.\"\"\"\n    del input_sequence  # Used by hmmseach but not needed for hhsearch.\n    return parsers.parse_hhr(output_string)\n"
  },
  {
    "path": "alphafold/data/tools/hmmbuild.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"A Python wrapper for hmmbuild - construct HMM profiles from MSA.\"\"\"\n\nimport os\nimport re\nimport subprocess\n\nfrom absl import logging\nfrom alphafold.data.tools import utils\n# Internal import (7716).\n\n\nclass Hmmbuild(object):\n  \"\"\"Python wrapper of the hmmbuild binary.\"\"\"\n\n  def __init__(self,\n               *,\n               binary_path: str,\n               singlemx: bool = False):\n    \"\"\"Initializes the Python hmmbuild wrapper.\n\n    Args:\n      binary_path: The path to the hmmbuild executable.\n      singlemx: Whether to use --singlemx flag. If True, it forces HMMBuild to\n        just use a common substitution score matrix.\n\n    Raises:\n      RuntimeError: If hmmbuild binary not found within the path.\n    \"\"\"\n    self.binary_path = binary_path\n    self.singlemx = singlemx\n\n  def build_profile_from_sto(self, sto: str, model_construction='fast') -> str:\n    \"\"\"Builds a HHM for the aligned sequences given as an A3M string.\n\n    Args:\n      sto: A string with the aligned sequences in the Stockholm format.\n      model_construction: Whether to use reference annotation in the msa to\n        determine consensus columns ('hand') or default ('fast').\n\n    Returns:\n      A string with the profile in the HMM format.\n\n    Raises:\n      RuntimeError: If hmmbuild fails.\n    \"\"\"\n    return self._build_profile(sto, model_construction=model_construction)\n\n  def build_profile_from_a3m(self, a3m: str) -> str:\n    \"\"\"Builds a HHM for the aligned sequences given as an A3M string.\n\n    Args:\n      a3m: A string with the aligned sequences in the A3M format.\n\n    Returns:\n      A string with the profile in the HMM format.\n\n    Raises:\n      RuntimeError: If hmmbuild fails.\n    \"\"\"\n    lines = []\n    for line in a3m.splitlines():\n      if not line.startswith('>'):\n        line = re.sub('[a-z]+', '', line)  # Remove inserted residues.\n      lines.append(line + '\\n')\n    msa = ''.join(lines)\n    return self._build_profile(msa, model_construction='fast')\n\n  def _build_profile(self, msa: str, model_construction: str = 'fast') -> str:\n    \"\"\"Builds a HMM for the aligned sequences given as an MSA string.\n\n    Args:\n      msa: A string with the aligned sequences, in A3M or STO format.\n      model_construction: Whether to use reference annotation in the msa to\n        determine consensus columns ('hand') or default ('fast').\n\n    Returns:\n      A string with the profile in the HMM format.\n\n    Raises:\n      RuntimeError: If hmmbuild fails.\n      ValueError: If unspecified arguments are provided.\n    \"\"\"\n    if model_construction not in {'hand', 'fast'}:\n      raise ValueError(f'Invalid model_construction {model_construction} - only'\n                       'hand and fast supported.')\n\n    with utils.tmpdir_manager() as query_tmp_dir:\n      input_query = os.path.join(query_tmp_dir, 'query.msa')\n      output_hmm_path = os.path.join(query_tmp_dir, 'output.hmm')\n\n      with open(input_query, 'w') as f:\n        f.write(msa)\n\n      cmd = [self.binary_path]\n      # If adding flags, we have to do so before the output and input:\n\n      if model_construction == 'hand':\n        cmd.append(f'--{model_construction}')\n      if self.singlemx:\n        cmd.append('--singlemx')\n      cmd.extend([\n          '--amino',\n          output_hmm_path,\n          input_query,\n      ])\n\n      logging.info('Launching subprocess %s', cmd)\n      process = subprocess.Popen(cmd, stdout=subprocess.PIPE,\n                                 stderr=subprocess.PIPE)\n\n      with utils.timing('hmmbuild query'):\n        stdout, stderr = process.communicate()\n        retcode = process.wait()\n        logging.info('hmmbuild stdout:\\n%s\\n\\nstderr:\\n%s\\n',\n                     stdout.decode('utf-8'), stderr.decode('utf-8'))\n\n      if retcode:\n        raise RuntimeError('hmmbuild failed\\nstdout:\\n%s\\n\\nstderr:\\n%s\\n'\n                           % (stdout.decode('utf-8'), stderr.decode('utf-8')))\n\n      with open(output_hmm_path, encoding='utf-8') as f:\n        hmm = f.read()\n\n    return hmm\n"
  },
  {
    "path": "alphafold/data/tools/hmmsearch.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"A Python wrapper for hmmsearch - search profile against a sequence db.\"\"\"\n\nimport os\nimport subprocess\nfrom typing import Optional, Sequence\n\nfrom absl import logging\nfrom alphafold.data import parsers\nfrom alphafold.data.tools import hmmbuild\nfrom alphafold.data.tools import utils\n# Internal import (7716).\n\n\nclass Hmmsearch(object):\n  \"\"\"Python wrapper of the hmmsearch binary.\"\"\"\n\n  def __init__(self,\n               *,\n               binary_path: str,\n               hmmbuild_binary_path: str,\n               database_path: str,\n               flags: Optional[Sequence[str]] = None):\n    \"\"\"Initializes the Python hmmsearch wrapper.\n\n    Args:\n      binary_path: The path to the hmmsearch executable.\n      hmmbuild_binary_path: The path to the hmmbuild executable. Used to build\n        an hmm from an input a3m.\n      database_path: The path to the hmmsearch database (FASTA format).\n      flags: List of flags to be used by hmmsearch.\n\n    Raises:\n      RuntimeError: If hmmsearch binary not found within the path.\n    \"\"\"\n    self.binary_path = binary_path\n    self.hmmbuild_runner = hmmbuild.Hmmbuild(binary_path=hmmbuild_binary_path)\n    self.database_path = database_path\n    if flags is None:\n      # Default hmmsearch run settings.\n      flags = ['--F1', '0.1',\n               '--F2', '0.1',\n               '--F3', '0.1',\n               '--incE', '100',\n               '-E', '100',\n               '--domE', '100',\n               '--incdomE', '100']\n    self.flags = flags\n\n    if not os.path.exists(self.database_path):\n      logging.error('Could not find hmmsearch database %s', database_path)\n      raise ValueError(f'Could not find hmmsearch database {database_path}')\n\n  @property\n  def output_format(self) -> str:\n    return 'sto'\n\n  @property\n  def input_format(self) -> str:\n    return 'sto'\n\n  def query(self, msa_sto: str) -> str:\n    \"\"\"Queries the database using hmmsearch using a given stockholm msa.\"\"\"\n    hmm = self.hmmbuild_runner.build_profile_from_sto(msa_sto,\n                                                      model_construction='hand')\n    return self.query_with_hmm(hmm)\n\n  def query_with_hmm(self, hmm: str) -> str:\n    \"\"\"Queries the database using hmmsearch using a given hmm.\"\"\"\n    with utils.tmpdir_manager() as query_tmp_dir:\n      hmm_input_path = os.path.join(query_tmp_dir, 'query.hmm')\n      out_path = os.path.join(query_tmp_dir, 'output.sto')\n      with open(hmm_input_path, 'w') as f:\n        f.write(hmm)\n\n      cmd = [\n          self.binary_path,\n          '--noali',  # Don't include the alignment in stdout.\n          '--cpu', '8'\n      ]\n      # If adding flags, we have to do so before the output and input:\n      if self.flags:\n        cmd.extend(self.flags)\n      cmd.extend([\n          '-A', out_path,\n          hmm_input_path,\n          self.database_path,\n      ])\n\n      logging.info('Launching sub-process %s', cmd)\n      process = subprocess.Popen(\n          cmd, stdout=subprocess.PIPE, stderr=subprocess.PIPE)\n      with utils.timing(\n          f'hmmsearch ({os.path.basename(self.database_path)}) query'):\n        stdout, stderr = process.communicate()\n        retcode = process.wait()\n\n      if retcode:\n        raise RuntimeError(\n            'hmmsearch failed:\\nstdout:\\n%s\\n\\nstderr:\\n%s\\n' % (\n                stdout.decode('utf-8'), stderr.decode('utf-8')))\n\n      with open(out_path) as f:\n        out_msa = f.read()\n\n    return out_msa\n\n  def get_template_hits(self,\n                        output_string: str,\n                        input_sequence: str) -> Sequence[parsers.TemplateHit]:\n    \"\"\"Gets parsed template hits from the raw string output by the tool.\"\"\"\n    a3m_string = parsers.convert_stockholm_to_a3m(output_string,\n                                                  remove_first_row_gaps=False)\n    template_hits = parsers.parse_hmmsearch_a3m(\n        query_sequence=input_sequence,\n        a3m_string=a3m_string,\n        skip_first=False)\n    return template_hits\n"
  },
  {
    "path": "alphafold/data/tools/jackhmmer.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Library to run Jackhmmer from Python.\"\"\"\n\nfrom concurrent import futures\nimport glob\nimport os\nimport subprocess\nfrom typing import Any, Callable, Mapping, Optional, Sequence\nfrom urllib import request\n\nfrom absl import logging\n\nfrom alphafold.data import parsers\nfrom alphafold.data.tools import utils\n# Internal import (7716).\n\n\nclass Jackhmmer:\n  \"\"\"Python wrapper of the Jackhmmer binary.\"\"\"\n\n  def __init__(self,\n               *,\n               binary_path: str,\n               database_path: str,\n               n_cpu: int = 8,\n               n_iter: int = 1,\n               e_value: float = 0.0001,\n               z_value: Optional[int] = None,\n               get_tblout: bool = False,\n               filter_f1: float = 0.0005,\n               filter_f2: float = 0.00005,\n               filter_f3: float = 0.0000005,\n               incdom_e: Optional[float] = None,\n               dom_e: Optional[float] = None,\n               num_streamed_chunks: Optional[int] = None,\n               streaming_callback: Optional[Callable[[int], None]] = None):\n    \"\"\"Initializes the Python Jackhmmer wrapper.\n\n    Args:\n      binary_path: The path to the jackhmmer executable.\n      database_path: The path to the jackhmmer database (FASTA format).\n      n_cpu: The number of CPUs to give Jackhmmer.\n      n_iter: The number of Jackhmmer iterations.\n      e_value: The E-value, see Jackhmmer docs for more details.\n      z_value: The Z-value, see Jackhmmer docs for more details.\n      get_tblout: Whether to save tblout string.\n      filter_f1: MSV and biased composition pre-filter, set to >1.0 to turn off.\n      filter_f2: Viterbi pre-filter, set to >1.0 to turn off.\n      filter_f3: Forward pre-filter, set to >1.0 to turn off.\n      incdom_e: Domain e-value criteria for inclusion of domains in MSA/next\n        round.\n      dom_e: Domain e-value criteria for inclusion in tblout.\n      num_streamed_chunks: Number of database chunks to stream over.\n      streaming_callback: Callback function run after each chunk iteration with\n        the iteration number as argument.\n    \"\"\"\n    self.binary_path = binary_path\n    self.database_path = database_path\n    self.num_streamed_chunks = num_streamed_chunks\n\n    if not os.path.exists(self.database_path) and num_streamed_chunks is None:\n      logging.error('Could not find Jackhmmer database %s', database_path)\n      raise ValueError(f'Could not find Jackhmmer database {database_path}')\n\n    self.n_cpu = n_cpu\n    self.n_iter = n_iter\n    self.e_value = e_value\n    self.z_value = z_value\n    self.filter_f1 = filter_f1\n    self.filter_f2 = filter_f2\n    self.filter_f3 = filter_f3\n    self.incdom_e = incdom_e\n    self.dom_e = dom_e\n    self.get_tblout = get_tblout\n    self.streaming_callback = streaming_callback\n\n  def _query_chunk(self,\n                   input_fasta_path: str,\n                   database_path: str,\n                   max_sequences: Optional[int] = None) -> Mapping[str, Any]:\n    \"\"\"Queries the database chunk using Jackhmmer.\"\"\"\n    with utils.tmpdir_manager() as query_tmp_dir:\n      sto_path = os.path.join(query_tmp_dir, 'output.sto')\n\n      # The F1/F2/F3 are the expected proportion to pass each of the filtering\n      # stages (which get progressively more expensive), reducing these\n      # speeds up the pipeline at the expensive of sensitivity.  They are\n      # currently set very low to make querying Mgnify run in a reasonable\n      # amount of time.\n      cmd_flags = [\n          # Don't pollute stdout with Jackhmmer output.\n          '-o', '/dev/null',\n          '-A', sto_path,\n          '--noali',\n          '--F1', str(self.filter_f1),\n          '--F2', str(self.filter_f2),\n          '--F3', str(self.filter_f3),\n          '--incE', str(self.e_value),\n          # Report only sequences with E-values <= x in per-sequence output.\n          '-E', str(self.e_value),\n          '--cpu', str(self.n_cpu),\n          '-N', str(self.n_iter)\n      ]\n      if self.get_tblout:\n        tblout_path = os.path.join(query_tmp_dir, 'tblout.txt')\n        cmd_flags.extend(['--tblout', tblout_path])\n\n      if self.z_value:\n        cmd_flags.extend(['-Z', str(self.z_value)])\n\n      if self.dom_e is not None:\n        cmd_flags.extend(['--domE', str(self.dom_e)])\n\n      if self.incdom_e is not None:\n        cmd_flags.extend(['--incdomE', str(self.incdom_e)])\n\n      cmd = [self.binary_path] + cmd_flags + [input_fasta_path,\n                                              database_path]\n\n      logging.info('Launching subprocess \"%s\"', ' '.join(cmd))\n      process = subprocess.Popen(\n          cmd, stdout=subprocess.PIPE, stderr=subprocess.PIPE)\n      with utils.timing(\n          f'Jackhmmer ({os.path.basename(database_path)}) query'):\n        _, stderr = process.communicate()\n        retcode = process.wait()\n\n      if retcode:\n        raise RuntimeError(\n            'Jackhmmer failed\\nstderr:\\n%s\\n' % stderr.decode('utf-8'))\n\n      # Get e-values for each target name\n      tbl = ''\n      if self.get_tblout:\n        with open(tblout_path) as f:\n          tbl = f.read()\n\n      if max_sequences is None:\n        with open(sto_path) as f:\n          sto = f.read()\n      else:\n        sto = parsers.truncate_stockholm_msa(sto_path, max_sequences)\n\n    raw_output = dict(\n        sto=sto,\n        tbl=tbl,\n        stderr=stderr,\n        n_iter=self.n_iter,\n        e_value=self.e_value)\n\n    return raw_output\n\n  def query(self,\n            input_fasta_path: str,\n            max_sequences: Optional[int] = None) -> Sequence[Mapping[str, Any]]:\n    \"\"\"Queries the database using Jackhmmer.\"\"\"\n    return self.query_multiple([input_fasta_path], max_sequences)[0]\n\n  def query_multiple(\n      self,\n      input_fasta_paths: Sequence[str],\n      max_sequences: Optional[int] = None,\n    ) -> Sequence[Sequence[Mapping[str, Any]]]:\n    \"\"\"Queries the database for multiple queries using Jackhmmer.\"\"\"\n    if self.num_streamed_chunks is None:\n      single_chunk_results = []\n      for input_fasta_path in input_fasta_paths:\n        single_chunk_results.append([self._query_chunk(\n            input_fasta_path, self.database_path, max_sequences)])\n      return single_chunk_results\n\n    db_basename = os.path.basename(self.database_path)\n    db_remote_chunk = lambda db_idx: f'{self.database_path}.{db_idx}'\n    db_local_chunk = lambda db_idx: f'/tmp/ramdisk/{db_basename}.{db_idx}'\n\n    # Remove existing files to prevent OOM\n    for f in glob.glob(db_local_chunk('[0-9]*')):\n      try:\n        os.remove(f)\n      except OSError:\n        print(f'OSError while deleting {f}')\n\n    # Download the (i+1)-th chunk while Jackhmmer is running on the i-th chunk\n    with futures.ThreadPoolExecutor(max_workers=2) as executor:\n      chunked_outputs = [[] for _ in range(len(input_fasta_paths))]\n      for i in range(1, self.num_streamed_chunks + 1):\n        # Copy the chunk locally\n        if i == 1:\n          future = executor.submit(\n              request.urlretrieve, db_remote_chunk(i), db_local_chunk(i))\n        if i < self.num_streamed_chunks:\n          next_future = executor.submit(\n              request.urlretrieve, db_remote_chunk(i+1), db_local_chunk(i+1))\n\n        # Run Jackhmmer with the chunk\n        future.result()\n        for fasta_index, input_fasta_path in enumerate(input_fasta_paths):\n          chunked_outputs[fasta_index].append(self._query_chunk(\n              input_fasta_path, db_local_chunk(i), max_sequences))\n        # Remove the local copy of the chunk\n        os.remove(db_local_chunk(i))\n        # Do not set next_future for the last chunk so that this works even for\n        # databases with only 1 chunk.\n        if i < self.num_streamed_chunks:\n          future = next_future\n        if self.streaming_callback:\n          self.streaming_callback(i)\n    return chunked_outputs\n"
  },
  {
    "path": "alphafold/data/tools/kalign.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"A Python wrapper for Kalign.\"\"\"\nimport os\nimport subprocess\nfrom typing import Sequence\n\nfrom absl import logging\n\nfrom alphafold.data.tools import utils\n# Internal import (7716).\n\n\ndef _to_a3m(sequences: Sequence[str]) -> str:\n  \"\"\"Converts sequences to an a3m file.\"\"\"\n  names = ['sequence %d' % i for i in range(1, len(sequences) + 1)]\n  a3m = []\n  for sequence, name in zip(sequences, names):\n    a3m.append(u'>' + name + u'\\n')\n    a3m.append(sequence + u'\\n')\n  return ''.join(a3m)\n\n\nclass Kalign:\n  \"\"\"Python wrapper of the Kalign binary.\"\"\"\n\n  def __init__(self, *, binary_path: str):\n    \"\"\"Initializes the Python Kalign wrapper.\n\n    Args:\n      binary_path: The path to the Kalign binary.\n\n    Raises:\n      RuntimeError: If Kalign binary not found within the path.\n    \"\"\"\n    self.binary_path = binary_path\n\n  def align(self, sequences: Sequence[str]) -> str:\n    \"\"\"Aligns the sequences and returns the alignment in A3M string.\n\n    Args:\n      sequences: A list of query sequence strings. The sequences have to be at\n        least 6 residues long (Kalign requires this). Note that the order in\n        which you give the sequences might alter the output slightly as\n        different alignment tree might get constructed.\n\n    Returns:\n      A string with the alignment in a3m format.\n\n    Raises:\n      RuntimeError: If Kalign fails.\n      ValueError: If any of the sequences is less than 6 residues long.\n    \"\"\"\n    logging.info('Aligning %d sequences', len(sequences))\n\n    for s in sequences:\n      if len(s) < 6:\n        raise ValueError('Kalign requires all sequences to be at least 6 '\n                         'residues long. Got %s (%d residues).' % (s, len(s)))\n\n    with utils.tmpdir_manager() as query_tmp_dir:\n      input_fasta_path = os.path.join(query_tmp_dir, 'input.fasta')\n      output_a3m_path = os.path.join(query_tmp_dir, 'output.a3m')\n\n      with open(input_fasta_path, 'w') as f:\n        f.write(_to_a3m(sequences))\n\n      cmd = [\n          self.binary_path,\n          '-i', input_fasta_path,\n          '-o', output_a3m_path,\n          '-format', 'fasta',\n      ]\n\n      logging.info('Launching subprocess \"%s\"', ' '.join(cmd))\n      process = subprocess.Popen(cmd, stdout=subprocess.PIPE,\n                                 stderr=subprocess.PIPE)\n\n      with utils.timing('Kalign query'):\n        stdout, stderr = process.communicate()\n        retcode = process.wait()\n        logging.info('Kalign stdout:\\n%s\\n\\nstderr:\\n%s\\n',\n                     stdout.decode('utf-8'), stderr.decode('utf-8'))\n\n      if retcode:\n        raise RuntimeError('Kalign failed\\nstdout:\\n%s\\n\\nstderr:\\n%s\\n'\n                           % (stdout.decode('utf-8'), stderr.decode('utf-8')))\n\n      with open(output_a3m_path) as f:\n        a3m = f.read()\n\n      return a3m\n"
  },
  {
    "path": "alphafold/data/tools/utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Common utilities for data pipeline tools.\"\"\"\nimport contextlib\nimport shutil\nimport tempfile\nimport time\nfrom typing import Optional\n\nfrom absl import logging\n\n\n@contextlib.contextmanager\ndef tmpdir_manager(base_dir: Optional[str] = None):\n  \"\"\"Context manager that deletes a temporary directory on exit.\"\"\"\n  tmpdir = tempfile.mkdtemp(dir=base_dir)\n  try:\n    yield tmpdir\n  finally:\n    shutil.rmtree(tmpdir, ignore_errors=True)\n\n\n@contextlib.contextmanager\ndef timing(msg: str):\n  logging.info('Started %s', msg)\n  tic = time.time()\n  yield\n  toc = time.time()\n  logging.info('Finished %s in %.3f seconds', msg, toc - tic)\n"
  },
  {
    "path": "alphafold/model/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Alphafold model.\"\"\"\n"
  },
  {
    "path": "alphafold/model/all_atom.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Ops for all atom representations.\n\nGenerally we employ two different representations for all atom coordinates,\none is atom37 where each heavy atom corresponds to a given position in a 37\ndimensional array, This mapping is non amino acid specific, but each slot\ncorresponds to an atom of a given name, for example slot 12 always corresponds\nto 'C delta 1', positions that are not present for a given amino acid are\nzeroed out and denoted by a mask.\nThe other representation we employ is called atom14, this is a more dense way\nof representing atoms with 14 slots. Here a given slot will correspond to a\ndifferent kind of atom depending on amino acid type, for example slot 5\ncorresponds to 'N delta 2' for Aspargine, but to 'C delta 1' for Isoleucine.\n14 is chosen because it is the maximum number of heavy atoms for any standard\namino acid.\nThe order of slots can be found in 'residue_constants.residue_atoms'.\nInternally the model uses the atom14 representation because it is\ncomputationally more efficient.\nThe internal atom14 representation is turned into the atom37 at the output of\nthe network to facilitate easier conversion to existing protein datastructures.\n\"\"\"\n\nfrom typing import Dict, Optional\nfrom alphafold.common import residue_constants\n\nfrom alphafold.model import r3\nfrom alphafold.model import utils\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\n\ndef squared_difference(x, y):\n  return jnp.square(x - y)\n\n\ndef get_chi_atom_indices():\n  \"\"\"Returns atom indices needed to compute chi angles for all residue types.\n\n  Returns:\n    A tensor of shape [residue_types=21, chis=4, atoms=4]. The residue types are\n    in the order specified in residue_constants.restypes + unknown residue type\n    at the end. For chi angles which are not defined on the residue, the\n    positions indices are by default set to 0.\n  \"\"\"\n  chi_atom_indices = []\n  for residue_name in residue_constants.restypes:\n    residue_name = residue_constants.restype_1to3[residue_name]\n    residue_chi_angles = residue_constants.chi_angles_atoms[residue_name]\n    atom_indices = []\n    for chi_angle in residue_chi_angles:\n      atom_indices.append(\n          [residue_constants.atom_order[atom] for atom in chi_angle])\n    for _ in range(4 - len(atom_indices)):\n      atom_indices.append([0, 0, 0, 0])  # For chi angles not defined on the AA.\n    chi_atom_indices.append(atom_indices)\n\n  chi_atom_indices.append([[0, 0, 0, 0]] * 4)  # For UNKNOWN residue.\n\n  return jnp.asarray(chi_atom_indices)\n\n\ndef atom14_to_atom37(atom14_data: jnp.ndarray,  # (N, 14, ...)\n                     batch: Dict[str, jnp.ndarray]\n                    ) -> jnp.ndarray:  # (N, 37, ...)\n  \"\"\"Convert atom14 to atom37 representation.\"\"\"\n  assert len(atom14_data.shape) in [2, 3]\n  assert 'residx_atom37_to_atom14' in batch\n  assert 'atom37_atom_exists' in batch\n\n  atom37_data = utils.batched_gather(atom14_data,\n                                     batch['residx_atom37_to_atom14'],\n                                     batch_dims=1)\n  if len(atom14_data.shape) == 2:\n    atom37_data *= batch['atom37_atom_exists']\n  elif len(atom14_data.shape) == 3:\n    atom37_data *= batch['atom37_atom_exists'][:, :,\n                                               None].astype(atom37_data.dtype)\n  return atom37_data\n\n\ndef atom37_to_atom14(\n    atom37_data: jnp.ndarray,  # (N, 37, ...)\n    batch: Dict[str, jnp.ndarray]) -> jnp.ndarray:  # (N, 14, ...)\n  \"\"\"Convert atom14 to atom37 representation.\"\"\"\n  assert len(atom37_data.shape) in [2, 3]\n  assert 'residx_atom14_to_atom37' in batch\n  assert 'atom14_atom_exists' in batch\n\n  atom14_data = utils.batched_gather(atom37_data,\n                                     batch['residx_atom14_to_atom37'],\n                                     batch_dims=1)\n  if len(atom37_data.shape) == 2:\n    atom14_data *= batch['atom14_atom_exists'].astype(atom14_data.dtype)\n  elif len(atom37_data.shape) == 3:\n    atom14_data *= batch['atom14_atom_exists'][:, :,\n                                               None].astype(atom14_data.dtype)\n  return atom14_data\n\n\ndef atom37_to_frames(\n    aatype: jnp.ndarray,  # (...)\n    all_atom_positions: jnp.ndarray,  # (..., 37, 3)\n    all_atom_mask: jnp.ndarray,  # (..., 37)\n) -> Dict[str, jnp.ndarray]:\n  \"\"\"Computes the frames for the up to 8 rigid groups for each residue.\n\n  The rigid groups are defined by the possible torsions in a given amino acid.\n  We group the atoms according to their dependence on the torsion angles into\n  \"rigid groups\".  E.g., the position of atoms in the chi2-group depend on\n  chi1 and chi2, but do not depend on chi3 or chi4.\n  Jumper et al. (2021) Suppl. Table 2 and corresponding text.\n\n  Args:\n    aatype: Amino acid type, given as array with integers.\n    all_atom_positions: atom37 representation of all atom coordinates.\n    all_atom_mask: atom37 representation of mask on all atom coordinates.\n  Returns:\n    Dictionary containing:\n      * 'rigidgroups_gt_frames': 8 Frames corresponding to 'all_atom_positions'\n           represented as flat 12 dimensional array.\n      * 'rigidgroups_gt_exists': Mask denoting whether the atom positions for\n          the given frame are available in the ground truth, e.g. if they were\n          resolved in the experiment.\n      * 'rigidgroups_group_exists': Mask denoting whether given group is in\n          principle present for given amino acid type.\n      * 'rigidgroups_group_is_ambiguous': Mask denoting whether frame is\n          affected by naming ambiguity.\n      * 'rigidgroups_alt_gt_frames': 8 Frames with alternative atom renaming\n          corresponding to 'all_atom_positions' represented as flat\n          12 dimensional array.\n  \"\"\"\n  # 0: 'backbone group',\n  # 1: 'pre-omega-group', (empty)\n  # 2: 'phi-group', (currently empty, because it defines only hydrogens)\n  # 3: 'psi-group',\n  # 4,5,6,7: 'chi1,2,3,4-group'\n  aatype_in_shape = aatype.shape\n\n  # If there is a batch axis, just flatten it away, and reshape everything\n  # back at the end of the function.\n  aatype = jnp.reshape(aatype, [-1])\n  all_atom_positions = jnp.reshape(all_atom_positions, [-1, 37, 3])\n  all_atom_mask = jnp.reshape(all_atom_mask, [-1, 37])\n\n  # Create an array with the atom names.\n  # shape (num_restypes, num_rigidgroups, 3_atoms): (21, 8, 3)\n  restype_rigidgroup_base_atom_names = np.full([21, 8, 3], '', dtype=object)\n\n  # 0: backbone frame\n  restype_rigidgroup_base_atom_names[:, 0, :] = ['C', 'CA', 'N']\n\n  # 3: 'psi-group'\n  restype_rigidgroup_base_atom_names[:, 3, :] = ['CA', 'C', 'O']\n\n  # 4,5,6,7: 'chi1,2,3,4-group'\n  for restype, restype_letter in enumerate(residue_constants.restypes):\n    resname = residue_constants.restype_1to3[restype_letter]\n    for chi_idx in range(4):\n      if residue_constants.chi_angles_mask[restype][chi_idx]:\n        atom_names = residue_constants.chi_angles_atoms[resname][chi_idx]\n        restype_rigidgroup_base_atom_names[\n            restype, chi_idx + 4, :] = atom_names[1:]\n\n  # Create mask for existing rigid groups.\n  restype_rigidgroup_mask = np.zeros([21, 8], dtype=np.float32)\n  restype_rigidgroup_mask[:, 0] = 1\n  restype_rigidgroup_mask[:, 3] = 1\n  restype_rigidgroup_mask[:20, 4:] = residue_constants.chi_angles_mask\n\n  # Translate atom names into atom37 indices.\n  lookuptable = residue_constants.atom_order.copy()\n  lookuptable[''] = 0\n  restype_rigidgroup_base_atom37_idx = np.vectorize(lambda x: lookuptable[x])(\n      restype_rigidgroup_base_atom_names)\n\n  # Compute the gather indices for all residues in the chain.\n  # shape (N, 8, 3)\n  residx_rigidgroup_base_atom37_idx = utils.batched_gather(\n      restype_rigidgroup_base_atom37_idx, aatype)\n\n  # Gather the base atom positions for each rigid group.\n  base_atom_pos = utils.batched_gather(\n      all_atom_positions,\n      residx_rigidgroup_base_atom37_idx,\n      batch_dims=1)\n\n  # Compute the Rigids.\n  gt_frames = r3.rigids_from_3_points(\n      point_on_neg_x_axis=r3.vecs_from_tensor(base_atom_pos[:, :, 0, :]),\n      origin=r3.vecs_from_tensor(base_atom_pos[:, :, 1, :]),\n      point_on_xy_plane=r3.vecs_from_tensor(base_atom_pos[:, :, 2, :])\n  )\n\n  # Compute a mask whether the group exists.\n  # (N, 8)\n  group_exists = utils.batched_gather(restype_rigidgroup_mask, aatype)\n\n  # Compute a mask whether ground truth exists for the group\n  gt_atoms_exist = utils.batched_gather(  # shape (N, 8, 3)\n      all_atom_mask.astype(jnp.float32),\n      residx_rigidgroup_base_atom37_idx,\n      batch_dims=1)\n  gt_exists = jnp.min(gt_atoms_exist, axis=-1) * group_exists  # (N, 8)\n\n  # Adapt backbone frame to old convention (mirror x-axis and z-axis).\n  rots = np.tile(np.eye(3, dtype=np.float32), [8, 1, 1])\n  rots[0, 0, 0] = -1\n  rots[0, 2, 2] = -1\n  gt_frames = r3.rigids_mul_rots(gt_frames, r3.rots_from_tensor3x3(rots))\n\n  # The frames for ambiguous rigid groups are just rotated by 180 degree around\n  # the x-axis. The ambiguous group is always the last chi-group.\n  restype_rigidgroup_is_ambiguous = np.zeros([21, 8], dtype=np.float32)\n  restype_rigidgroup_rots = np.tile(np.eye(3, dtype=np.float32), [21, 8, 1, 1])\n\n  for resname, _ in residue_constants.residue_atom_renaming_swaps.items():\n    restype = residue_constants.restype_order[\n        residue_constants.restype_3to1[resname]]\n    chi_idx = int(sum(residue_constants.chi_angles_mask[restype]) - 1)\n    restype_rigidgroup_is_ambiguous[restype, chi_idx + 4] = 1\n    restype_rigidgroup_rots[restype, chi_idx + 4, 1, 1] = -1\n    restype_rigidgroup_rots[restype, chi_idx + 4, 2, 2] = -1\n\n  # Gather the ambiguity information for each residue.\n  residx_rigidgroup_is_ambiguous = utils.batched_gather(\n      restype_rigidgroup_is_ambiguous, aatype)\n  residx_rigidgroup_ambiguity_rot = utils.batched_gather(\n      restype_rigidgroup_rots, aatype)\n\n  # Create the alternative ground truth frames.\n  alt_gt_frames = r3.rigids_mul_rots(\n      gt_frames, r3.rots_from_tensor3x3(residx_rigidgroup_ambiguity_rot))\n\n  gt_frames_flat12 = r3.rigids_to_tensor_flat12(gt_frames)\n  alt_gt_frames_flat12 = r3.rigids_to_tensor_flat12(alt_gt_frames)\n\n  # reshape back to original residue layout\n  gt_frames_flat12 = jnp.reshape(gt_frames_flat12, aatype_in_shape + (8, 12))\n  gt_exists = jnp.reshape(gt_exists, aatype_in_shape + (8,))\n  group_exists = jnp.reshape(group_exists, aatype_in_shape + (8,))\n  gt_frames_flat12 = jnp.reshape(gt_frames_flat12, aatype_in_shape + (8, 12))\n  residx_rigidgroup_is_ambiguous = jnp.reshape(residx_rigidgroup_is_ambiguous,\n                                               aatype_in_shape + (8,))\n  alt_gt_frames_flat12 = jnp.reshape(alt_gt_frames_flat12,\n                                     aatype_in_shape + (8, 12,))\n\n  return {\n      'rigidgroups_gt_frames': gt_frames_flat12,  # (..., 8, 12)\n      'rigidgroups_gt_exists': gt_exists,  # (..., 8)\n      'rigidgroups_group_exists': group_exists,  # (..., 8)\n      'rigidgroups_group_is_ambiguous':\n          residx_rigidgroup_is_ambiguous,  # (..., 8)\n      'rigidgroups_alt_gt_frames': alt_gt_frames_flat12,  # (..., 8, 12)\n  }\n\n\ndef atom37_to_torsion_angles(\n    aatype: jnp.ndarray,  # (B, N)\n    all_atom_pos: jnp.ndarray,  # (B, N, 37, 3)\n    all_atom_mask: jnp.ndarray,  # (B, N, 37)\n    placeholder_for_undefined=False,\n) -> Dict[str, jnp.ndarray]:\n  \"\"\"Computes the 7 torsion angles (in sin, cos encoding) for each residue.\n\n  The 7 torsion angles are in the order\n  '[pre_omega, phi, psi, chi_1, chi_2, chi_3, chi_4]',\n  here pre_omega denotes the omega torsion angle between the given amino acid\n  and the previous amino acid.\n\n  Args:\n    aatype: Amino acid type, given as array with integers.\n    all_atom_pos: atom37 representation of all atom coordinates.\n    all_atom_mask: atom37 representation of mask on all atom coordinates.\n    placeholder_for_undefined: flag denoting whether to set masked torsion\n      angles to zero.\n  Returns:\n    Dict containing:\n      * 'torsion_angles_sin_cos': Array with shape (B, N, 7, 2) where the final\n        2 dimensions denote sin and cos respectively\n      * 'alt_torsion_angles_sin_cos': same as 'torsion_angles_sin_cos', but\n        with the angle shifted by pi for all chi angles affected by the naming\n        ambiguities.\n      * 'torsion_angles_mask': Mask for which chi angles are present.\n  \"\"\"\n\n  # Map aatype > 20 to 'Unknown' (20).\n  aatype = jnp.minimum(aatype, 20)\n\n  # Compute the backbone angles.\n  num_batch, num_res = aatype.shape\n\n  pad = jnp.zeros([num_batch, 1, 37, 3], jnp.float32)\n  prev_all_atom_pos = jnp.concatenate([pad, all_atom_pos[:, :-1, :, :]], axis=1)\n\n  pad = jnp.zeros([num_batch, 1, 37], jnp.float32)\n  prev_all_atom_mask = jnp.concatenate([pad, all_atom_mask[:, :-1, :]], axis=1)\n\n  # For each torsion angle collect the 4 atom positions that define this angle.\n  # shape (B, N, atoms=4, xyz=3)\n  pre_omega_atom_pos = jnp.concatenate(\n      [prev_all_atom_pos[:, :, 1:3, :],  # prev CA, C\n       all_atom_pos[:, :, 0:2, :]  # this N, CA\n      ], axis=-2)\n  phi_atom_pos = jnp.concatenate(\n      [prev_all_atom_pos[:, :, 2:3, :],  # prev C\n       all_atom_pos[:, :, 0:3, :]  # this N, CA, C\n      ], axis=-2)\n  psi_atom_pos = jnp.concatenate(\n      [all_atom_pos[:, :, 0:3, :],  # this N, CA, C\n       all_atom_pos[:, :, 4:5, :]  # this O\n      ], axis=-2)\n\n  # Collect the masks from these atoms.\n  # Shape [batch, num_res]\n  pre_omega_mask = (\n      jnp.prod(prev_all_atom_mask[:, :, 1:3], axis=-1)  # prev CA, C\n      * jnp.prod(all_atom_mask[:, :, 0:2], axis=-1))  # this N, CA\n  phi_mask = (\n      prev_all_atom_mask[:, :, 2]  # prev C\n      * jnp.prod(all_atom_mask[:, :, 0:3], axis=-1))  # this N, CA, C\n  psi_mask = (\n      jnp.prod(all_atom_mask[:, :, 0:3], axis=-1) *  # this N, CA, C\n      all_atom_mask[:, :, 4])  # this O\n\n  # Collect the atoms for the chi-angles.\n  # Compute the table of chi angle indices. Shape: [restypes, chis=4, atoms=4].\n  chi_atom_indices = get_chi_atom_indices()\n  # Select atoms to compute chis. Shape: [batch, num_res, chis=4, atoms=4].\n  atom_indices = utils.batched_gather(\n      params=chi_atom_indices, indices=aatype, axis=0, batch_dims=0)\n  # Gather atom positions. Shape: [batch, num_res, chis=4, atoms=4, xyz=3].\n  chis_atom_pos = utils.batched_gather(\n      params=all_atom_pos, indices=atom_indices, axis=-2,\n      batch_dims=2)\n\n  # Copy the chi angle mask, add the UNKNOWN residue. Shape: [restypes, 4].\n  chi_angles_mask = list(residue_constants.chi_angles_mask)\n  chi_angles_mask.append([0.0, 0.0, 0.0, 0.0])\n  chi_angles_mask = jnp.asarray(chi_angles_mask)\n\n  # Compute the chi angle mask. I.e. which chis angles exist according to the\n  # aatype. Shape [batch, num_res, chis=4].\n  chis_mask = utils.batched_gather(params=chi_angles_mask, indices=aatype,\n                                   axis=0, batch_dims=0)\n\n  # Constrain the chis_mask to those chis, where the ground truth coordinates of\n  # all defining four atoms are available.\n  # Gather the chi angle atoms mask. Shape: [batch, num_res, chis=4, atoms=4].\n  chi_angle_atoms_mask = utils.batched_gather(\n      params=all_atom_mask, indices=atom_indices, axis=-1,\n      batch_dims=2)\n  # Check if all 4 chi angle atoms were set. Shape: [batch, num_res, chis=4].\n  chi_angle_atoms_mask = jnp.prod(chi_angle_atoms_mask, axis=[-1])\n  chis_mask = chis_mask * (chi_angle_atoms_mask).astype(jnp.float32)\n\n  # Stack all torsion angle atom positions.\n  # Shape (B, N, torsions=7, atoms=4, xyz=3)\n  torsions_atom_pos = jnp.concatenate(\n      [pre_omega_atom_pos[:, :, None, :, :],\n       phi_atom_pos[:, :, None, :, :],\n       psi_atom_pos[:, :, None, :, :],\n       chis_atom_pos\n      ], axis=2)\n\n  # Stack up masks for all torsion angles.\n  # shape (B, N, torsions=7)\n  torsion_angles_mask = jnp.concatenate(\n      [pre_omega_mask[:, :, None],\n       phi_mask[:, :, None],\n       psi_mask[:, :, None],\n       chis_mask\n      ], axis=2)\n\n  # Create a frame from the first three atoms:\n  # First atom: point on x-y-plane\n  # Second atom: point on negative x-axis\n  # Third atom: origin\n  # r3.Rigids (B, N, torsions=7)\n  torsion_frames = r3.rigids_from_3_points(\n      point_on_neg_x_axis=r3.vecs_from_tensor(torsions_atom_pos[:, :, :, 1, :]),\n      origin=r3.vecs_from_tensor(torsions_atom_pos[:, :, :, 2, :]),\n      point_on_xy_plane=r3.vecs_from_tensor(torsions_atom_pos[:, :, :, 0, :]))\n\n  # Compute the position of the forth atom in this frame (y and z coordinate\n  # define the chi angle)\n  # r3.Vecs (B, N, torsions=7)\n  forth_atom_rel_pos = r3.rigids_mul_vecs(\n      r3.invert_rigids(torsion_frames),\n      r3.vecs_from_tensor(torsions_atom_pos[:, :, :, 3, :]))\n\n  # Normalize to have the sin and cos of the torsion angle.\n  # jnp.ndarray (B, N, torsions=7, sincos=2)\n  torsion_angles_sin_cos = jnp.stack(\n      [forth_atom_rel_pos.z, forth_atom_rel_pos.y], axis=-1)\n  torsion_angles_sin_cos /= jnp.sqrt(\n      jnp.sum(jnp.square(torsion_angles_sin_cos), axis=-1, keepdims=True)\n      + 1e-8)\n\n  # Mirror psi, because we computed it from the Oxygen-atom.\n  torsion_angles_sin_cos *= jnp.asarray(\n      [1., 1., -1., 1., 1., 1., 1.])[None, None, :, None]\n\n  # Create alternative angles for ambiguous atom names.\n  chi_is_ambiguous = utils.batched_gather(\n      jnp.asarray(residue_constants.chi_pi_periodic), aatype)\n  mirror_torsion_angles = jnp.concatenate(\n      [jnp.ones([num_batch, num_res, 3]),\n       1.0 - 2.0 * chi_is_ambiguous], axis=-1)\n  alt_torsion_angles_sin_cos = (\n      torsion_angles_sin_cos * mirror_torsion_angles[:, :, :, None])\n\n  if placeholder_for_undefined:\n    # Add placeholder torsions in place of undefined torsion angles\n    # (e.g. N-terminus pre-omega)\n    placeholder_torsions = jnp.stack([\n        jnp.ones(torsion_angles_sin_cos.shape[:-1]),\n        jnp.zeros(torsion_angles_sin_cos.shape[:-1])\n    ], axis=-1)\n    torsion_angles_sin_cos = torsion_angles_sin_cos * torsion_angles_mask[\n        ..., None] + placeholder_torsions * (1 - torsion_angles_mask[..., None])\n    alt_torsion_angles_sin_cos = alt_torsion_angles_sin_cos * torsion_angles_mask[\n        ..., None] + placeholder_torsions * (1 - torsion_angles_mask[..., None])\n\n  return {\n      'torsion_angles_sin_cos': torsion_angles_sin_cos,  # (B, N, 7, 2)\n      'alt_torsion_angles_sin_cos': alt_torsion_angles_sin_cos,  # (B, N, 7, 2)\n      'torsion_angles_mask': torsion_angles_mask  # (B, N, 7)\n  }\n\n\ndef torsion_angles_to_frames(\n    aatype: jnp.ndarray,  # (N)\n    backb_to_global: r3.Rigids,  # (N)\n    torsion_angles_sin_cos: jnp.ndarray  # (N, 7, 2)\n) -> r3.Rigids:  # (N, 8)\n  \"\"\"Compute rigid group frames from torsion angles.\n\n  Jumper et al. (2021) Suppl. Alg. 24 \"computeAllAtomCoordinates\" lines 2-10\n  Jumper et al. (2021) Suppl. Alg. 25 \"makeRotX\"\n\n  Args:\n    aatype: aatype for each residue\n    backb_to_global: Rigid transformations describing transformation from\n      backbone frame to global frame.\n    torsion_angles_sin_cos: sin and cosine of the 7 torsion angles\n  Returns:\n    Frames corresponding to all the Sidechain Rigid Transforms\n  \"\"\"\n  assert len(aatype.shape) == 1\n  assert len(backb_to_global.rot.xx.shape) == 1\n  assert len(torsion_angles_sin_cos.shape) == 3\n  assert torsion_angles_sin_cos.shape[1] == 7\n  assert torsion_angles_sin_cos.shape[2] == 2\n\n  # Gather the default frames for all rigid groups.\n  # r3.Rigids with shape (N, 8)\n  m = utils.batched_gather(residue_constants.restype_rigid_group_default_frame,\n                           aatype)\n  default_frames = r3.rigids_from_tensor4x4(m)\n\n  # Create the rotation matrices according to the given angles (each frame is\n  # defined such that its rotation is around the x-axis).\n  sin_angles = torsion_angles_sin_cos[..., 0]\n  cos_angles = torsion_angles_sin_cos[..., 1]\n\n  # insert zero rotation for backbone group.\n  num_residues, = aatype.shape\n  sin_angles = jnp.concatenate([jnp.zeros([num_residues, 1]), sin_angles],\n                               axis=-1)\n  cos_angles = jnp.concatenate([jnp.ones([num_residues, 1]), cos_angles],\n                               axis=-1)\n  zeros = jnp.zeros_like(sin_angles)\n  ones = jnp.ones_like(sin_angles)\n\n  # all_rots are r3.Rots with shape (N, 8)\n  all_rots = r3.Rots(ones, zeros, zeros,\n                     zeros, cos_angles, -sin_angles,\n                     zeros, sin_angles, cos_angles)\n\n  # Apply rotations to the frames.\n  all_frames = r3.rigids_mul_rots(default_frames, all_rots)\n\n  # chi2, chi3, and chi4 frames do not transform to the backbone frame but to\n  # the previous frame. So chain them up accordingly.\n  chi2_frame_to_frame = jax.tree_map(lambda x: x[:, 5], all_frames)\n  chi3_frame_to_frame = jax.tree_map(lambda x: x[:, 6], all_frames)\n  chi4_frame_to_frame = jax.tree_map(lambda x: x[:, 7], all_frames)\n\n  chi1_frame_to_backb = jax.tree_map(lambda x: x[:, 4], all_frames)\n  chi2_frame_to_backb = r3.rigids_mul_rigids(chi1_frame_to_backb,\n                                             chi2_frame_to_frame)\n  chi3_frame_to_backb = r3.rigids_mul_rigids(chi2_frame_to_backb,\n                                             chi3_frame_to_frame)\n  chi4_frame_to_backb = r3.rigids_mul_rigids(chi3_frame_to_backb,\n                                             chi4_frame_to_frame)\n\n  # Recombine them to a r3.Rigids with shape (N, 8).\n  def _concat_frames(xall, x5, x6, x7):\n    return jnp.concatenate(\n        [xall[:, 0:5], x5[:, None], x6[:, None], x7[:, None]], axis=-1)\n\n  all_frames_to_backb = jax.tree_map(\n      _concat_frames,\n      all_frames,\n      chi2_frame_to_backb,\n      chi3_frame_to_backb,\n      chi4_frame_to_backb)\n\n  # Create the global frames.\n  # shape (N, 8)\n  all_frames_to_global = r3.rigids_mul_rigids(\n      jax.tree_map(lambda x: x[:, None], backb_to_global),\n      all_frames_to_backb)\n\n  return all_frames_to_global\n\n\ndef frames_and_literature_positions_to_atom14_pos(\n    aatype: jnp.ndarray,  # (N)\n    all_frames_to_global: r3.Rigids  # (N, 8)\n) -> r3.Vecs:  # (N, 14)\n  \"\"\"Put atom literature positions (atom14 encoding) in each rigid group.\n\n  Jumper et al. (2021) Suppl. Alg. 24 \"computeAllAtomCoordinates\" line 11\n\n  Args:\n    aatype: aatype for each residue.\n    all_frames_to_global: All per residue coordinate frames.\n  Returns:\n    Positions of all atom coordinates in global frame.\n  \"\"\"\n\n  # Pick the appropriate transform for every atom.\n  residx_to_group_idx = utils.batched_gather(\n      residue_constants.restype_atom14_to_rigid_group, aatype)\n  group_mask = jax.nn.one_hot(\n      residx_to_group_idx, num_classes=8)  # shape (N, 14, 8)\n\n  # r3.Rigids with shape (N, 14)\n  map_atoms_to_global = jax.tree_map(\n      lambda x: jnp.sum(x[:, None, :] * group_mask, axis=-1),\n      all_frames_to_global)\n\n  # Gather the literature atom positions for each residue.\n  # r3.Vecs with shape (N, 14)\n  lit_positions = r3.vecs_from_tensor(\n      utils.batched_gather(\n          residue_constants.restype_atom14_rigid_group_positions, aatype))\n\n  # Transform each atom from its local frame to the global frame.\n  # r3.Vecs with shape (N, 14)\n  pred_positions = r3.rigids_mul_vecs(map_atoms_to_global, lit_positions)\n\n  # Mask out non-existing atoms.\n  mask = utils.batched_gather(residue_constants.restype_atom14_mask, aatype)\n  pred_positions = jax.tree_map(lambda x: x * mask, pred_positions)\n\n  return pred_positions\n\n\ndef extreme_ca_ca_distance_violations(\n    pred_atom_positions: jnp.ndarray,  # (N, 37(14), 3)\n    pred_atom_mask: jnp.ndarray,  # (N, 37(14))\n    residue_index: jnp.ndarray,  # (N)\n    max_angstrom_tolerance=1.5\n    ) -> jnp.ndarray:\n  \"\"\"Counts residues whose Ca is a large distance from its neighbour.\n\n  Measures the fraction of CA-CA pairs between consecutive amino acids that are\n  more than 'max_angstrom_tolerance' apart.\n\n  Args:\n    pred_atom_positions: Atom positions in atom37/14 representation\n    pred_atom_mask: Atom mask in atom37/14 representation\n    residue_index: Residue index for given amino acid, this is assumed to be\n      monotonically increasing.\n    max_angstrom_tolerance: Maximum distance allowed to not count as violation.\n  Returns:\n    Fraction of consecutive CA-CA pairs with violation.\n  \"\"\"\n  this_ca_pos = pred_atom_positions[:-1, 1, :]  # (N - 1, 3)\n  this_ca_mask = pred_atom_mask[:-1, 1]         # (N - 1)\n  next_ca_pos = pred_atom_positions[1:, 1, :]  # (N - 1, 3)\n  next_ca_mask = pred_atom_mask[1:, 1]  # (N - 1)\n  has_no_gap_mask = ((residue_index[1:] - residue_index[:-1]) == 1.0).astype(\n      jnp.float32)\n  ca_ca_distance = jnp.sqrt(\n      1e-6 + jnp.sum(squared_difference(this_ca_pos, next_ca_pos), axis=-1))\n  violations = (ca_ca_distance -\n                residue_constants.ca_ca) > max_angstrom_tolerance\n  mask = this_ca_mask * next_ca_mask * has_no_gap_mask\n  return utils.mask_mean(mask=mask, value=violations)\n\n\ndef between_residue_bond_loss(\n    pred_atom_positions: jnp.ndarray,  # (N, 37(14), 3)\n    pred_atom_mask: jnp.ndarray,  # (N, 37(14))\n    residue_index: jnp.ndarray,  # (N)\n    aatype: jnp.ndarray,  # (N)\n    tolerance_factor_soft=12.0,\n    tolerance_factor_hard=12.0\n) -> Dict[str, jnp.ndarray]:\n  \"\"\"Flat-bottom loss to penalize structural violations between residues.\n\n  This is a loss penalizing any violation of the geometry around the peptide\n  bond between consecutive amino acids. This loss corresponds to\n  Jumper et al. (2021) Suppl. Sec. 1.9.11, eq 44, 45.\n\n  Args:\n    pred_atom_positions: Atom positions in atom37/14 representation\n    pred_atom_mask: Atom mask in atom37/14 representation\n    residue_index: Residue index for given amino acid, this is assumed to be\n      monotonically increasing.\n    aatype: Amino acid type of given residue\n    tolerance_factor_soft: soft tolerance factor measured in standard deviations\n      of pdb distributions\n    tolerance_factor_hard: hard tolerance factor measured in standard deviations\n      of pdb distributions\n\n  Returns:\n    Dict containing:\n      * 'c_n_loss_mean': Loss for peptide bond length violations\n      * 'ca_c_n_loss_mean': Loss for violations of bond angle around C spanned\n          by CA, C, N\n      * 'c_n_ca_loss_mean': Loss for violations of bond angle around N spanned\n          by C, N, CA\n      * 'per_residue_loss_sum': sum of all losses for each residue\n      * 'per_residue_violation_mask': mask denoting all residues with violation\n          present.\n  \"\"\"\n  assert len(pred_atom_positions.shape) == 3\n  assert len(pred_atom_mask.shape) == 2\n  assert len(residue_index.shape) == 1\n  assert len(aatype.shape) == 1\n\n  # Get the positions of the relevant backbone atoms.\n  this_ca_pos = pred_atom_positions[:-1, 1, :]  # (N - 1, 3)\n  this_ca_mask = pred_atom_mask[:-1, 1]         # (N - 1)\n  this_c_pos = pred_atom_positions[:-1, 2, :]   # (N - 1, 3)\n  this_c_mask = pred_atom_mask[:-1, 2]          # (N - 1)\n  next_n_pos = pred_atom_positions[1:, 0, :]    # (N - 1, 3)\n  next_n_mask = pred_atom_mask[1:, 0]           # (N - 1)\n  next_ca_pos = pred_atom_positions[1:, 1, :]   # (N - 1, 3)\n  next_ca_mask = pred_atom_mask[1:, 1]          # (N - 1)\n  has_no_gap_mask = ((residue_index[1:] - residue_index[:-1]) == 1.0).astype(\n      jnp.float32)\n\n  # Compute loss for the C--N bond.\n  c_n_bond_length = jnp.sqrt(\n      1e-6 + jnp.sum(squared_difference(this_c_pos, next_n_pos), axis=-1))\n\n  # The C-N bond to proline has slightly different length because of the ring.\n  next_is_proline = (\n      aatype[1:] == residue_constants.resname_to_idx['PRO']).astype(jnp.float32)\n  gt_length = (\n      (1. - next_is_proline) * residue_constants.between_res_bond_length_c_n[0]\n      + next_is_proline * residue_constants.between_res_bond_length_c_n[1])\n  gt_stddev = (\n      (1. - next_is_proline) *\n      residue_constants.between_res_bond_length_stddev_c_n[0] +\n      next_is_proline * residue_constants.between_res_bond_length_stddev_c_n[1])\n  c_n_bond_length_error = jnp.sqrt(1e-6 +\n                                   jnp.square(c_n_bond_length - gt_length))\n  c_n_loss_per_residue = jax.nn.relu(\n      c_n_bond_length_error - tolerance_factor_soft * gt_stddev)\n  mask = this_c_mask * next_n_mask * has_no_gap_mask\n  c_n_loss = jnp.sum(mask * c_n_loss_per_residue) / (jnp.sum(mask) + 1e-6)\n  c_n_violation_mask = mask * (\n      c_n_bond_length_error > (tolerance_factor_hard * gt_stddev))\n\n  # Compute loss for the angles.\n  ca_c_bond_length = jnp.sqrt(1e-6 + jnp.sum(\n      squared_difference(this_ca_pos, this_c_pos), axis=-1))\n  n_ca_bond_length = jnp.sqrt(1e-6 + jnp.sum(\n      squared_difference(next_n_pos, next_ca_pos), axis=-1))\n\n  c_ca_unit_vec = (this_ca_pos - this_c_pos) / ca_c_bond_length[:, None]\n  c_n_unit_vec = (next_n_pos - this_c_pos) / c_n_bond_length[:, None]\n  n_ca_unit_vec = (next_ca_pos - next_n_pos) / n_ca_bond_length[:, None]\n\n  ca_c_n_cos_angle = jnp.sum(c_ca_unit_vec * c_n_unit_vec, axis=-1)\n  gt_angle = residue_constants.between_res_cos_angles_ca_c_n[0]\n  gt_stddev = residue_constants.between_res_bond_length_stddev_c_n[0]\n  ca_c_n_cos_angle_error = jnp.sqrt(\n      1e-6 + jnp.square(ca_c_n_cos_angle - gt_angle))\n  ca_c_n_loss_per_residue = jax.nn.relu(\n      ca_c_n_cos_angle_error - tolerance_factor_soft * gt_stddev)\n  mask = this_ca_mask * this_c_mask * next_n_mask * has_no_gap_mask\n  ca_c_n_loss = jnp.sum(mask * ca_c_n_loss_per_residue) / (jnp.sum(mask) + 1e-6)\n  ca_c_n_violation_mask = mask * (ca_c_n_cos_angle_error >\n                                  (tolerance_factor_hard * gt_stddev))\n\n  c_n_ca_cos_angle = jnp.sum((-c_n_unit_vec) * n_ca_unit_vec, axis=-1)\n  gt_angle = residue_constants.between_res_cos_angles_c_n_ca[0]\n  gt_stddev = residue_constants.between_res_cos_angles_c_n_ca[1]\n  c_n_ca_cos_angle_error = jnp.sqrt(\n      1e-6 + jnp.square(c_n_ca_cos_angle - gt_angle))\n  c_n_ca_loss_per_residue = jax.nn.relu(\n      c_n_ca_cos_angle_error - tolerance_factor_soft * gt_stddev)\n  mask = this_c_mask * next_n_mask * next_ca_mask * has_no_gap_mask\n  c_n_ca_loss = jnp.sum(mask * c_n_ca_loss_per_residue) / (jnp.sum(mask) + 1e-6)\n  c_n_ca_violation_mask = mask * (\n      c_n_ca_cos_angle_error > (tolerance_factor_hard * gt_stddev))\n\n  # Compute a per residue loss (equally distribute the loss to both\n  # neighbouring residues).\n  per_residue_loss_sum = (c_n_loss_per_residue +\n                          ca_c_n_loss_per_residue +\n                          c_n_ca_loss_per_residue)\n  per_residue_loss_sum = 0.5 * (jnp.pad(per_residue_loss_sum, [[0, 1]]) +\n                                jnp.pad(per_residue_loss_sum, [[1, 0]]))\n\n  # Compute hard violations.\n  violation_mask = jnp.max(\n      jnp.stack([c_n_violation_mask,\n                 ca_c_n_violation_mask,\n                 c_n_ca_violation_mask]), axis=0)\n  violation_mask = jnp.maximum(\n      jnp.pad(violation_mask, [[0, 1]]),\n      jnp.pad(violation_mask, [[1, 0]]))\n\n  return {'c_n_loss_mean': c_n_loss,  # shape ()\n          'ca_c_n_loss_mean': ca_c_n_loss,  # shape ()\n          'c_n_ca_loss_mean': c_n_ca_loss,  # shape ()\n          'per_residue_loss_sum': per_residue_loss_sum,  # shape (N)\n          'per_residue_violation_mask': violation_mask  # shape (N)\n         }\n\n\ndef between_residue_clash_loss(\n    atom14_pred_positions: jnp.ndarray,  # (N, 14, 3)\n    atom14_atom_exists: jnp.ndarray,  # (N, 14)\n    atom14_atom_radius: jnp.ndarray,  # (N, 14)\n    residue_index: jnp.ndarray,  # (N)\n    overlap_tolerance_soft=1.5,\n    overlap_tolerance_hard=1.5\n) -> Dict[str, jnp.ndarray]:\n  \"\"\"Loss to penalize steric clashes between residues.\n\n  This is a loss penalizing any steric clashes due to non bonded atoms in\n  different peptides coming too close. This loss corresponds to the part with\n  different residues of\n  Jumper et al. (2021) Suppl. Sec. 1.9.11, eq 46.\n\n  Args:\n    atom14_pred_positions: Predicted positions of atoms in\n      global prediction frame\n    atom14_atom_exists: Mask denoting whether atom at positions exists for given\n      amino acid type\n    atom14_atom_radius: Van der Waals radius for each atom.\n    residue_index: Residue index for given amino acid.\n    overlap_tolerance_soft: Soft tolerance factor.\n    overlap_tolerance_hard: Hard tolerance factor.\n\n  Returns:\n    Dict containing:\n      * 'mean_loss': average clash loss\n      * 'per_atom_loss_sum': sum of all clash losses per atom, shape (N, 14)\n      * 'per_atom_clash_mask': mask whether atom clashes with any other atom\n          shape (N, 14)\n  \"\"\"\n  assert len(atom14_pred_positions.shape) == 3\n  assert len(atom14_atom_exists.shape) == 2\n  assert len(atom14_atom_radius.shape) == 2\n  assert len(residue_index.shape) == 1\n\n  # Create the distance matrix.\n  # (N, N, 14, 14)\n  dists = jnp.sqrt(1e-10 + jnp.sum(\n      squared_difference(\n          atom14_pred_positions[:, None, :, None, :],\n          atom14_pred_positions[None, :, None, :, :]),\n      axis=-1))\n\n  # Create the mask for valid distances.\n  # shape (N, N, 14, 14)\n  dists_mask = (atom14_atom_exists[:, None, :, None] *\n                atom14_atom_exists[None, :, None, :])\n\n  # Mask out all the duplicate entries in the lower triangular matrix.\n  # Also mask out the diagonal (atom-pairs from the same residue) -- these atoms\n  # are handled separately.\n  dists_mask *= (\n      residue_index[:, None, None, None] < residue_index[None, :, None, None])\n\n  # Backbone C--N bond between subsequent residues is no clash.\n  c_one_hot = jax.nn.one_hot(2, num_classes=14)\n  n_one_hot = jax.nn.one_hot(0, num_classes=14)\n  neighbour_mask = ((residue_index[:, None, None, None] +\n                     1) == residue_index[None, :, None, None])\n  c_n_bonds = neighbour_mask * c_one_hot[None, None, :,\n                                         None] * n_one_hot[None, None, None, :]\n  dists_mask *= (1. - c_n_bonds)\n\n  # Disulfide bridge between two cysteines is no clash.\n  cys_sg_idx = residue_constants.restype_name_to_atom14_names['CYS'].index('SG')\n  cys_sg_one_hot = jax.nn.one_hot(cys_sg_idx, num_classes=14)\n  disulfide_bonds = (cys_sg_one_hot[None, None, :, None] *\n                     cys_sg_one_hot[None, None, None, :])\n  dists_mask *= (1. - disulfide_bonds)\n\n  # Compute the lower bound for the allowed distances.\n  # shape (N, N, 14, 14)\n  dists_lower_bound = dists_mask * (atom14_atom_radius[:, None, :, None] +\n                                    atom14_atom_radius[None, :, None, :])\n\n  # Compute the error.\n  # shape (N, N, 14, 14)\n  dists_to_low_error = dists_mask * jax.nn.relu(\n      dists_lower_bound - overlap_tolerance_soft - dists)\n\n  # Compute the mean loss.\n  # shape ()\n  mean_loss = (jnp.sum(dists_to_low_error)\n               / (1e-6 + jnp.sum(dists_mask)))\n\n  # Compute the per atom loss sum.\n  # shape (N, 14)\n  per_atom_loss_sum = (jnp.sum(dists_to_low_error, axis=[0, 2]) +\n                       jnp.sum(dists_to_low_error, axis=[1, 3]))\n\n  # Compute the hard clash mask.\n  # shape (N, N, 14, 14)\n  clash_mask = dists_mask * (\n      dists < (dists_lower_bound - overlap_tolerance_hard))\n\n  # Compute the per atom clash.\n  # shape (N, 14)\n  per_atom_clash_mask = jnp.maximum(\n      jnp.max(clash_mask, axis=[0, 2]),\n      jnp.max(clash_mask, axis=[1, 3]))\n\n  return {'mean_loss': mean_loss,  # shape ()\n          'per_atom_loss_sum': per_atom_loss_sum,  # shape (N, 14)\n          'per_atom_clash_mask': per_atom_clash_mask  # shape (N, 14)\n         }\n\n\ndef within_residue_violations(\n    atom14_pred_positions: jnp.ndarray,  # (N, 14, 3)\n    atom14_atom_exists: jnp.ndarray,  # (N, 14)\n    atom14_dists_lower_bound: jnp.ndarray,  # (N, 14, 14)\n    atom14_dists_upper_bound: jnp.ndarray,  # (N, 14, 14)\n    tighten_bounds_for_loss=0.0,\n) -> Dict[str, jnp.ndarray]:\n  \"\"\"Loss to penalize steric clashes within residues.\n\n  This is a loss penalizing any steric violations or clashes of non-bonded atoms\n  in a given peptide. This loss corresponds to the part with\n  the same residues of\n  Jumper et al. (2021) Suppl. Sec. 1.9.11, eq 46.\n\n  Args:\n    atom14_pred_positions: Predicted positions of atoms in\n      global prediction frame\n    atom14_atom_exists: Mask denoting whether atom at positions exists for given\n      amino acid type\n    atom14_dists_lower_bound: Lower bound on allowed distances.\n    atom14_dists_upper_bound: Upper bound on allowed distances\n    tighten_bounds_for_loss: Extra factor to tighten loss\n\n  Returns:\n    Dict containing:\n      * 'per_atom_loss_sum': sum of all clash losses per atom, shape (N, 14)\n      * 'per_atom_clash_mask': mask whether atom clashes with any other atom\n          shape (N, 14)\n  \"\"\"\n  assert len(atom14_pred_positions.shape) == 3\n  assert len(atom14_atom_exists.shape) == 2\n  assert len(atom14_dists_lower_bound.shape) == 3\n  assert len(atom14_dists_upper_bound.shape) == 3\n\n  # Compute the mask for each residue.\n  # shape (N, 14, 14)\n  dists_masks = (1. - jnp.eye(14, 14)[None])\n  dists_masks *= (atom14_atom_exists[:, :, None] *\n                  atom14_atom_exists[:, None, :])\n\n  # Distance matrix\n  # shape (N, 14, 14)\n  dists = jnp.sqrt(1e-10 + jnp.sum(\n      squared_difference(\n          atom14_pred_positions[:, :, None, :],\n          atom14_pred_positions[:, None, :, :]),\n      axis=-1))\n\n  # Compute the loss.\n  # shape (N, 14, 14)\n  dists_to_low_error = jax.nn.relu(\n      atom14_dists_lower_bound + tighten_bounds_for_loss - dists)\n  dists_to_high_error = jax.nn.relu(\n      dists - (atom14_dists_upper_bound - tighten_bounds_for_loss))\n  loss = dists_masks * (dists_to_low_error + dists_to_high_error)\n\n  # Compute the per atom loss sum.\n  # shape (N, 14)\n  per_atom_loss_sum = (jnp.sum(loss, axis=1) +\n                       jnp.sum(loss, axis=2))\n\n  # Compute the violations mask.\n  # shape (N, 14, 14)\n  violations = dists_masks * ((dists < atom14_dists_lower_bound) |\n                              (dists > atom14_dists_upper_bound))\n\n  # Compute the per atom violations.\n  # shape (N, 14)\n  per_atom_violations = jnp.maximum(\n      jnp.max(violations, axis=1), jnp.max(violations, axis=2))\n\n  return {'per_atom_loss_sum': per_atom_loss_sum,  # shape (N, 14)\n          'per_atom_violations': per_atom_violations  # shape (N, 14)\n         }\n\n\ndef find_optimal_renaming(\n    atom14_gt_positions: jnp.ndarray,  # (N, 14, 3)\n    atom14_alt_gt_positions: jnp.ndarray,  # (N, 14, 3)\n    atom14_atom_is_ambiguous: jnp.ndarray,  # (N, 14)\n    atom14_gt_exists: jnp.ndarray,  # (N, 14)\n    atom14_pred_positions: jnp.ndarray,  # (N, 14, 3)\n    atom14_atom_exists: jnp.ndarray,  # (N, 14)\n) -> jnp.ndarray:  # (N):\n  \"\"\"Find optimal renaming for ground truth that maximizes LDDT.\n\n  Jumper et al. (2021) Suppl. Alg. 26\n  \"renameSymmetricGroundTruthAtoms\" lines 1-5\n\n  Args:\n    atom14_gt_positions: Ground truth positions in global frame of ground truth.\n    atom14_alt_gt_positions: Alternate ground truth positions in global frame of\n      ground truth with coordinates of ambiguous atoms swapped relative to\n      'atom14_gt_positions'.\n    atom14_atom_is_ambiguous: Mask denoting whether atom is among ambiguous\n      atoms, see Jumper et al. (2021) Suppl. Table 3\n    atom14_gt_exists: Mask denoting whether atom at positions exists in ground\n      truth.\n    atom14_pred_positions: Predicted positions of atoms in\n      global prediction frame\n    atom14_atom_exists: Mask denoting whether atom at positions exists for given\n      amino acid type\n\n  Returns:\n    Float array of shape [N] with 1. where atom14_alt_gt_positions is closer to\n    prediction and 0. otherwise\n  \"\"\"\n  assert len(atom14_gt_positions.shape) == 3\n  assert len(atom14_alt_gt_positions.shape) == 3\n  assert len(atom14_atom_is_ambiguous.shape) == 2\n  assert len(atom14_gt_exists.shape) == 2\n  assert len(atom14_pred_positions.shape) == 3\n  assert len(atom14_atom_exists.shape) == 2\n\n  # Create the pred distance matrix.\n  # shape (N, N, 14, 14)\n  pred_dists = jnp.sqrt(1e-10 + jnp.sum(\n      squared_difference(\n          atom14_pred_positions[:, None, :, None, :],\n          atom14_pred_positions[None, :, None, :, :]),\n      axis=-1))\n\n  # Compute distances for ground truth with original and alternative names.\n  # shape (N, N, 14, 14)\n  gt_dists = jnp.sqrt(1e-10 + jnp.sum(\n      squared_difference(\n          atom14_gt_positions[:, None, :, None, :],\n          atom14_gt_positions[None, :, None, :, :]),\n      axis=-1))\n  alt_gt_dists = jnp.sqrt(1e-10 + jnp.sum(\n      squared_difference(\n          atom14_alt_gt_positions[:, None, :, None, :],\n          atom14_alt_gt_positions[None, :, None, :, :]),\n      axis=-1))\n\n  # Compute LDDT's.\n  # shape (N, N, 14, 14)\n  lddt = jnp.sqrt(1e-10 + squared_difference(pred_dists, gt_dists))\n  alt_lddt = jnp.sqrt(1e-10 + squared_difference(pred_dists, alt_gt_dists))\n\n  # Create a mask for ambiguous atoms in rows vs. non-ambiguous atoms\n  # in cols.\n  # shape (N ,N, 14, 14)\n  mask = (atom14_gt_exists[:, None, :, None] *  # rows\n          atom14_atom_is_ambiguous[:, None, :, None] *  # rows\n          atom14_gt_exists[None, :, None, :] *  # cols\n          (1. - atom14_atom_is_ambiguous[None, :, None, :]))  # cols\n\n  # Aggregate distances for each residue to the non-amibuguous atoms.\n  # shape (N)\n  per_res_lddt = jnp.sum(mask * lddt, axis=[1, 2, 3])\n  alt_per_res_lddt = jnp.sum(mask * alt_lddt, axis=[1, 2, 3])\n\n  # Decide for each residue, whether alternative naming is better.\n  # shape (N)\n  alt_naming_is_better = (alt_per_res_lddt < per_res_lddt).astype(jnp.float32)\n\n  return alt_naming_is_better  # shape (N)\n\n\ndef frame_aligned_point_error(\n    pred_frames: r3.Rigids,  # shape (num_frames)\n    target_frames: r3.Rigids,  # shape (num_frames)\n    frames_mask: jnp.ndarray,  # shape (num_frames)\n    pred_positions: r3.Vecs,  # shape (num_positions)\n    target_positions: r3.Vecs,  # shape (num_positions)\n    positions_mask: jnp.ndarray,  # shape (num_positions)\n    length_scale: float,\n    l1_clamp_distance: Optional[float] = None,\n    epsilon=1e-4) -> jnp.ndarray:  # shape ()\n  \"\"\"Measure point error under different alignments.\n\n  Jumper et al. (2021) Suppl. Alg. 28 \"computeFAPE\"\n\n  Computes error between two structures with B points under A alignments derived\n  from the given pairs of frames.\n  Args:\n    pred_frames: num_frames reference frames for 'pred_positions'.\n    target_frames: num_frames reference frames for 'target_positions'.\n    frames_mask: Mask for frame pairs to use.\n    pred_positions: num_positions predicted positions of the structure.\n    target_positions: num_positions target positions of the structure.\n    positions_mask: Mask on which positions to score.\n    length_scale: length scale to divide loss by.\n    l1_clamp_distance: Distance cutoff on error beyond which gradients will\n      be zero.\n    epsilon: small value used to regularize denominator for masked average.\n  Returns:\n    Masked Frame Aligned Point Error.\n  \"\"\"\n  assert pred_frames.rot.xx.ndim == 1\n  assert target_frames.rot.xx.ndim == 1\n  assert frames_mask.ndim == 1, frames_mask.ndim\n  assert pred_positions.x.ndim == 1\n  assert target_positions.x.ndim == 1\n  assert positions_mask.ndim == 1\n\n  # Compute array of predicted positions in the predicted frames.\n  # r3.Vecs (num_frames, num_positions)\n  local_pred_pos = r3.rigids_mul_vecs(\n      jax.tree_map(lambda r: r[:, None], r3.invert_rigids(pred_frames)),\n      jax.tree_map(lambda x: x[None, :], pred_positions))\n\n  # Compute array of target positions in the target frames.\n  # r3.Vecs (num_frames, num_positions)\n  local_target_pos = r3.rigids_mul_vecs(\n      jax.tree_map(lambda r: r[:, None], r3.invert_rigids(target_frames)),\n      jax.tree_map(lambda x: x[None, :], target_positions))\n\n  # Compute errors between the structures.\n  # jnp.ndarray (num_frames, num_positions)\n  error_dist = jnp.sqrt(\n      r3.vecs_squared_distance(local_pred_pos, local_target_pos)\n      + epsilon)\n\n  if l1_clamp_distance:\n    error_dist = jnp.clip(error_dist, 0, l1_clamp_distance)\n\n  normed_error = error_dist / length_scale\n  normed_error *= jnp.expand_dims(frames_mask, axis=-1)\n  normed_error *= jnp.expand_dims(positions_mask, axis=-2)\n\n  normalization_factor = (\n      jnp.sum(frames_mask, axis=-1) *\n      jnp.sum(positions_mask, axis=-1))\n  return (jnp.sum(normed_error, axis=(-2, -1)) /\n          (epsilon + normalization_factor))\n\n\ndef _make_renaming_matrices():\n  \"\"\"Matrices to map atoms to symmetry partners in ambiguous case.\"\"\"\n  # As the atom naming is ambiguous for 7 of the 20 amino acids, provide\n  # alternative groundtruth coordinates where the naming is swapped\n  restype_3 = [\n      residue_constants.restype_1to3[res] for res in residue_constants.restypes\n  ]\n  restype_3 += ['UNK']\n  # Matrices for renaming ambiguous atoms.\n  all_matrices = {res: np.eye(14, dtype=np.float32) for res in restype_3}\n  for resname, swap in residue_constants.residue_atom_renaming_swaps.items():\n    correspondences = np.arange(14)\n    for source_atom_swap, target_atom_swap in swap.items():\n      source_index = residue_constants.restype_name_to_atom14_names[\n          resname].index(source_atom_swap)\n      target_index = residue_constants.restype_name_to_atom14_names[\n          resname].index(target_atom_swap)\n      correspondences[source_index] = target_index\n      correspondences[target_index] = source_index\n      renaming_matrix = np.zeros((14, 14), dtype=np.float32)\n      for index, correspondence in enumerate(correspondences):\n        renaming_matrix[index, correspondence] = 1.\n    all_matrices[resname] = renaming_matrix.astype(np.float32)\n  renaming_matrices = np.stack([all_matrices[restype] for restype in restype_3])\n  return renaming_matrices\n\n\nRENAMING_MATRICES = _make_renaming_matrices()\n\n\ndef get_alt_atom14(aatype, positions, mask):\n  \"\"\"Get alternative atom14 positions.\n\n  Constructs renamed atom positions for ambiguous residues.\n\n  Jumper et al. (2021) Suppl. Table 3 \"Ambiguous atom names due to 180 degree-\n  rotation-symmetry\"\n\n  Args:\n    aatype: Amino acid at given position\n    positions: Atom positions as r3.Vecs in atom14 representation, (N, 14)\n    mask: Atom masks in atom14 representation, (N, 14)\n  Returns:\n    renamed atom positions, renamed atom mask\n  \"\"\"\n  # pick the transformation matrices for the given residue sequence\n  # shape (num_res, 14, 14)\n  renaming_transform = utils.batched_gather(\n      jnp.asarray(RENAMING_MATRICES), aatype)\n\n  positions = jax.tree_map(lambda x: x[:, :, None], positions)\n  alternative_positions = jax.tree_map(\n      lambda x: jnp.sum(x, axis=1), positions * renaming_transform)\n\n  # Create the mask for the alternative ground truth (differs from the\n  # ground truth mask, if only one of the atoms in an ambiguous pair has a\n  # ground truth position)\n  alternative_mask = jnp.sum(mask[..., None] * renaming_transform, axis=1)\n\n  return alternative_positions, alternative_mask\n"
  },
  {
    "path": "alphafold/model/all_atom_multimer.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Ops for all atom representations.\"\"\"\n\nfrom typing import Dict, Text\n\nfrom alphafold.common import residue_constants\nfrom alphafold.model import geometry\nfrom alphafold.model import utils\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\n\ndef squared_difference(x, y):\n  return jnp.square(x - y)\n\n\ndef _make_chi_atom_indices():\n  \"\"\"Returns atom indices needed to compute chi angles for all residue types.\n\n  Returns:\n    A tensor of shape [residue_types=21, chis=4, atoms=4]. The residue types are\n    in the order specified in residue_constants.restypes + unknown residue type\n    at the end. For chi angles which are not defined on the residue, the\n    positions indices are by default set to 0.\n  \"\"\"\n  chi_atom_indices = []\n  for residue_name in residue_constants.restypes:\n    residue_name = residue_constants.restype_1to3[residue_name]\n    residue_chi_angles = residue_constants.chi_angles_atoms[residue_name]\n    atom_indices = []\n    for chi_angle in residue_chi_angles:\n      atom_indices.append(\n          [residue_constants.atom_order[atom] for atom in chi_angle])\n    for _ in range(4 - len(atom_indices)):\n      atom_indices.append([0, 0, 0, 0])  # For chi angles not defined on the AA.\n    chi_atom_indices.append(atom_indices)\n\n  chi_atom_indices.append([[0, 0, 0, 0]] * 4)  # For UNKNOWN residue.\n\n  return np.array(chi_atom_indices)\n\n\ndef _make_renaming_matrices():\n  \"\"\"Matrices to map atoms to symmetry partners in ambiguous case.\"\"\"\n  # As the atom naming is ambiguous for 7 of the 20 amino acids, provide\n  # alternative groundtruth coordinates where the naming is swapped\n  restype_3 = [\n      residue_constants.restype_1to3[res] for res in residue_constants.restypes\n  ]\n  restype_3 += ['UNK']\n  # Matrices for renaming ambiguous atoms.\n  all_matrices = {res: np.eye(14, dtype=np.float32) for res in restype_3}\n  for resname, swap in residue_constants.residue_atom_renaming_swaps.items():\n    correspondences = np.arange(14)\n    for source_atom_swap, target_atom_swap in swap.items():\n      source_index = residue_constants.restype_name_to_atom14_names[\n          resname].index(source_atom_swap)\n      target_index = residue_constants.restype_name_to_atom14_names[\n          resname].index(target_atom_swap)\n      correspondences[source_index] = target_index\n      correspondences[target_index] = source_index\n      renaming_matrix = np.zeros((14, 14), dtype=np.float32)\n      for index, correspondence in enumerate(correspondences):\n        renaming_matrix[index, correspondence] = 1.\n    all_matrices[resname] = renaming_matrix.astype(np.float32)\n  renaming_matrices = np.stack([all_matrices[restype] for restype in restype_3])\n  return renaming_matrices\n\n\ndef _make_restype_atom37_mask():\n  \"\"\"Mask of which atoms are present for which residue type in atom37.\"\"\"\n  # create the corresponding mask\n  restype_atom37_mask = np.zeros([21, 37], dtype=np.float32)\n  for restype, restype_letter in enumerate(residue_constants.restypes):\n    restype_name = residue_constants.restype_1to3[restype_letter]\n    atom_names = residue_constants.residue_atoms[restype_name]\n    for atom_name in atom_names:\n      atom_type = residue_constants.atom_order[atom_name]\n      restype_atom37_mask[restype, atom_type] = 1\n  return restype_atom37_mask\n\n\ndef _make_restype_atom14_mask():\n  \"\"\"Mask of which atoms are present for which residue type in atom14.\"\"\"\n  restype_atom14_mask = []\n\n  for rt in residue_constants.restypes:\n    atom_names = residue_constants.restype_name_to_atom14_names[\n        residue_constants.restype_1to3[rt]]\n    restype_atom14_mask.append([(1. if name else 0.) for name in atom_names])\n\n  restype_atom14_mask.append([0.] * 14)\n  restype_atom14_mask = np.array(restype_atom14_mask, dtype=np.float32)\n  return restype_atom14_mask\n\n\ndef _make_restype_atom37_to_atom14():\n  \"\"\"Map from atom37 to atom14 per residue type.\"\"\"\n  restype_atom37_to_atom14 = []  # mapping (restype, atom37) --> atom14\n  for rt in residue_constants.restypes:\n    atom_names = residue_constants.restype_name_to_atom14_names[\n        residue_constants.restype_1to3[rt]]\n    atom_name_to_idx14 = {name: i for i, name in enumerate(atom_names)}\n    restype_atom37_to_atom14.append([\n        (atom_name_to_idx14[name] if name in atom_name_to_idx14 else 0)\n        for name in residue_constants.atom_types\n    ])\n\n  restype_atom37_to_atom14.append([0] * 37)\n  restype_atom37_to_atom14 = np.array(restype_atom37_to_atom14, dtype=np.int32)\n  return restype_atom37_to_atom14\n\n\ndef _make_restype_atom14_to_atom37():\n  \"\"\"Map from atom14 to atom37 per residue type.\"\"\"\n  restype_atom14_to_atom37 = []  # mapping (restype, atom14) --> atom37\n  for rt in residue_constants.restypes:\n    atom_names = residue_constants.restype_name_to_atom14_names[\n        residue_constants.restype_1to3[rt]]\n    restype_atom14_to_atom37.append([\n        (residue_constants.atom_order[name] if name else 0)\n        for name in atom_names\n    ])\n  # Add dummy mapping for restype 'UNK'\n  restype_atom14_to_atom37.append([0] * 14)\n  restype_atom14_to_atom37 = np.array(restype_atom14_to_atom37, dtype=np.int32)\n  return restype_atom14_to_atom37\n\n\ndef _make_restype_atom14_is_ambiguous():\n  \"\"\"Mask which atoms are ambiguous in atom14.\"\"\"\n  # create an ambiguous atoms mask.  shape: (21, 14)\n  restype_atom14_is_ambiguous = np.zeros((21, 14), dtype=np.float32)\n  for resname, swap in residue_constants.residue_atom_renaming_swaps.items():\n    for atom_name1, atom_name2 in swap.items():\n      restype = residue_constants.restype_order[\n          residue_constants.restype_3to1[resname]]\n      atom_idx1 = residue_constants.restype_name_to_atom14_names[resname].index(\n          atom_name1)\n      atom_idx2 = residue_constants.restype_name_to_atom14_names[resname].index(\n          atom_name2)\n      restype_atom14_is_ambiguous[restype, atom_idx1] = 1\n      restype_atom14_is_ambiguous[restype, atom_idx2] = 1\n\n  return restype_atom14_is_ambiguous\n\n\ndef _make_restype_rigidgroup_base_atom37_idx():\n  \"\"\"Create Map from rigidgroups to atom37 indices.\"\"\"\n  # Create an array with the atom names.\n  # shape (num_restypes, num_rigidgroups, 3_atoms): (21, 8, 3)\n  base_atom_names = np.full([21, 8, 3], '', dtype=object)\n\n  # 0: backbone frame\n  base_atom_names[:, 0, :] = ['C', 'CA', 'N']\n\n  # 3: 'psi-group'\n  base_atom_names[:, 3, :] = ['CA', 'C', 'O']\n\n  # 4,5,6,7: 'chi1,2,3,4-group'\n  for restype, restype_letter in enumerate(residue_constants.restypes):\n    resname = residue_constants.restype_1to3[restype_letter]\n    for chi_idx in range(4):\n      if residue_constants.chi_angles_mask[restype][chi_idx]:\n        atom_names = residue_constants.chi_angles_atoms[resname][chi_idx]\n        base_atom_names[restype, chi_idx + 4, :] = atom_names[1:]\n\n  # Translate atom names into atom37 indices.\n  lookuptable = residue_constants.atom_order.copy()\n  lookuptable[''] = 0\n  restype_rigidgroup_base_atom37_idx = np.vectorize(lambda x: lookuptable[x])(\n      base_atom_names)\n  return restype_rigidgroup_base_atom37_idx\n\n\nCHI_ATOM_INDICES = _make_chi_atom_indices()\nRENAMING_MATRICES = _make_renaming_matrices()\nRESTYPE_ATOM14_TO_ATOM37 = _make_restype_atom14_to_atom37()\nRESTYPE_ATOM37_TO_ATOM14 = _make_restype_atom37_to_atom14()\nRESTYPE_ATOM37_MASK = _make_restype_atom37_mask()\nRESTYPE_ATOM14_MASK = _make_restype_atom14_mask()\nRESTYPE_ATOM14_IS_AMBIGUOUS = _make_restype_atom14_is_ambiguous()\nRESTYPE_RIGIDGROUP_BASE_ATOM37_IDX = _make_restype_rigidgroup_base_atom37_idx()\n\n# Create mask for existing rigid groups.\nRESTYPE_RIGIDGROUP_MASK = np.zeros([21, 8], dtype=np.float32)\nRESTYPE_RIGIDGROUP_MASK[:, 0] = 1\nRESTYPE_RIGIDGROUP_MASK[:, 3] = 1\nRESTYPE_RIGIDGROUP_MASK[:20, 4:] = residue_constants.chi_angles_mask\n\n\ndef get_atom37_mask(aatype):\n  return utils.batched_gather(jnp.asarray(RESTYPE_ATOM37_MASK), aatype)\n\n\ndef get_atom14_mask(aatype):\n  return utils.batched_gather(jnp.asarray(RESTYPE_ATOM14_MASK), aatype)\n\n\ndef get_atom14_is_ambiguous(aatype):\n  return utils.batched_gather(jnp.asarray(RESTYPE_ATOM14_IS_AMBIGUOUS), aatype)\n\n\ndef get_atom14_to_atom37_map(aatype):\n  return utils.batched_gather(jnp.asarray(RESTYPE_ATOM14_TO_ATOM37), aatype)\n\n\ndef get_atom37_to_atom14_map(aatype):\n  return utils.batched_gather(jnp.asarray(RESTYPE_ATOM37_TO_ATOM14), aatype)\n\n\ndef atom14_to_atom37(atom14_data: jnp.ndarray,  # (N, 14, ...)\n                     aatype: jnp.ndarray\n                    ) -> jnp.ndarray:  # (N, 37, ...)\n  \"\"\"Convert atom14 to atom37 representation.\"\"\"\n  assert len(atom14_data.shape) in [2, 3]\n  idx_atom37_to_atom14 = get_atom37_to_atom14_map(aatype)\n  atom37_data = utils.batched_gather(\n      atom14_data, idx_atom37_to_atom14, batch_dims=1)\n  atom37_mask = get_atom37_mask(aatype)\n  if len(atom14_data.shape) == 2:\n    atom37_data *= atom37_mask\n  elif len(atom14_data.shape) == 3:\n    atom37_data *= atom37_mask[:, :, None].astype(atom37_data.dtype)\n  return atom37_data\n\n\ndef atom37_to_atom14(aatype, all_atom_pos, all_atom_mask):\n  \"\"\"Convert Atom37 positions to Atom14 positions.\"\"\"\n  residx_atom14_to_atom37 = utils.batched_gather(\n      jnp.asarray(RESTYPE_ATOM14_TO_ATOM37), aatype)\n  atom14_mask = utils.batched_gather(\n      all_atom_mask, residx_atom14_to_atom37, batch_dims=1).astype(jnp.float32)\n  # create a mask for known groundtruth positions\n  atom14_mask *= utils.batched_gather(jnp.asarray(RESTYPE_ATOM14_MASK), aatype)\n  # gather the groundtruth positions\n  atom14_positions = jax.tree_map(\n      lambda x: utils.batched_gather(x, residx_atom14_to_atom37, batch_dims=1),\n      all_atom_pos)\n  atom14_positions = atom14_mask * atom14_positions\n  return atom14_positions, atom14_mask\n\n\ndef get_alt_atom14(aatype, positions: geometry.Vec3Array, mask):\n  \"\"\"Get alternative atom14 positions.\"\"\"\n  # pick the transformation matrices for the given residue sequence\n  # shape (num_res, 14, 14)\n  renaming_transform = utils.batched_gather(\n      jnp.asarray(RENAMING_MATRICES), aatype)\n\n  alternative_positions = jax.tree_map(\n      lambda x: jnp.sum(x, axis=1), positions[:, :, None] * renaming_transform)\n\n  # Create the mask for the alternative ground truth (differs from the\n  # ground truth mask, if only one of the atoms in an ambiguous pair has a\n  # ground truth position)\n  alternative_mask = jnp.sum(mask[..., None] * renaming_transform, axis=1)\n\n  return alternative_positions, alternative_mask\n\n\ndef atom37_to_frames(\n    aatype: jnp.ndarray,  # (...)\n    all_atom_positions: geometry.Vec3Array,  # (..., 37)\n    all_atom_mask: jnp.ndarray,  # (..., 37)\n) -> Dict[Text, jnp.ndarray]:\n  \"\"\"Computes the frames for the up to 8 rigid groups for each residue.\"\"\"\n  # 0: 'backbone group',\n  # 1: 'pre-omega-group', (empty)\n  # 2: 'phi-group', (currently empty, because it defines only hydrogens)\n  # 3: 'psi-group',\n  # 4,5,6,7: 'chi1,2,3,4-group'\n  aatype_in_shape = aatype.shape\n\n  # If there is a batch axis, just flatten it away, and reshape everything\n  # back at the end of the function.\n  aatype = jnp.reshape(aatype, [-1])\n  all_atom_positions = jax.tree_map(lambda x: jnp.reshape(x, [-1, 37]),\n                                    all_atom_positions)\n  all_atom_mask = jnp.reshape(all_atom_mask, [-1, 37])\n\n  # Compute the gather indices for all residues in the chain.\n  # shape (N, 8, 3)\n  residx_rigidgroup_base_atom37_idx = utils.batched_gather(\n      RESTYPE_RIGIDGROUP_BASE_ATOM37_IDX, aatype)\n\n  # Gather the base atom positions for each rigid group.\n  base_atom_pos = jax.tree_map(\n      lambda x: utils.batched_gather(  # pylint: disable=g-long-lambda\n          x, residx_rigidgroup_base_atom37_idx, batch_dims=1),\n      all_atom_positions)\n\n  # Compute the Rigids.\n  point_on_neg_x_axis = base_atom_pos[:, :, 0]\n  origin = base_atom_pos[:, :, 1]\n  point_on_xy_plane = base_atom_pos[:, :, 2]\n  gt_rotation = geometry.Rot3Array.from_two_vectors(\n      origin - point_on_neg_x_axis, point_on_xy_plane - origin)\n\n  gt_frames = geometry.Rigid3Array(gt_rotation, origin)\n\n  # Compute a mask whether the group exists.\n  # (N, 8)\n  group_exists = utils.batched_gather(RESTYPE_RIGIDGROUP_MASK, aatype)\n\n  # Compute a mask whether ground truth exists for the group\n  gt_atoms_exist = utils.batched_gather(  # shape (N, 8, 3)\n      all_atom_mask.astype(jnp.float32),\n      residx_rigidgroup_base_atom37_idx,\n      batch_dims=1)\n  gt_exists = jnp.min(gt_atoms_exist, axis=-1) * group_exists  # (N, 8)\n\n  # Adapt backbone frame to old convention (mirror x-axis and z-axis).\n  rots = np.tile(np.eye(3, dtype=np.float32), [8, 1, 1])\n  rots[0, 0, 0] = -1\n  rots[0, 2, 2] = -1\n  gt_frames = gt_frames.compose_rotation(\n      geometry.Rot3Array.from_array(rots))\n\n  # The frames for ambiguous rigid groups are just rotated by 180 degree around\n  # the x-axis. The ambiguous group is always the last chi-group.\n  restype_rigidgroup_is_ambiguous = np.zeros([21, 8], dtype=np.float32)\n  restype_rigidgroup_rots = np.tile(np.eye(3, dtype=np.float32), [21, 8, 1, 1])\n\n  for resname, _ in residue_constants.residue_atom_renaming_swaps.items():\n    restype = residue_constants.restype_order[\n        residue_constants.restype_3to1[resname]]\n    chi_idx = int(sum(residue_constants.chi_angles_mask[restype]) - 1)\n    restype_rigidgroup_is_ambiguous[restype, chi_idx + 4] = 1\n    restype_rigidgroup_rots[restype, chi_idx + 4, 1, 1] = -1\n    restype_rigidgroup_rots[restype, chi_idx + 4, 2, 2] = -1\n\n  # Gather the ambiguity information for each residue.\n  residx_rigidgroup_is_ambiguous = utils.batched_gather(\n      restype_rigidgroup_is_ambiguous, aatype)\n  ambiguity_rot = utils.batched_gather(restype_rigidgroup_rots, aatype)\n  ambiguity_rot = geometry.Rot3Array.from_array(ambiguity_rot)\n\n  # Create the alternative ground truth frames.\n  alt_gt_frames = gt_frames.compose_rotation(ambiguity_rot)\n\n  fix_shape = lambda x: jnp.reshape(x, aatype_in_shape + (8,))\n\n  # reshape back to original residue layout\n  gt_frames = jax.tree_map(fix_shape, gt_frames)\n  gt_exists = fix_shape(gt_exists)\n  group_exists = fix_shape(group_exists)\n  residx_rigidgroup_is_ambiguous = fix_shape(residx_rigidgroup_is_ambiguous)\n  alt_gt_frames = jax.tree_map(fix_shape, alt_gt_frames)\n\n  return {\n      'rigidgroups_gt_frames': gt_frames,  # Rigid (..., 8)\n      'rigidgroups_gt_exists': gt_exists,  # (..., 8)\n      'rigidgroups_group_exists': group_exists,  # (..., 8)\n      'rigidgroups_group_is_ambiguous':\n          residx_rigidgroup_is_ambiguous,  # (..., 8)\n      'rigidgroups_alt_gt_frames': alt_gt_frames,  # Rigid (..., 8)\n  }\n\n\ndef torsion_angles_to_frames(\n    aatype: jnp.ndarray,  # (N)\n    backb_to_global: geometry.Rigid3Array,  # (N)\n    torsion_angles_sin_cos: jnp.ndarray  # (N, 7, 2)\n) -> geometry.Rigid3Array:  # (N, 8)\n  \"\"\"Compute rigid group frames from torsion angles.\"\"\"\n  assert len(aatype.shape) == 1, (\n      f'Expected array of rank 1, got array with shape: {aatype.shape}.')\n  assert len(backb_to_global.rotation.shape) == 1, (\n      f'Expected array of rank 1, got array with shape: '\n      f'{backb_to_global.rotation.shape}')\n  assert len(torsion_angles_sin_cos.shape) == 3, (\n      f'Expected array of rank 3, got array with shape: '\n      f'{torsion_angles_sin_cos.shape}')\n  assert torsion_angles_sin_cos.shape[1] == 7, (\n      f'wrong shape {torsion_angles_sin_cos.shape}')\n  assert torsion_angles_sin_cos.shape[2] == 2, (\n      f'wrong shape {torsion_angles_sin_cos.shape}')\n\n  # Gather the default frames for all rigid groups.\n  # geometry.Rigid3Array with shape (N, 8)\n  m = utils.batched_gather(residue_constants.restype_rigid_group_default_frame,\n                           aatype)\n  default_frames = geometry.Rigid3Array.from_array4x4(m)\n\n  # Create the rotation matrices according to the given angles (each frame is\n  # defined such that its rotation is around the x-axis).\n  sin_angles = torsion_angles_sin_cos[..., 0]\n  cos_angles = torsion_angles_sin_cos[..., 1]\n\n  # insert zero rotation for backbone group.\n  num_residues, = aatype.shape\n  sin_angles = jnp.concatenate([jnp.zeros([num_residues, 1]), sin_angles],\n                               axis=-1)\n  cos_angles = jnp.concatenate([jnp.ones([num_residues, 1]), cos_angles],\n                               axis=-1)\n  zeros = jnp.zeros_like(sin_angles)\n  ones = jnp.ones_like(sin_angles)\n\n  # all_rots are geometry.Rot3Array with shape (N, 8)\n  all_rots = geometry.Rot3Array(ones, zeros, zeros,\n                                zeros, cos_angles, -sin_angles,\n                                zeros, sin_angles, cos_angles)\n\n  # Apply rotations to the frames.\n  all_frames = default_frames.compose_rotation(all_rots)\n\n  # chi2, chi3, and chi4 frames do not transform to the backbone frame but to\n  # the previous frame. So chain them up accordingly.\n\n  chi1_frame_to_backb = all_frames[:, 4]\n  chi2_frame_to_backb = chi1_frame_to_backb @ all_frames[:, 5]\n  chi3_frame_to_backb = chi2_frame_to_backb @ all_frames[:, 6]\n  chi4_frame_to_backb = chi3_frame_to_backb @ all_frames[:, 7]\n\n  all_frames_to_backb = jax.tree_map(\n      lambda *x: jnp.concatenate(x, axis=-1), all_frames[:, 0:5],\n      chi2_frame_to_backb[:, None], chi3_frame_to_backb[:, None],\n      chi4_frame_to_backb[:, None])\n\n  # Create the global frames.\n  # shape (N, 8)\n  all_frames_to_global = backb_to_global[:, None] @ all_frames_to_backb\n\n  return all_frames_to_global\n\n\ndef frames_and_literature_positions_to_atom14_pos(\n    aatype: jnp.ndarray,  # (N)\n    all_frames_to_global: geometry.Rigid3Array  # (N, 8)\n) -> geometry.Vec3Array:  # (N, 14)\n  \"\"\"Put atom literature positions (atom14 encoding) in each rigid group.\"\"\"\n\n  # Pick the appropriate transform for every atom.\n  residx_to_group_idx = utils.batched_gather(\n      residue_constants.restype_atom14_to_rigid_group, aatype)\n  group_mask = jax.nn.one_hot(\n      residx_to_group_idx, num_classes=8)  # shape (N, 14, 8)\n\n  # geometry.Rigid3Array with shape (N, 14)\n  map_atoms_to_global = jax.tree_map(\n      lambda x: jnp.sum(x[:, None, :] * group_mask, axis=-1),\n      all_frames_to_global)\n\n  # Gather the literature atom positions for each residue.\n  # geometry.Vec3Array with shape (N, 14)\n  lit_positions = geometry.Vec3Array.from_array(\n      utils.batched_gather(\n          residue_constants.restype_atom14_rigid_group_positions, aatype))\n\n  # Transform each atom from its local frame to the global frame.\n  # geometry.Vec3Array with shape (N, 14)\n  pred_positions = map_atoms_to_global.apply_to_point(lit_positions)\n\n  # Mask out non-existing atoms.\n  mask = utils.batched_gather(residue_constants.restype_atom14_mask, aatype)\n  pred_positions = pred_positions * mask\n\n  return pred_positions\n\n\ndef extreme_ca_ca_distance_violations(\n    positions: geometry.Vec3Array,  # (N, 37(14))\n    mask: jnp.ndarray,  # (N, 37(14))\n    residue_index: jnp.ndarray,  # (N)\n    max_angstrom_tolerance=1.5\n    ) -> jnp.ndarray:\n  \"\"\"Counts residues whose Ca is a large distance from its neighbor.\"\"\"\n  this_ca_pos = positions[:-1, 1]  # (N - 1,)\n  this_ca_mask = mask[:-1, 1]         # (N - 1)\n  next_ca_pos = positions[1:, 1]  # (N - 1,)\n  next_ca_mask = mask[1:, 1]  # (N - 1)\n  has_no_gap_mask = ((residue_index[1:] - residue_index[:-1]) == 1.0).astype(\n      jnp.float32)\n  ca_ca_distance = geometry.euclidean_distance(this_ca_pos, next_ca_pos, 1e-6)\n  violations = (ca_ca_distance -\n                residue_constants.ca_ca) > max_angstrom_tolerance\n  mask = this_ca_mask * next_ca_mask * has_no_gap_mask\n  return utils.mask_mean(mask=mask, value=violations)\n\n\ndef between_residue_bond_loss(\n    pred_atom_positions: geometry.Vec3Array,  # (N, 37(14))\n    pred_atom_mask: jnp.ndarray,  # (N, 37(14))\n    residue_index: jnp.ndarray,  # (N)\n    aatype: jnp.ndarray,  # (N)\n    tolerance_factor_soft=12.0,\n    tolerance_factor_hard=12.0) -> Dict[Text, jnp.ndarray]:\n  \"\"\"Flat-bottom loss to penalize structural violations between residues.\"\"\"\n  assert len(pred_atom_positions.shape) == 2\n  assert len(pred_atom_mask.shape) == 2\n  assert len(residue_index.shape) == 1\n  assert len(aatype.shape) == 1\n\n  # Get the positions of the relevant backbone atoms.\n  this_ca_pos = pred_atom_positions[:-1, 1]  # (N - 1)\n  this_ca_mask = pred_atom_mask[:-1, 1]         # (N - 1)\n  this_c_pos = pred_atom_positions[:-1, 2]  # (N - 1)\n  this_c_mask = pred_atom_mask[:-1, 2]          # (N - 1)\n  next_n_pos = pred_atom_positions[1:, 0]  # (N - 1)\n  next_n_mask = pred_atom_mask[1:, 0]           # (N - 1)\n  next_ca_pos = pred_atom_positions[1:, 1]  # (N - 1)\n  next_ca_mask = pred_atom_mask[1:, 1]          # (N - 1)\n  has_no_gap_mask = ((residue_index[1:] - residue_index[:-1]) == 1.0).astype(\n      jnp.float32)\n\n  # Compute loss for the C--N bond.\n  c_n_bond_length = geometry.euclidean_distance(this_c_pos, next_n_pos, 1e-6)\n\n  # The C-N bond to proline has slightly different length because of the ring.\n  next_is_proline = (\n      aatype[1:] == residue_constants.restype_order['P']).astype(jnp.float32)\n  gt_length = (\n      (1. - next_is_proline) * residue_constants.between_res_bond_length_c_n[0]\n      + next_is_proline * residue_constants.between_res_bond_length_c_n[1])\n  gt_stddev = (\n      (1. - next_is_proline) *\n      residue_constants.between_res_bond_length_stddev_c_n[0] +\n      next_is_proline * residue_constants.between_res_bond_length_stddev_c_n[1])\n  c_n_bond_length_error = jnp.sqrt(1e-6 +\n                                   jnp.square(c_n_bond_length - gt_length))\n  c_n_loss_per_residue = jax.nn.relu(\n      c_n_bond_length_error - tolerance_factor_soft * gt_stddev)\n  mask = this_c_mask * next_n_mask * has_no_gap_mask\n  c_n_loss = jnp.sum(mask * c_n_loss_per_residue) / (jnp.sum(mask) + 1e-6)\n  c_n_violation_mask = mask * (\n      c_n_bond_length_error > (tolerance_factor_hard * gt_stddev))\n\n  # Compute loss for the angles.\n  c_ca_unit_vec = (this_ca_pos - this_c_pos).normalized(1e-6)\n  c_n_unit_vec = (next_n_pos - this_c_pos) / c_n_bond_length\n  n_ca_unit_vec = (next_ca_pos - next_n_pos).normalized(1e-6)\n\n  ca_c_n_cos_angle = c_ca_unit_vec.dot(c_n_unit_vec)\n  gt_angle = residue_constants.between_res_cos_angles_ca_c_n[0]\n  gt_stddev = residue_constants.between_res_bond_length_stddev_c_n[0]\n  ca_c_n_cos_angle_error = jnp.sqrt(\n      1e-6 + jnp.square(ca_c_n_cos_angle - gt_angle))\n  ca_c_n_loss_per_residue = jax.nn.relu(\n      ca_c_n_cos_angle_error - tolerance_factor_soft * gt_stddev)\n  mask = this_ca_mask * this_c_mask * next_n_mask * has_no_gap_mask\n  ca_c_n_loss = jnp.sum(mask * ca_c_n_loss_per_residue) / (jnp.sum(mask) + 1e-6)\n  ca_c_n_violation_mask = mask * (ca_c_n_cos_angle_error >\n                                  (tolerance_factor_hard * gt_stddev))\n\n  c_n_ca_cos_angle = (-c_n_unit_vec).dot(n_ca_unit_vec)\n  gt_angle = residue_constants.between_res_cos_angles_c_n_ca[0]\n  gt_stddev = residue_constants.between_res_cos_angles_c_n_ca[1]\n  c_n_ca_cos_angle_error = jnp.sqrt(\n      1e-6 + jnp.square(c_n_ca_cos_angle - gt_angle))\n  c_n_ca_loss_per_residue = jax.nn.relu(\n      c_n_ca_cos_angle_error - tolerance_factor_soft * gt_stddev)\n  mask = this_c_mask * next_n_mask * next_ca_mask * has_no_gap_mask\n  c_n_ca_loss = jnp.sum(mask * c_n_ca_loss_per_residue) / (jnp.sum(mask) + 1e-6)\n  c_n_ca_violation_mask = mask * (\n      c_n_ca_cos_angle_error > (tolerance_factor_hard * gt_stddev))\n\n  # Compute a per residue loss (equally distribute the loss to both\n  # neighbouring residues).\n  per_residue_loss_sum = (c_n_loss_per_residue +\n                          ca_c_n_loss_per_residue +\n                          c_n_ca_loss_per_residue)\n  per_residue_loss_sum = 0.5 * (jnp.pad(per_residue_loss_sum, [[0, 1]]) +\n                                jnp.pad(per_residue_loss_sum, [[1, 0]]))\n\n  # Compute hard violations.\n  violation_mask = jnp.max(\n      jnp.stack([c_n_violation_mask,\n                 ca_c_n_violation_mask,\n                 c_n_ca_violation_mask]), axis=0)\n  violation_mask = jnp.maximum(\n      jnp.pad(violation_mask, [[0, 1]]),\n      jnp.pad(violation_mask, [[1, 0]]))\n\n  return {'c_n_loss_mean': c_n_loss,  # shape ()\n          'ca_c_n_loss_mean': ca_c_n_loss,  # shape ()\n          'c_n_ca_loss_mean': c_n_ca_loss,  # shape ()\n          'per_residue_loss_sum': per_residue_loss_sum,  # shape (N)\n          'per_residue_violation_mask': violation_mask  # shape (N)\n         }\n\n\ndef between_residue_clash_loss(\n    pred_positions: geometry.Vec3Array,  # (N, 14)\n    atom_exists: jnp.ndarray,  # (N, 14)\n    atom_radius: jnp.ndarray,  # (N, 14)\n    residue_index: jnp.ndarray,  # (N)\n    asym_id: jnp.ndarray,  # (N)\n    overlap_tolerance_soft=1.5,\n    overlap_tolerance_hard=1.5) -> Dict[Text, jnp.ndarray]:\n  \"\"\"Loss to penalize steric clashes between residues.\"\"\"\n  assert len(pred_positions.shape) == 2\n  assert len(atom_exists.shape) == 2\n  assert len(atom_radius.shape) == 2\n  assert len(residue_index.shape) == 1\n\n  # Create the distance matrix.\n  # (N, N, 14, 14)\n  dists = geometry.euclidean_distance(pred_positions[:, None, :, None],\n                                      pred_positions[None, :, None, :], 1e-10)\n\n  # Create the mask for valid distances.\n  # shape (N, N, 14, 14)\n  dists_mask = (atom_exists[:, None, :, None] * atom_exists[None, :, None, :])\n\n  # Mask out all the duplicate entries in the lower triangular matrix.\n  # Also mask out the diagonal (atom-pairs from the same residue) -- these atoms\n  # are handled separately.\n  dists_mask *= (\n      residue_index[:, None, None, None] < residue_index[None, :, None, None])\n\n  # Backbone C--N bond between subsequent residues is no clash.\n  c_one_hot = jax.nn.one_hot(2, num_classes=14)\n  n_one_hot = jax.nn.one_hot(0, num_classes=14)\n  neighbour_mask = ((residue_index[:, None] + 1) == residue_index[None, :])\n  neighbour_mask &= (asym_id[:, None] == asym_id[None, :])\n  neighbour_mask = neighbour_mask[..., None, None]\n  c_n_bonds = neighbour_mask * c_one_hot[None, None, :,\n                                         None] * n_one_hot[None, None, None, :]\n  dists_mask *= (1. - c_n_bonds)\n\n  # Disulfide bridge between two cysteines is no clash.\n  cys_sg_idx = residue_constants.restype_name_to_atom14_names['CYS'].index('SG')\n  cys_sg_one_hot = jax.nn.one_hot(cys_sg_idx, num_classes=14)\n  disulfide_bonds = (cys_sg_one_hot[None, None, :, None] *\n                     cys_sg_one_hot[None, None, None, :])\n  dists_mask *= (1. - disulfide_bonds)\n\n  # Compute the lower bound for the allowed distances.\n  # shape (N, N, 14, 14)\n  dists_lower_bound = dists_mask * (\n      atom_radius[:, None, :, None] + atom_radius[None, :, None, :])\n\n  # Compute the error.\n  # shape (N, N, 14, 14)\n  dists_to_low_error = dists_mask * jax.nn.relu(\n      dists_lower_bound - overlap_tolerance_soft - dists)\n\n  # Compute the mean loss.\n  # shape ()\n  mean_loss = (jnp.sum(dists_to_low_error)\n               / (1e-6 + jnp.sum(dists_mask)))\n\n  # Compute the per atom loss sum.\n  # shape (N, 14)\n  per_atom_loss_sum = (jnp.sum(dists_to_low_error, axis=[0, 2]) +\n                       jnp.sum(dists_to_low_error, axis=[1, 3]))\n\n  # Compute the hard clash mask.\n  # shape (N, N, 14, 14)\n  clash_mask = dists_mask * (\n      dists < (dists_lower_bound - overlap_tolerance_hard))\n\n  # Compute the per atom clash.\n  # shape (N, 14)\n  per_atom_clash_mask = jnp.maximum(\n      jnp.max(clash_mask, axis=[0, 2]),\n      jnp.max(clash_mask, axis=[1, 3]))\n\n  return {'mean_loss': mean_loss,  # shape ()\n          'per_atom_loss_sum': per_atom_loss_sum,  # shape (N, 14)\n          'per_atom_clash_mask': per_atom_clash_mask  # shape (N, 14)\n         }\n\n\ndef within_residue_violations(\n    pred_positions: geometry.Vec3Array,  # (N, 14)\n    atom_exists: jnp.ndarray,  # (N, 14)\n    dists_lower_bound: jnp.ndarray,  # (N, 14, 14)\n    dists_upper_bound: jnp.ndarray,  # (N, 14, 14)\n    tighten_bounds_for_loss=0.0,\n) -> Dict[Text, jnp.ndarray]:\n  \"\"\"Find within-residue violations.\"\"\"\n  assert len(pred_positions.shape) == 2\n  assert len(atom_exists.shape) == 2\n  assert len(dists_lower_bound.shape) == 3\n  assert len(dists_upper_bound.shape) == 3\n\n  # Compute the mask for each residue.\n  # shape (N, 14, 14)\n  dists_masks = (1. - jnp.eye(14, 14)[None])\n  dists_masks *= (atom_exists[:, :, None] * atom_exists[:, None, :])\n\n  # Distance matrix\n  # shape (N, 14, 14)\n  dists = geometry.euclidean_distance(pred_positions[:, :, None],\n                                      pred_positions[:, None, :], 1e-10)\n\n  # Compute the loss.\n  # shape (N, 14, 14)\n  dists_to_low_error = jax.nn.relu(\n      dists_lower_bound + tighten_bounds_for_loss - dists)\n  dists_to_high_error = jax.nn.relu(\n      dists + tighten_bounds_for_loss - dists_upper_bound)\n  loss = dists_masks * (dists_to_low_error + dists_to_high_error)\n\n  # Compute the per atom loss sum.\n  # shape (N, 14)\n  per_atom_loss_sum = (jnp.sum(loss, axis=1) +\n                       jnp.sum(loss, axis=2))\n\n  # Compute the violations mask.\n  # shape (N, 14, 14)\n  violations = dists_masks * ((dists < dists_lower_bound) |\n                              (dists > dists_upper_bound))\n\n  # Compute the per atom violations.\n  # shape (N, 14)\n  per_atom_violations = jnp.maximum(\n      jnp.max(violations, axis=1), jnp.max(violations, axis=2))\n\n  return {'per_atom_loss_sum': per_atom_loss_sum,  # shape (N, 14)\n          'per_atom_violations': per_atom_violations  # shape (N, 14)\n         }\n\n\ndef find_optimal_renaming(\n    gt_positions: geometry.Vec3Array,  # (N, 14)\n    alt_gt_positions: geometry.Vec3Array,  # (N, 14)\n    atom_is_ambiguous: jnp.ndarray,  # (N, 14)\n    gt_exists: jnp.ndarray,  # (N, 14)\n    pred_positions: geometry.Vec3Array,  # (N, 14)\n) -> jnp.ndarray:  # (N):\n  \"\"\"Find optimal renaming for ground truth that maximizes LDDT.\"\"\"\n  assert len(gt_positions.shape) == 2\n  assert len(alt_gt_positions.shape) == 2\n  assert len(atom_is_ambiguous.shape) == 2\n  assert len(gt_exists.shape) == 2\n  assert len(pred_positions.shape) == 2\n\n  # Create the pred distance matrix.\n  # shape (N, N, 14, 14)\n  pred_dists = geometry.euclidean_distance(pred_positions[:, None, :, None],\n                                           pred_positions[None, :, None, :],\n                                           1e-10)\n\n  # Compute distances for ground truth with original and alternative names.\n  # shape (N, N, 14, 14)\n  gt_dists = geometry.euclidean_distance(gt_positions[:, None, :, None],\n                                         gt_positions[None, :, None, :], 1e-10)\n\n  alt_gt_dists = geometry.euclidean_distance(alt_gt_positions[:, None, :, None],\n                                             alt_gt_positions[None, :, None, :],\n                                             1e-10)\n\n  # Compute LDDT's.\n  # shape (N, N, 14, 14)\n  lddt = jnp.sqrt(1e-10 + squared_difference(pred_dists, gt_dists))\n  alt_lddt = jnp.sqrt(1e-10 + squared_difference(pred_dists, alt_gt_dists))\n\n  # Create a mask for ambiguous atoms in rows vs. non-ambiguous atoms\n  # in cols.\n  # shape (N ,N, 14, 14)\n  mask = (\n      gt_exists[:, None, :, None] *  # rows\n      atom_is_ambiguous[:, None, :, None] *  # rows\n      gt_exists[None, :, None, :] *  # cols\n      (1. - atom_is_ambiguous[None, :, None, :]))  # cols\n\n  # Aggregate distances for each residue to the non-amibuguous atoms.\n  # shape (N)\n  per_res_lddt = jnp.sum(mask * lddt, axis=[1, 2, 3])\n  alt_per_res_lddt = jnp.sum(mask * alt_lddt, axis=[1, 2, 3])\n\n  # Decide for each residue, whether alternative naming is better.\n  # shape (N)\n  alt_naming_is_better = (alt_per_res_lddt < per_res_lddt).astype(jnp.float32)\n\n  return alt_naming_is_better  # shape (N)\n\n\ndef frame_aligned_point_error(\n    pred_frames: geometry.Rigid3Array,  # shape (num_frames)\n    target_frames: geometry.Rigid3Array,  # shape (num_frames)\n    frames_mask: jnp.ndarray,  # shape (num_frames)\n    pred_positions: geometry.Vec3Array,  # shape (num_positions)\n    target_positions: geometry.Vec3Array,  # shape (num_positions)\n    positions_mask: jnp.ndarray,  # shape (num_positions)\n    pair_mask: jnp.ndarray,  # shape (num_frames, num_posiitons)\n    l1_clamp_distance: float,\n    length_scale=20.,\n    epsilon=1e-4) -> jnp.ndarray:  # shape ()\n  \"\"\"Measure point error under different alignements.\n\n  Computes error between two structures with B points\n  under A alignments derived form the given pairs of frames.\n  Args:\n    pred_frames: num_frames reference frames for 'pred_positions'.\n    target_frames: num_frames reference frames for 'target_positions'.\n    frames_mask: Mask for frame pairs to use.\n    pred_positions: num_positions predicted positions of the structure.\n    target_positions: num_positions target positions of the structure.\n    positions_mask: Mask on which positions to score.\n    pair_mask: A (num_frames, num_positions) mask to use in the loss, useful\n      for separating intra from inter chain losses.\n    l1_clamp_distance: Distance cutoff on error beyond which gradients will\n      be zero.\n    length_scale: length scale to divide loss by.\n    epsilon: small value used to regularize denominator for masked average.\n  Returns:\n    Masked Frame aligned point error.\n  \"\"\"\n  # For now we do not allow any batch dimensions.\n  assert len(pred_frames.rotation.shape) == 1\n  assert len(target_frames.rotation.shape) == 1\n  assert frames_mask.ndim == 1\n  assert pred_positions.x.ndim == 1\n  assert target_positions.x.ndim == 1\n  assert positions_mask.ndim == 1\n\n  # Compute array of predicted positions in the predicted frames.\n  # geometry.Vec3Array (num_frames, num_positions)\n  local_pred_pos = pred_frames[:, None].inverse().apply_to_point(\n      pred_positions[None, :])\n\n  # Compute array of target positions in the target frames.\n  # geometry.Vec3Array (num_frames, num_positions)\n  local_target_pos = target_frames[:, None].inverse().apply_to_point(\n      target_positions[None, :])\n\n  # Compute errors between the structures.\n  # jnp.ndarray (num_frames, num_positions)\n  error_dist = geometry.euclidean_distance(local_pred_pos, local_target_pos,\n                                           epsilon)\n\n  clipped_error_dist = jnp.clip(error_dist, 0, l1_clamp_distance)\n\n  normed_error = clipped_error_dist / length_scale\n  normed_error *= jnp.expand_dims(frames_mask, axis=-1)\n  normed_error *= jnp.expand_dims(positions_mask, axis=-2)\n  if pair_mask is not None:\n    normed_error *= pair_mask\n\n  mask = (jnp.expand_dims(frames_mask, axis=-1) *\n          jnp.expand_dims(positions_mask, axis=-2))\n  if pair_mask is not None:\n    mask *= pair_mask\n  normalization_factor = jnp.sum(mask, axis=(-1, -2))\n  return (jnp.sum(normed_error, axis=(-2, -1)) /\n          (epsilon + normalization_factor))\n\n\ndef get_chi_atom_indices():\n  \"\"\"Returns atom indices needed to compute chi angles for all residue types.\n\n  Returns:\n    A tensor of shape [residue_types=21, chis=4, atoms=4]. The residue types are\n    in the order specified in residue_constants.restypes + unknown residue type\n    at the end. For chi angles which are not defined on the residue, the\n    positions indices are by default set to 0.\n  \"\"\"\n  chi_atom_indices = []\n  for residue_name in residue_constants.restypes:\n    residue_name = residue_constants.restype_1to3[residue_name]\n    residue_chi_angles = residue_constants.chi_angles_atoms[residue_name]\n    atom_indices = []\n    for chi_angle in residue_chi_angles:\n      atom_indices.append(\n          [residue_constants.atom_order[atom] for atom in chi_angle])\n    for _ in range(4 - len(atom_indices)):\n      atom_indices.append([0, 0, 0, 0])  # For chi angles not defined on the AA.\n    chi_atom_indices.append(atom_indices)\n\n  chi_atom_indices.append([[0, 0, 0, 0]] * 4)  # For UNKNOWN residue.\n\n  return jnp.asarray(chi_atom_indices)\n\n\ndef compute_chi_angles(positions: geometry.Vec3Array,\n                       mask: geometry.Vec3Array,\n                       aatype: geometry.Vec3Array):\n  \"\"\"Computes the chi angles given all atom positions and the amino acid type.\n\n  Args:\n    positions: A Vec3Array of shape\n      [num_res, residue_constants.atom_type_num], with positions of\n      atoms needed to calculate chi angles. Supports up to 1 batch dimension.\n    mask: An optional tensor of shape\n      [num_res, residue_constants.atom_type_num] that masks which atom\n      positions are set for each residue. If given, then the chi mask will be\n      set to 1 for a chi angle only if the amino acid has that chi angle and all\n      the chi atoms needed to calculate that chi angle are set. If not given\n      (set to None), the chi mask will be set to 1 for a chi angle if the amino\n      acid has that chi angle and whether the actual atoms needed to calculate\n      it were set will be ignored.\n    aatype: A tensor of shape [num_res] with amino acid type integer\n      code (0 to 21). Supports up to 1 batch dimension.\n\n  Returns:\n    A tuple of tensors (chi_angles, mask), where both have shape\n    [num_res, 4]. The mask masks out unused chi angles for amino acid\n    types that have less than 4 chi angles. If atom_positions_mask is set, the\n    chi mask will also mask out uncomputable chi angles.\n  \"\"\"\n\n  # Don't assert on the num_res and batch dimensions as they might be unknown.\n  assert positions.shape[-1] == residue_constants.atom_type_num\n  assert mask.shape[-1] == residue_constants.atom_type_num\n\n  # Compute the table of chi angle indices. Shape: [restypes, chis=4, atoms=4].\n  chi_atom_indices = get_chi_atom_indices()\n  # Select atoms to compute chis. Shape: [num_res, chis=4, atoms=4].\n  atom_indices = utils.batched_gather(\n      params=chi_atom_indices, indices=aatype, axis=0)\n  # Gather atom positions. Shape: [num_res, chis=4, atoms=4, xyz=3].\n  chi_angle_atoms = jax.tree_map(\n      lambda x: utils.batched_gather(  # pylint: disable=g-long-lambda\n          params=x, indices=atom_indices, axis=-1, batch_dims=1), positions)\n  a, b, c, d = [chi_angle_atoms[..., i] for i in range(4)]\n\n  chi_angles = geometry.dihedral_angle(a, b, c, d)\n\n  # Copy the chi angle mask, add the UNKNOWN residue. Shape: [restypes, 4].\n  chi_angles_mask = list(residue_constants.chi_angles_mask)\n  chi_angles_mask.append([0.0, 0.0, 0.0, 0.0])\n  chi_angles_mask = jnp.asarray(chi_angles_mask)\n  # Compute the chi angle mask. Shape [num_res, chis=4].\n  chi_mask = utils.batched_gather(params=chi_angles_mask, indices=aatype,\n                                  axis=0)\n\n  # The chi_mask is set to 1 only when all necessary chi angle atoms were set.\n  # Gather the chi angle atoms mask. Shape: [num_res, chis=4, atoms=4].\n  chi_angle_atoms_mask = utils.batched_gather(\n      params=mask, indices=atom_indices, axis=-1, batch_dims=1)\n  # Check if all 4 chi angle atoms were set. Shape: [num_res, chis=4].\n  chi_angle_atoms_mask = jnp.prod(chi_angle_atoms_mask, axis=[-1])\n  chi_mask = chi_mask * chi_angle_atoms_mask.astype(jnp.float32)\n\n  return chi_angles, chi_mask\n\n\ndef make_transform_from_reference(\n    a_xyz: geometry.Vec3Array,\n    b_xyz: geometry.Vec3Array,\n    c_xyz: geometry.Vec3Array) -> geometry.Rigid3Array:\n  \"\"\"Returns rotation and translation matrices to convert from reference.\n\n  Note that this method does not take care of symmetries. If you provide the\n  coordinates in the non-standard way, the A atom will end up in the negative\n  y-axis rather than in the positive y-axis. You need to take care of such\n  cases in your code.\n\n  Args:\n    a_xyz: A Vec3Array.\n    b_xyz: A Vec3Array.\n    c_xyz: A Vec3Array.\n\n  Returns:\n    A Rigid3Array which, when applied to coordinates in a canonicalized\n    reference frame, will give coordinates approximately equal\n    the original coordinates (in the global frame).\n  \"\"\"\n  rotation = geometry.Rot3Array.from_two_vectors(c_xyz - b_xyz,\n                                                 a_xyz - b_xyz)\n  return geometry.Rigid3Array(rotation, b_xyz)\n"
  },
  {
    "path": "alphafold/model/all_atom_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for all_atom.\"\"\"\n\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.model import all_atom\nfrom alphafold.model import r3\nimport numpy as np\n\nL1_CLAMP_DISTANCE = 10\n\n\ndef get_identity_rigid(shape):\n  \"\"\"Returns identity rigid transform.\"\"\"\n\n  ones = np.ones(shape)\n  zeros = np.zeros(shape)\n  rot = r3.Rots(ones, zeros, zeros,\n                zeros, ones, zeros,\n                zeros, zeros, ones)\n  trans = r3.Vecs(zeros, zeros, zeros)\n  return r3.Rigids(rot, trans)\n\n\ndef get_global_rigid_transform(rot_angle, translation, bcast_dims):\n  \"\"\"Returns rigid transform that globally rotates/translates by same amount.\"\"\"\n\n  rot_angle = np.asarray(rot_angle)\n  translation = np.asarray(translation)\n  if bcast_dims:\n    for _ in range(bcast_dims):\n      rot_angle = np.expand_dims(rot_angle, 0)\n      translation = np.expand_dims(translation, 0)\n  sin_angle = np.sin(np.deg2rad(rot_angle))\n  cos_angle = np.cos(np.deg2rad(rot_angle))\n  ones = np.ones_like(sin_angle)\n  zeros = np.zeros_like(sin_angle)\n  rot = r3.Rots(ones, zeros, zeros,\n                zeros, cos_angle, -sin_angle,\n                zeros, sin_angle, cos_angle)\n  trans = r3.Vecs(translation[..., 0], translation[..., 1], translation[..., 2])\n  return r3.Rigids(rot, trans)\n\n\nclass AllAtomTest(parameterized.TestCase, absltest.TestCase):\n\n  @parameterized.named_parameters(\n      ('identity', 0, [0, 0, 0]),\n      ('rot_90', 90, [0, 0, 0]),\n      ('trans_10', 0, [0, 0, 10]),\n      ('rot_174_trans_1', 174, [1, 1, 1]))\n  def test_frame_aligned_point_error_perfect_on_global_transform(\n      self, rot_angle, translation):\n    \"\"\"Tests global transform between target and preds gives perfect score.\"\"\"\n\n    # pylint: disable=bad-whitespace\n    target_positions = np.array(\n        [[ 21.182,  23.095,  19.731],\n         [ 22.055,  20.919,  17.294],\n         [ 24.599,  20.005,  15.041],\n         [ 25.567,  18.214,  12.166],\n         [ 28.063,  17.082,  10.043],\n         [ 28.779,  15.569,   6.985],\n         [ 30.581,  13.815,   4.612],\n         [ 29.258,  12.193,   2.296]])\n    # pylint: enable=bad-whitespace\n    global_rigid_transform = get_global_rigid_transform(\n        rot_angle, translation, 1)\n\n    target_positions = r3.vecs_from_tensor(target_positions)\n    pred_positions = r3.rigids_mul_vecs(\n        global_rigid_transform, target_positions)\n    positions_mask = np.ones(target_positions.x.shape[0])\n\n    target_frames = get_identity_rigid(10)\n    pred_frames = r3.rigids_mul_rigids(global_rigid_transform, target_frames)\n    frames_mask = np.ones(10)\n\n    fape = all_atom.frame_aligned_point_error(\n        pred_frames, target_frames, frames_mask, pred_positions,\n        target_positions, positions_mask, L1_CLAMP_DISTANCE,\n        L1_CLAMP_DISTANCE, epsilon=0)\n    self.assertAlmostEqual(fape, 0.)\n\n  @parameterized.named_parameters(\n      ('identity',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       0.),\n      ('shift_2.5',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[2.5, 0, 0], [7.5, 0, 0], [7.5, 0, 0]],\n       0.25),\n      ('shift_5',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[5, 0, 0], [10, 0, 0], [15, 0, 0]],\n       0.5),\n      ('shift_10',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[10, 0, 0], [15, 0, 0], [0, 0, 0]],\n       1.))\n  def test_frame_aligned_point_error_matches_expected(\n      self, target_positions, pred_positions, expected_alddt):\n    \"\"\"Tests score matches expected.\"\"\"\n\n    target_frames = get_identity_rigid(2)\n    pred_frames = target_frames\n    frames_mask = np.ones(2)\n\n    target_positions = r3.vecs_from_tensor(np.array(target_positions))\n    pred_positions = r3.vecs_from_tensor(np.array(pred_positions))\n    positions_mask = np.ones(target_positions.x.shape[0])\n\n    alddt = all_atom.frame_aligned_point_error(\n        pred_frames, target_frames, frames_mask, pred_positions,\n        target_positions, positions_mask, L1_CLAMP_DISTANCE,\n        L1_CLAMP_DISTANCE, epsilon=0)\n    self.assertAlmostEqual(alddt, expected_alddt)\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/model/common_modules.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"A collection of common Haiku modules for use in protein folding.\"\"\"\nimport numbers\nfrom typing import Union, Sequence\n\nimport haiku as hk\nimport jax.numpy as jnp\nimport numpy as np\n\n\n# Constant from scipy.stats.truncnorm.std(a=-2, b=2, loc=0., scale=1.)\nTRUNCATED_NORMAL_STDDEV_FACTOR = np.asarray(.87962566103423978,\n                                            dtype=np.float32)\n\n\ndef get_initializer_scale(initializer_name, input_shape):\n  \"\"\"Get Initializer for weights and scale to multiply activations by.\"\"\"\n\n  if initializer_name == 'zeros':\n    w_init = hk.initializers.Constant(0.0)\n  else:\n    # fan-in scaling\n    scale = 1.\n    for channel_dim in input_shape:\n      scale /= channel_dim\n    if initializer_name == 'relu':\n      scale *= 2\n\n    noise_scale = scale\n\n    stddev = np.sqrt(noise_scale)\n    # Adjust stddev for truncation.\n    stddev = stddev / TRUNCATED_NORMAL_STDDEV_FACTOR\n    w_init = hk.initializers.TruncatedNormal(mean=0.0, stddev=stddev)\n\n  return w_init\n\n\nclass Linear(hk.Module):\n  \"\"\"Protein folding specific Linear module.\n\n  This differs from the standard Haiku Linear in a few ways:\n    * It supports inputs and outputs of arbitrary rank\n    * Initializers are specified by strings\n  \"\"\"\n\n  def __init__(self,\n               num_output: Union[int, Sequence[int]],\n               initializer: str = 'linear',\n               num_input_dims: int = 1,\n               use_bias: bool = True,\n               bias_init: float = 0.,\n               precision = None,\n               name: str = 'linear'):\n    \"\"\"Constructs Linear Module.\n\n    Args:\n      num_output: Number of output channels. Can be tuple when outputting\n          multiple dimensions.\n      initializer: What initializer to use, should be one of {'linear', 'relu',\n        'zeros'}\n      num_input_dims: Number of dimensions from the end to project.\n      use_bias: Whether to include trainable bias\n      bias_init: Value used to initialize bias.\n      precision: What precision to use for matrix multiplication, defaults\n        to None.\n      name: Name of module, used for name scopes.\n    \"\"\"\n    super().__init__(name=name)\n    if isinstance(num_output, numbers.Integral):\n      self.output_shape = (num_output,)\n    else:\n      self.output_shape = tuple(num_output)\n    self.initializer = initializer\n    self.use_bias = use_bias\n    self.bias_init = bias_init\n    self.num_input_dims = num_input_dims\n    self.num_output_dims = len(self.output_shape)\n    self.precision = precision\n\n  def __call__(self, inputs):\n    \"\"\"Connects Module.\n\n    Args:\n      inputs: Tensor with at least num_input_dims dimensions.\n\n    Returns:\n      output of shape [...] + num_output.\n    \"\"\"\n\n    num_input_dims = self.num_input_dims\n\n    if self.num_input_dims > 0:\n      in_shape = inputs.shape[-self.num_input_dims:]\n    else:\n      in_shape = ()\n\n    weight_init = get_initializer_scale(self.initializer, in_shape)\n\n    in_letters = 'abcde'[:self.num_input_dims]\n    out_letters = 'hijkl'[:self.num_output_dims]\n\n    weight_shape = in_shape + self.output_shape\n    weights = hk.get_parameter('weights', weight_shape, inputs.dtype,\n                               weight_init)\n\n    equation = f'...{in_letters}, {in_letters}{out_letters}->...{out_letters}'\n\n    output = jnp.einsum(equation, inputs, weights, precision=self.precision)\n\n    if self.use_bias:\n      bias = hk.get_parameter('bias', self.output_shape, inputs.dtype,\n                              hk.initializers.Constant(self.bias_init))\n      output += bias\n\n    return output\n\n\nclass LayerNorm(hk.LayerNorm):\n  \"\"\"LayerNorm module.\n\n  Equivalent to hk.LayerNorm but with different parameter shapes: they are\n  always vectors rather than possibly higher-rank tensors. This makes it easier\n  to change the layout whilst keep the model weight-compatible.\n  \"\"\"\n\n  def __init__(self,\n               axis,\n               create_scale: bool,\n               create_offset: bool,\n               eps: float = 1e-5,\n               scale_init=None,\n               offset_init=None,\n               use_fast_variance: bool = False,\n               name=None,\n               param_axis=None):\n    super().__init__(\n        axis=axis,\n        create_scale=False,\n        create_offset=False,\n        eps=eps,\n        scale_init=None,\n        offset_init=None,\n        use_fast_variance=use_fast_variance,\n        name=name,\n        param_axis=param_axis)\n    self._temp_create_scale = create_scale\n    self._temp_create_offset = create_offset\n\n  def __call__(self, x: jnp.ndarray) -> jnp.ndarray:\n    is_bf16 = (x.dtype == jnp.bfloat16)\n    if is_bf16:\n      x = x.astype(jnp.float32)\n\n    param_axis = self.param_axis[0] if self.param_axis else -1\n    param_shape = (x.shape[param_axis],)\n\n    param_broadcast_shape = [1] * x.ndim\n    param_broadcast_shape[param_axis] = x.shape[param_axis]\n    scale = None\n    offset = None\n    if self._temp_create_scale:\n      scale = hk.get_parameter(\n          'scale', param_shape, x.dtype, init=self.scale_init)\n      scale = scale.reshape(param_broadcast_shape)\n\n    if self._temp_create_offset:\n      offset = hk.get_parameter(\n          'offset', param_shape, x.dtype, init=self.offset_init)\n      offset = offset.reshape(param_broadcast_shape)\n\n    out = super().__call__(x, scale=scale, offset=offset)\n\n    if is_bf16:\n      out = out.astype(jnp.bfloat16)\n\n    return out\n  "
  },
  {
    "path": "alphafold/model/config.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Model config.\"\"\"\n\nimport copy\nfrom alphafold.model.tf import shape_placeholders\nimport ml_collections\n\nNUM_RES = shape_placeholders.NUM_RES\nNUM_MSA_SEQ = shape_placeholders.NUM_MSA_SEQ\nNUM_EXTRA_SEQ = shape_placeholders.NUM_EXTRA_SEQ\nNUM_TEMPLATES = shape_placeholders.NUM_TEMPLATES\n\n\ndef model_config(name: str) -> ml_collections.ConfigDict:\n  \"\"\"Get the ConfigDict of a CASP14 model.\"\"\"\n\n  if name not in CONFIG_DIFFS:\n    raise ValueError(f'Invalid model name {name}.')\n  if 'multimer' in name:\n    cfg = copy.deepcopy(CONFIG_MULTIMER)\n  else:\n    cfg = copy.deepcopy(CONFIG)\n  cfg.update_from_flattened_dict(CONFIG_DIFFS[name])\n  return cfg\n\n\nMODEL_PRESETS = {\n    'monomer': (\n        'model_1',\n        'model_2',\n        'model_3',\n        'model_4',\n        'model_5',\n    ),\n    'monomer_ptm': (\n        'model_1_ptm',\n        'model_2_ptm',\n        'model_3_ptm',\n        'model_4_ptm',\n        'model_5_ptm',\n    ),\n    'multimer': (\n        'model_1_multimer_v3',\n        'model_2_multimer_v3',\n        'model_3_multimer_v3',\n        'model_4_multimer_v3',\n        'model_5_multimer_v3',\n    ),\n}\nMODEL_PRESETS['monomer_casp14'] = MODEL_PRESETS['monomer']\n\n\nCONFIG_DIFFS = {\n    'model_1': {\n        # Jumper et al. (2021) Suppl. Table 5, Model 1.1.1\n        'data.common.max_extra_msa': 5120,\n        'data.common.reduce_msa_clusters_by_max_templates': True,\n        'data.common.use_templates': True,\n        'model.embeddings_and_evoformer.template.embed_torsion_angles': True,\n        'model.embeddings_and_evoformer.template.enabled': True\n    },\n    'model_2': {\n        # Jumper et al. (2021) Suppl. Table 5, Model 1.1.2\n        'data.common.reduce_msa_clusters_by_max_templates': True,\n        'data.common.use_templates': True,\n        'model.embeddings_and_evoformer.template.embed_torsion_angles': True,\n        'model.embeddings_and_evoformer.template.enabled': True\n    },\n    'model_3': {\n        # Jumper et al. (2021) Suppl. Table 5, Model 1.2.1\n        'data.common.max_extra_msa': 5120,\n    },\n    'model_4': {\n        # Jumper et al. (2021) Suppl. Table 5, Model 1.2.2\n        'data.common.max_extra_msa': 5120,\n    },\n    'model_5': {\n        # Jumper et al. (2021) Suppl. Table 5, Model 1.2.3\n    },\n\n    # The following models are fine-tuned from the corresponding models above\n    # with an additional predicted_aligned_error head that can produce\n    # predicted TM-score (pTM) and predicted aligned errors.\n    'model_1_ptm': {\n        'data.common.max_extra_msa': 5120,\n        'data.common.reduce_msa_clusters_by_max_templates': True,\n        'data.common.use_templates': True,\n        'model.embeddings_and_evoformer.template.embed_torsion_angles': True,\n        'model.embeddings_and_evoformer.template.enabled': True,\n        'model.heads.predicted_aligned_error.weight': 0.1\n    },\n    'model_2_ptm': {\n        'data.common.reduce_msa_clusters_by_max_templates': True,\n        'data.common.use_templates': True,\n        'model.embeddings_and_evoformer.template.embed_torsion_angles': True,\n        'model.embeddings_and_evoformer.template.enabled': True,\n        'model.heads.predicted_aligned_error.weight': 0.1\n    },\n    'model_3_ptm': {\n        'data.common.max_extra_msa': 5120,\n        'model.heads.predicted_aligned_error.weight': 0.1\n    },\n    'model_4_ptm': {\n        'data.common.max_extra_msa': 5120,\n        'model.heads.predicted_aligned_error.weight': 0.1\n    },\n    'model_5_ptm': {\n        'model.heads.predicted_aligned_error.weight': 0.1\n    },\n    'model_1_multimer_v3': {},\n    'model_2_multimer_v3': {},\n    'model_3_multimer_v3': {},\n    'model_4_multimer_v3': {\n        'model.embeddings_and_evoformer.num_extra_msa': 1152\n    },\n    'model_5_multimer_v3': {\n        'model.embeddings_and_evoformer.num_extra_msa': 1152\n    },\n}\n# Key differences between multimer v1/v2 and v3, mostly due to numerical\n# optimisations in the TriangleMultiplication module.\ncommon_updates = {\n    'model.embeddings_and_evoformer.num_msa': 252,\n    'model.embeddings_and_evoformer.num_extra_msa': 1152,\n    'model.embeddings_and_evoformer.evoformer.triangle_multiplication_incoming.fuse_projection_weights': False,\n    'model.embeddings_and_evoformer.evoformer.triangle_multiplication_outgoing.fuse_projection_weights': False,\n    'model.embeddings_and_evoformer.template.template_pair_stack.triangle_multiplication_incoming.fuse_projection_weights': False,\n    'model.embeddings_and_evoformer.template.template_pair_stack.triangle_multiplication_outgoing.fuse_projection_weights': False,\n}\nCONFIG_DIFFS.update(\n    {f'model_{i}_multimer': common_updates for i in range(1, 6)})\nCONFIG_DIFFS.update(\n    {f'model_{i}_multimer_v2': common_updates for i in range(1, 6)})\n\n\nCONFIG = ml_collections.ConfigDict({\n    'data': {\n        'common': {\n            'masked_msa': {\n                'profile_prob': 0.1,\n                'same_prob': 0.1,\n                'uniform_prob': 0.1\n            },\n            'max_extra_msa': 1024,\n            'msa_cluster_features': True,\n            'num_recycle': 3,\n            'reduce_msa_clusters_by_max_templates': False,\n            'resample_msa_in_recycling': True,\n            'template_features': [\n                'template_all_atom_positions', 'template_sum_probs',\n                'template_aatype', 'template_all_atom_masks',\n                'template_domain_names'\n            ],\n            'unsupervised_features': [\n                'aatype', 'residue_index', 'sequence', 'msa', 'domain_name',\n                'num_alignments', 'seq_length', 'between_segment_residues',\n                'deletion_matrix'\n            ],\n            'use_templates': False,\n        },\n        'eval': {\n            'feat': {\n                'aatype': [NUM_RES],\n                'all_atom_mask': [NUM_RES, None],\n                'all_atom_positions': [NUM_RES, None, None],\n                'alt_chi_angles': [NUM_RES, None],\n                'atom14_alt_gt_exists': [NUM_RES, None],\n                'atom14_alt_gt_positions': [NUM_RES, None, None],\n                'atom14_atom_exists': [NUM_RES, None],\n                'atom14_atom_is_ambiguous': [NUM_RES, None],\n                'atom14_gt_exists': [NUM_RES, None],\n                'atom14_gt_positions': [NUM_RES, None, None],\n                'atom37_atom_exists': [NUM_RES, None],\n                'backbone_affine_mask': [NUM_RES],\n                'backbone_affine_tensor': [NUM_RES, None],\n                'bert_mask': [NUM_MSA_SEQ, NUM_RES],\n                'chi_angles': [NUM_RES, None],\n                'chi_mask': [NUM_RES, None],\n                'extra_deletion_value': [NUM_EXTRA_SEQ, NUM_RES],\n                'extra_has_deletion': [NUM_EXTRA_SEQ, NUM_RES],\n                'extra_msa': [NUM_EXTRA_SEQ, NUM_RES],\n                'extra_msa_mask': [NUM_EXTRA_SEQ, NUM_RES],\n                'extra_msa_row_mask': [NUM_EXTRA_SEQ],\n                'is_distillation': [],\n                'msa_feat': [NUM_MSA_SEQ, NUM_RES, None],\n                'msa_mask': [NUM_MSA_SEQ, NUM_RES],\n                'msa_row_mask': [NUM_MSA_SEQ],\n                'pseudo_beta': [NUM_RES, None],\n                'pseudo_beta_mask': [NUM_RES],\n                'random_crop_to_size_seed': [None],\n                'residue_index': [NUM_RES],\n                'residx_atom14_to_atom37': [NUM_RES, None],\n                'residx_atom37_to_atom14': [NUM_RES, None],\n                'resolution': [],\n                'rigidgroups_alt_gt_frames': [NUM_RES, None, None],\n                'rigidgroups_group_exists': [NUM_RES, None],\n                'rigidgroups_group_is_ambiguous': [NUM_RES, None],\n                'rigidgroups_gt_exists': [NUM_RES, None],\n                'rigidgroups_gt_frames': [NUM_RES, None, None],\n                'seq_length': [],\n                'seq_mask': [NUM_RES],\n                'target_feat': [NUM_RES, None],\n                'template_aatype': [NUM_TEMPLATES, NUM_RES],\n                'template_all_atom_masks': [NUM_TEMPLATES, NUM_RES, None],\n                'template_all_atom_positions': [\n                    NUM_TEMPLATES, NUM_RES, None, None],\n                'template_backbone_affine_mask': [NUM_TEMPLATES, NUM_RES],\n                'template_backbone_affine_tensor': [\n                    NUM_TEMPLATES, NUM_RES, None],\n                'template_mask': [NUM_TEMPLATES],\n                'template_pseudo_beta': [NUM_TEMPLATES, NUM_RES, None],\n                'template_pseudo_beta_mask': [NUM_TEMPLATES, NUM_RES],\n                'template_sum_probs': [NUM_TEMPLATES, None],\n                'true_msa': [NUM_MSA_SEQ, NUM_RES]\n            },\n            'fixed_size': True,\n            'subsample_templates': False,  # We want top templates.\n            'masked_msa_replace_fraction': 0.15,\n            'max_msa_clusters': 512,\n            'max_templates': 4,\n            'num_ensemble': 1,\n        },\n    },\n    'model': {\n        'embeddings_and_evoformer': {\n            'evoformer_num_block': 48,\n            'evoformer': {\n                'msa_row_attention_with_pair_bias': {\n                    'dropout_rate': 0.15,\n                    'gating': True,\n                    'num_head': 8,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'msa_column_attention': {\n                    'dropout_rate': 0.0,\n                    'gating': True,\n                    'num_head': 8,\n                    'orientation': 'per_column',\n                    'shared_dropout': True\n                },\n                'msa_transition': {\n                    'dropout_rate': 0.0,\n                    'num_intermediate_factor': 4,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'outer_product_mean': {\n                    'first': False,\n                    'chunk_size': 128,\n                    'dropout_rate': 0.0,\n                    'num_outer_channel': 32,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'triangle_attention_starting_node': {\n                    'dropout_rate': 0.25,\n                    'gating': True,\n                    'num_head': 4,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'triangle_attention_ending_node': {\n                    'dropout_rate': 0.25,\n                    'gating': True,\n                    'num_head': 4,\n                    'orientation': 'per_column',\n                    'shared_dropout': True\n                },\n                'triangle_multiplication_outgoing': {\n                    'dropout_rate': 0.25,\n                    'equation': 'ikc,jkc->ijc',\n                    'num_intermediate_channel': 128,\n                    'orientation': 'per_row',\n                    'shared_dropout': True,\n                    'fuse_projection_weights': False,\n                },\n                'triangle_multiplication_incoming': {\n                    'dropout_rate': 0.25,\n                    'equation': 'kjc,kic->ijc',\n                    'num_intermediate_channel': 128,\n                    'orientation': 'per_row',\n                    'shared_dropout': True,\n                    'fuse_projection_weights': False,\n                },\n                'pair_transition': {\n                    'dropout_rate': 0.0,\n                    'num_intermediate_factor': 4,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                }\n            },\n            'extra_msa_channel': 64,\n            'extra_msa_stack_num_block': 4,\n            'max_relative_feature': 32,\n            'msa_channel': 256,\n            'pair_channel': 128,\n            'prev_pos': {\n                'min_bin': 3.25,\n                'max_bin': 20.75,\n                'num_bins': 15\n            },\n            'recycle_features': True,\n            'recycle_pos': True,\n            'seq_channel': 384,\n            'template': {\n                'attention': {\n                    'gating': False,\n                    'key_dim': 64,\n                    'num_head': 4,\n                    'value_dim': 64\n                },\n                'dgram_features': {\n                    'min_bin': 3.25,\n                    'max_bin': 50.75,\n                    'num_bins': 39\n                },\n                'embed_torsion_angles': False,\n                'enabled': False,\n                'template_pair_stack': {\n                    'num_block': 2,\n                    'triangle_attention_starting_node': {\n                        'dropout_rate': 0.25,\n                        'gating': True,\n                        'key_dim': 64,\n                        'num_head': 4,\n                        'orientation': 'per_row',\n                        'shared_dropout': True,\n                        'value_dim': 64\n                    },\n                    'triangle_attention_ending_node': {\n                        'dropout_rate': 0.25,\n                        'gating': True,\n                        'key_dim': 64,\n                        'num_head': 4,\n                        'orientation': 'per_column',\n                        'shared_dropout': True,\n                        'value_dim': 64\n                    },\n                    'triangle_multiplication_outgoing': {\n                        'dropout_rate': 0.25,\n                        'equation': 'ikc,jkc->ijc',\n                        'num_intermediate_channel': 64,\n                        'orientation': 'per_row',\n                        'shared_dropout': True,\n                        'fuse_projection_weights': False,\n                    },\n                    'triangle_multiplication_incoming': {\n                        'dropout_rate': 0.25,\n                        'equation': 'kjc,kic->ijc',\n                        'num_intermediate_channel': 64,\n                        'orientation': 'per_row',\n                        'shared_dropout': True,\n                        'fuse_projection_weights': False,\n                    },\n                    'pair_transition': {\n                        'dropout_rate': 0.0,\n                        'num_intermediate_factor': 2,\n                        'orientation': 'per_row',\n                        'shared_dropout': True\n                    }\n                },\n                'max_templates': 4,\n                'subbatch_size': 128,\n                'use_template_unit_vector': False,\n            }\n        },\n        'global_config': {\n            'deterministic': False,\n            'multimer_mode': False,\n            'subbatch_size': 4,\n            'use_remat': False,\n            'zero_init': True,\n            'eval_dropout': False,\n        },\n        'heads': {\n            'distogram': {\n                'first_break': 2.3125,\n                'last_break': 21.6875,\n                'num_bins': 64,\n                'weight': 0.3\n            },\n            'predicted_aligned_error': {\n                # `num_bins - 1` bins uniformly space the\n                # [0, max_error_bin A] range.\n                # The final bin covers [max_error_bin A, +infty]\n                # 31A gives bins with 0.5A width.\n                'max_error_bin': 31.,\n                'num_bins': 64,\n                'num_channels': 128,\n                'filter_by_resolution': True,\n                'min_resolution': 0.1,\n                'max_resolution': 3.0,\n                'weight': 0.0,\n            },\n            'experimentally_resolved': {\n                'filter_by_resolution': True,\n                'max_resolution': 3.0,\n                'min_resolution': 0.1,\n                'weight': 0.01\n            },\n            'structure_module': {\n                'num_layer': 8,\n                'fape': {\n                    'clamp_distance': 10.0,\n                    'clamp_type': 'relu',\n                    'loss_unit_distance': 10.0\n                },\n                'angle_norm_weight': 0.01,\n                'chi_weight': 0.5,\n                'clash_overlap_tolerance': 1.5,\n                'compute_in_graph_metrics': True,\n                'dropout': 0.1,\n                'num_channel': 384,\n                'num_head': 12,\n                'num_layer_in_transition': 3,\n                'num_point_qk': 4,\n                'num_point_v': 8,\n                'num_scalar_qk': 16,\n                'num_scalar_v': 16,\n                'position_scale': 10.0,\n                'sidechain': {\n                    'atom_clamp_distance': 10.0,\n                    'num_channel': 128,\n                    'num_residual_block': 2,\n                    'weight_frac': 0.5,\n                    'length_scale': 10.,\n                },\n                'structural_violation_loss_weight': 1.0,\n                'violation_tolerance_factor': 12.0,\n                'weight': 1.0\n            },\n            'predicted_lddt': {\n                'filter_by_resolution': True,\n                'max_resolution': 3.0,\n                'min_resolution': 0.1,\n                'num_bins': 50,\n                'num_channels': 128,\n                'weight': 0.01\n            },\n            'masked_msa': {\n                'num_output': 23,\n                'weight': 2.0\n            },\n        },\n        'num_recycle': 3,\n        'resample_msa_in_recycling': True\n    },\n})\n\n\nCONFIG_MULTIMER = ml_collections.ConfigDict({\n    'model': {\n        'embeddings_and_evoformer': {\n            'evoformer_num_block': 48,\n            'evoformer': {\n                'msa_column_attention': {\n                    'dropout_rate': 0.0,\n                    'gating': True,\n                    'num_head': 8,\n                    'orientation': 'per_column',\n                    'shared_dropout': True\n                },\n                'msa_row_attention_with_pair_bias': {\n                    'dropout_rate': 0.15,\n                    'gating': True,\n                    'num_head': 8,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'msa_transition': {\n                    'dropout_rate': 0.0,\n                    'num_intermediate_factor': 4,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'outer_product_mean': {\n                    'chunk_size': 128,\n                    'dropout_rate': 0.0,\n                    'first': True,\n                    'num_outer_channel': 32,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'pair_transition': {\n                    'dropout_rate': 0.0,\n                    'num_intermediate_factor': 4,\n                    'orientation': 'per_row',\n                    'shared_dropout': True\n                },\n                'triangle_attention_ending_node': {\n                    'dropout_rate': 0.25,\n                    'gating': True,\n                    'num_head': 4,\n                    'orientation': 'per_column',\n                    'shared_dropout': True\n                },\n                'triangle_attention_starting_node': {\n                    'dropout_rate': 0.25,\n                    'gating': True,\n                    'num_head': 4,\n                    'orientation': 'per_row',\n                    'shared_dropout': True,\n                },\n                'triangle_multiplication_incoming': {\n                    'dropout_rate': 0.25,\n                    'equation': 'kjc,kic->ijc',\n                    'num_intermediate_channel': 128,\n                    'orientation': 'per_row',\n                    'shared_dropout': True,\n                    'fuse_projection_weights': True,\n                },\n                'triangle_multiplication_outgoing': {\n                    'dropout_rate': 0.25,\n                    'equation': 'ikc,jkc->ijc',\n                    'num_intermediate_channel': 128,\n                    'orientation': 'per_row',\n                    'shared_dropout': True,\n                    'fuse_projection_weights': True,\n                }\n            },\n            'extra_msa_channel': 64,\n            'extra_msa_stack_num_block': 4,\n            'num_msa': 508,\n            'num_extra_msa': 2048,\n            'masked_msa': {\n                'profile_prob': 0.1,\n                'replace_fraction': 0.15,\n                'same_prob': 0.1,\n                'uniform_prob': 0.1\n            },\n            'use_chain_relative': True,\n            'max_relative_chain': 2,\n            'max_relative_idx': 32,\n            'seq_channel': 384,\n            'msa_channel': 256,\n            'pair_channel': 128,\n            'prev_pos': {\n                'max_bin': 20.75,\n                'min_bin': 3.25,\n                'num_bins': 15\n            },\n            'recycle_features': True,\n            'recycle_pos': True,\n            'template': {\n                'attention': {\n                    'gating': False,\n                    'num_head': 4\n                },\n                'dgram_features': {\n                    'max_bin': 50.75,\n                    'min_bin': 3.25,\n                    'num_bins': 39\n                },\n                'enabled': True,\n                'max_templates': 4,\n                'num_channels': 64,\n                'subbatch_size': 128,\n                'template_pair_stack': {\n                    'num_block': 2,\n                    'pair_transition': {\n                        'dropout_rate': 0.0,\n                        'num_intermediate_factor': 2,\n                        'orientation': 'per_row',\n                        'shared_dropout': True\n                    },\n                    'triangle_attention_ending_node': {\n                        'dropout_rate': 0.25,\n                        'gating': True,\n                        'num_head': 4,\n                        'orientation': 'per_column',\n                        'shared_dropout': True\n                    },\n                    'triangle_attention_starting_node': {\n                        'dropout_rate': 0.25,\n                        'gating': True,\n                        'num_head': 4,\n                        'orientation': 'per_row',\n                        'shared_dropout': True\n                    },\n                    'triangle_multiplication_incoming': {\n                        'dropout_rate': 0.25,\n                        'equation': 'kjc,kic->ijc',\n                        'num_intermediate_channel': 64,\n                        'orientation': 'per_row',\n                        'shared_dropout': True,\n                        'fuse_projection_weights': True,\n                    },\n                    'triangle_multiplication_outgoing': {\n                        'dropout_rate': 0.25,\n                        'equation': 'ikc,jkc->ijc',\n                        'num_intermediate_channel': 64,\n                        'orientation': 'per_row',\n                        'shared_dropout': True,\n                        'fuse_projection_weights': True,\n                    }\n                }\n            },\n        },\n        'global_config': {\n            'bfloat16': True,\n            'bfloat16_output': False,\n            'deterministic': False,\n            'multimer_mode': True,\n            'subbatch_size': 4,\n            'use_remat': False,\n            'zero_init': True,\n            'eval_dropout': False,\n        },\n        'heads': {\n            'distogram': {\n                'first_break': 2.3125,\n                'last_break': 21.6875,\n                'num_bins': 64,\n                'weight': 0.3\n            },\n            'experimentally_resolved': {\n                'filter_by_resolution': True,\n                'max_resolution': 3.0,\n                'min_resolution': 0.1,\n                'weight': 0.01\n            },\n            'masked_msa': {\n                'weight': 2.0\n            },\n            'predicted_aligned_error': {\n                'filter_by_resolution': True,\n                'max_error_bin': 31.0,\n                'max_resolution': 3.0,\n                'min_resolution': 0.1,\n                'num_bins': 64,\n                'num_channels': 128,\n                'weight': 0.1\n            },\n            'predicted_lddt': {\n                'filter_by_resolution': True,\n                'max_resolution': 3.0,\n                'min_resolution': 0.1,\n                'num_bins': 50,\n                'num_channels': 128,\n                'weight': 0.01\n            },\n            'structure_module': {\n                'angle_norm_weight': 0.01,\n                'chi_weight': 0.5,\n                'clash_overlap_tolerance': 1.5,\n                'dropout': 0.1,\n                'interface_fape': {\n                    'atom_clamp_distance': 1000.0,\n                    'loss_unit_distance': 20.0\n                },\n                'intra_chain_fape': {\n                    'atom_clamp_distance': 10.0,\n                    'loss_unit_distance': 10.0\n                },\n                'num_channel': 384,\n                'num_head': 12,\n                'num_layer': 8,\n                'num_layer_in_transition': 3,\n                'num_point_qk': 4,\n                'num_point_v': 8,\n                'num_scalar_qk': 16,\n                'num_scalar_v': 16,\n                'position_scale': 20.0,\n                'sidechain': {\n                    'atom_clamp_distance': 10.0,\n                    'loss_unit_distance': 10.0,\n                    'num_channel': 128,\n                    'num_residual_block': 2,\n                    'weight_frac': 0.5\n                },\n                'structural_violation_loss_weight': 1.0,\n                'violation_tolerance_factor': 12.0,\n                'weight': 1.0\n            }\n        },\n        'num_ensemble_eval': 1,\n        'num_recycle': 20,\n        # A negative value indicates that no early stopping will occur, i.e.\n        # the model will always run `num_recycle` number of recycling\n        # iterations.  A positive value will enable early stopping if the\n        # difference in pairwise distances is less than the tolerance between\n        # recycling steps.\n        'recycle_early_stop_tolerance': 0.5,\n        'resample_msa_in_recycling': True\n    }\n})\n"
  },
  {
    "path": "alphafold/model/data.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Convenience functions for reading data.\"\"\"\n\nimport io\nimport os\nfrom alphafold.model import utils\nimport haiku as hk\nimport numpy as np\n# Internal import (7716).\n\n\ndef get_model_haiku_params(model_name: str, parameter_path: str) -> hk.Params:\n  \"\"\"Get the Haiku parameters from a model name.\"\"\"\n\n  path = os.path.join(parameter_path, f'params_{model_name}.npz')\n\n  with open(path, 'rb') as f:\n    params = np.load(io.BytesIO(f.read()), allow_pickle=False)\n\n  return utils.flat_params_to_haiku(params)\n"
  },
  {
    "path": "alphafold/model/features.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Code to generate processed features.\"\"\"\nimport copy\nfrom typing import List, Mapping, Tuple\n\nfrom alphafold.model.tf import input_pipeline\nfrom alphafold.model.tf import proteins_dataset\n\nimport ml_collections\nimport numpy as np\nimport tensorflow.compat.v1 as tf\n\nFeatureDict = Mapping[str, np.ndarray]\n\n\ndef make_data_config(\n    config: ml_collections.ConfigDict,\n    num_res: int,\n    ) -> Tuple[ml_collections.ConfigDict, List[str]]:\n  \"\"\"Makes a data config for the input pipeline.\"\"\"\n  cfg = copy.deepcopy(config.data)\n\n  feature_names = cfg.common.unsupervised_features\n  if cfg.common.use_templates:\n    feature_names += cfg.common.template_features\n\n  with cfg.unlocked():\n    cfg.eval.crop_size = num_res\n\n  return cfg, feature_names\n\n\ndef tf_example_to_features(tf_example: tf.train.Example,\n                           config: ml_collections.ConfigDict,\n                           random_seed: int = 0) -> FeatureDict:\n  \"\"\"Converts tf_example to numpy feature dictionary.\"\"\"\n  num_res = int(tf_example.features.feature['seq_length'].int64_list.value[0])\n  cfg, feature_names = make_data_config(config, num_res=num_res)\n\n  if 'deletion_matrix_int' in set(tf_example.features.feature):\n    deletion_matrix_int = (\n        tf_example.features.feature['deletion_matrix_int'].int64_list.value)\n    feat = tf.train.Feature(float_list=tf.train.FloatList(\n        value=map(float, deletion_matrix_int)))\n    tf_example.features.feature['deletion_matrix'].CopyFrom(feat)\n    del tf_example.features.feature['deletion_matrix_int']\n\n  tf_graph = tf.Graph()\n  with tf_graph.as_default(), tf.device('/device:CPU:0'):\n    tf.compat.v1.set_random_seed(random_seed)\n    tensor_dict = proteins_dataset.create_tensor_dict(\n        raw_data=tf_example.SerializeToString(),\n        features=feature_names)\n    processed_batch = input_pipeline.process_tensors_from_config(\n        tensor_dict, cfg)\n\n  tf_graph.finalize()\n\n  with tf.Session(graph=tf_graph) as sess:\n    features = sess.run(processed_batch)\n\n  return {k: v for k, v in features.items() if v.dtype != 'O'}\n\n\ndef np_example_to_features(np_example: FeatureDict,\n                           config: ml_collections.ConfigDict,\n                           random_seed: int = 0) -> FeatureDict:\n  \"\"\"Preprocesses NumPy feature dict using TF pipeline.\"\"\"\n  np_example = dict(np_example)\n  num_res = int(np_example['seq_length'][0])\n  cfg, feature_names = make_data_config(config, num_res=num_res)\n\n  if 'deletion_matrix_int' in np_example:\n    np_example['deletion_matrix'] = (\n        np_example.pop('deletion_matrix_int').astype(np.float32))\n\n  tf_graph = tf.Graph()\n  with tf_graph.as_default(), tf.device('/device:CPU:0'):\n    tf.compat.v1.set_random_seed(random_seed)\n    tensor_dict = proteins_dataset.np_to_tensor_dict(\n        np_example=np_example, features=feature_names)\n\n    processed_batch = input_pipeline.process_tensors_from_config(\n        tensor_dict, cfg)\n\n  tf_graph.finalize()\n\n  with tf.Session(graph=tf_graph) as sess:\n    features = sess.run(processed_batch)\n\n  return {k: v for k, v in features.items() if v.dtype != 'O'}\n"
  },
  {
    "path": "alphafold/model/folding.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Modules and utilities for the structure module.\"\"\"\n\nimport functools\nfrom typing import Dict\nfrom alphafold.common import residue_constants\nfrom alphafold.model import all_atom\nfrom alphafold.model import common_modules\nfrom alphafold.model import prng\nfrom alphafold.model import quat_affine\nfrom alphafold.model import r3\nfrom alphafold.model import utils\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\nimport ml_collections\nimport numpy as np\n\n\ndef squared_difference(x, y):\n  return jnp.square(x - y)\n\n\nclass InvariantPointAttention(hk.Module):\n  \"\"\"Invariant Point attention module.\n\n  The high-level idea is that this attention module works over a set of points\n  and associated orientations in 3D space (e.g. protein residues).\n\n  Each residue outputs a set of queries and keys as points in their local\n  reference frame.  The attention is then defined as the euclidean distance\n  between the queries and keys in the global frame.\n\n  Jumper et al. (2021) Suppl. Alg. 22 \"InvariantPointAttention\"\n  \"\"\"\n\n  def __init__(self,\n               config,\n               global_config,\n               dist_epsilon=1e-8,\n               name='invariant_point_attention'):\n    \"\"\"Initialize.\n\n    Args:\n      config: Structure Module Config\n      global_config: Global Config of Model.\n      dist_epsilon: Small value to avoid NaN in distance calculation.\n      name: Haiku Module name.\n    \"\"\"\n    super().__init__(name=name)\n\n    self._dist_epsilon = dist_epsilon\n    self._zero_initialize_last = global_config.zero_init\n\n    self.config = config\n\n    self.global_config = global_config\n\n  def __call__(self, inputs_1d, inputs_2d, mask, affine):\n    \"\"\"Compute geometry-aware attention.\n\n    Given a set of query residues (defined by affines and associated scalar\n    features), this function computes geometry-aware attention between the\n    query residues and target residues.\n\n    The residues produce points in their local reference frame, which\n    are converted into the global frame in order to compute attention via\n    euclidean distance.\n\n    Equivalently, the target residues produce points in their local frame to be\n    used as attention values, which are converted into the query residues'\n    local frames.\n\n    Args:\n      inputs_1d: (N, C) 1D input embedding that is the basis for the\n        scalar queries.\n      inputs_2d: (N, M, C') 2D input embedding, used for biases and values.\n      mask: (N, 1) mask to indicate which elements of inputs_1d participate\n        in the attention.\n      affine: QuatAffine object describing the position and orientation of\n        every element in inputs_1d.\n\n    Returns:\n      Transformation of the input embedding.\n    \"\"\"\n    num_residues, _ = inputs_1d.shape\n\n    # Improve readability by removing a large number of 'self's.\n    num_head = self.config.num_head\n    num_scalar_qk = self.config.num_scalar_qk\n    num_point_qk = self.config.num_point_qk\n    num_scalar_v = self.config.num_scalar_v\n    num_point_v = self.config.num_point_v\n    num_output = self.config.num_channel\n\n    assert num_scalar_qk > 0\n    assert num_point_qk > 0\n    assert num_point_v > 0\n\n    # Construct scalar queries of shape:\n    # [num_query_residues, num_head, num_points]\n    q_scalar = common_modules.Linear(\n        num_head * num_scalar_qk, name='q_scalar')(\n            inputs_1d)\n    q_scalar = jnp.reshape(\n        q_scalar, [num_residues, num_head, num_scalar_qk])\n\n    # Construct scalar keys/values of shape:\n    # [num_target_residues, num_head, num_points]\n    kv_scalar = common_modules.Linear(\n        num_head * (num_scalar_v + num_scalar_qk), name='kv_scalar')(\n            inputs_1d)\n    kv_scalar = jnp.reshape(kv_scalar,\n                            [num_residues, num_head,\n                             num_scalar_v + num_scalar_qk])\n    k_scalar, v_scalar = jnp.split(kv_scalar, [num_scalar_qk], axis=-1)\n\n    # Construct query points of shape:\n    # [num_residues, num_head, num_point_qk]\n\n    # First construct query points in local frame.\n    q_point_local = common_modules.Linear(\n        num_head * 3 * num_point_qk, name='q_point_local')(\n            inputs_1d)\n    q_point_local = jnp.split(q_point_local, 3, axis=-1)\n    # Project query points into global frame.\n    q_point_global = affine.apply_to_point(q_point_local, extra_dims=1)\n    # Reshape query point for later use.\n    q_point = [\n        jnp.reshape(x, [num_residues, num_head, num_point_qk])\n        for x in q_point_global]\n\n    # Construct key and value points.\n    # Key points have shape [num_residues, num_head, num_point_qk]\n    # Value points have shape [num_residues, num_head, num_point_v]\n\n    # Construct key and value points in local frame.\n    kv_point_local = common_modules.Linear(\n        num_head * 3 * (num_point_qk + num_point_v), name='kv_point_local')(\n            inputs_1d)\n    kv_point_local = jnp.split(kv_point_local, 3, axis=-1)\n    # Project key and value points into global frame.\n    kv_point_global = affine.apply_to_point(kv_point_local, extra_dims=1)\n    kv_point_global = [\n        jnp.reshape(x, [num_residues,\n                        num_head, (num_point_qk + num_point_v)])\n        for x in kv_point_global]\n    # Split key and value points.\n    k_point, v_point = list(\n        zip(*[\n            jnp.split(x, [num_point_qk,], axis=-1)\n            for x in kv_point_global\n        ]))\n\n    # We assume that all queries and keys come iid from N(0, 1) distribution\n    # and compute the variances of the attention logits.\n    # Each scalar pair (q, k) contributes Var q*k = 1\n    scalar_variance = max(num_scalar_qk, 1) * 1.\n    # Each point pair (q, k) contributes Var [0.5 ||q||^2 - <q, k>] = 9 / 2\n    point_variance = max(num_point_qk, 1) * 9. / 2\n\n    # Allocate equal variance to scalar, point and attention 2d parts so that\n    # the sum is 1.\n\n    num_logit_terms = 3\n\n    scalar_weights = np.sqrt(1.0 / (num_logit_terms * scalar_variance))\n    point_weights = np.sqrt(1.0 / (num_logit_terms * point_variance))\n    attention_2d_weights = np.sqrt(1.0 / (num_logit_terms))\n\n    # Trainable per-head weights for points.\n    trainable_point_weights = jax.nn.softplus(hk.get_parameter(\n        'trainable_point_weights', shape=[num_head],\n        # softplus^{-1} (1)\n        init=hk.initializers.Constant(np.log(np.exp(1.) - 1.))))\n    point_weights *= jnp.expand_dims(trainable_point_weights, axis=1)\n\n    v_point = [jnp.swapaxes(x, -2, -3) for x in v_point]\n\n    q_point = [jnp.swapaxes(x, -2, -3) for x in q_point]\n    k_point = [jnp.swapaxes(x, -2, -3) for x in k_point]\n    dist2 = [\n        squared_difference(qx[:, :, None, :], kx[:, None, :, :])\n        for qx, kx in zip(q_point, k_point)\n    ]\n    dist2 = sum(dist2)\n    attn_qk_point = -0.5 * jnp.sum(\n        point_weights[:, None, None, :] * dist2, axis=-1)\n\n    v = jnp.swapaxes(v_scalar, -2, -3)\n    q = jnp.swapaxes(scalar_weights * q_scalar, -2, -3)\n    k = jnp.swapaxes(k_scalar, -2, -3)\n    attn_qk_scalar = jnp.matmul(q, jnp.swapaxes(k, -2, -1))\n    attn_logits = attn_qk_scalar + attn_qk_point\n\n    attention_2d = common_modules.Linear(\n        num_head, name='attention_2d')(\n            inputs_2d)\n\n    attention_2d = jnp.transpose(attention_2d, [2, 0, 1])\n    attention_2d = attention_2d_weights * attention_2d\n    attn_logits += attention_2d\n\n    mask_2d = mask * jnp.swapaxes(mask, -1, -2)\n    attn_logits -= 1e5 * (1. - mask_2d)\n\n    # [num_head, num_query_residues, num_target_residues]\n    attn = jax.nn.softmax(attn_logits)\n\n    # [num_head, num_query_residues, num_head * num_scalar_v]\n    result_scalar = jnp.matmul(attn, v)\n\n    # For point result, implement matmul manually so that it will be a float32\n    # on TPU.  This is equivalent to\n    # result_point_global = [jnp.einsum('bhqk,bhkc->bhqc', attn, vx)\n    #                        for vx in v_point]\n    # but on the TPU, doing the multiply and reduce_sum ensures the\n    # computation happens in float32 instead of bfloat16.\n    result_point_global = [jnp.sum(\n        attn[:, :, :, None] * vx[:, None, :, :],\n        axis=-2) for vx in v_point]\n\n    # [num_query_residues, num_head, num_head * num_(scalar|point)_v]\n    result_scalar = jnp.swapaxes(result_scalar, -2, -3)\n    result_point_global = [\n        jnp.swapaxes(x, -2, -3)\n        for x in result_point_global]\n\n    # Features used in the linear output projection. Should have the size\n    # [num_query_residues, ?]\n    output_features = []\n\n    result_scalar = jnp.reshape(\n        result_scalar, [num_residues, num_head * num_scalar_v])\n    output_features.append(result_scalar)\n\n    result_point_global = [\n        jnp.reshape(r, [num_residues, num_head * num_point_v])\n        for r in result_point_global]\n    result_point_local = affine.invert_point(result_point_global, extra_dims=1)\n    output_features.extend(result_point_local)\n\n    output_features.append(jnp.sqrt(self._dist_epsilon +\n                                    jnp.square(result_point_local[0]) +\n                                    jnp.square(result_point_local[1]) +\n                                    jnp.square(result_point_local[2])))\n\n    # Dimensions: h = heads, i and j = residues,\n    # c = inputs_2d channels\n    # Contraction happens over the second residue dimension, similarly to how\n    # the usual attention is performed.\n    result_attention_over_2d = jnp.einsum('hij, ijc->ihc', attn, inputs_2d)\n    num_out = num_head * result_attention_over_2d.shape[-1]\n    output_features.append(\n        jnp.reshape(result_attention_over_2d,\n                    [num_residues, num_out]))\n\n    final_init = 'zeros' if self._zero_initialize_last else 'linear'\n\n    final_act = jnp.concatenate(output_features, axis=-1)\n\n    return common_modules.Linear(\n        num_output,\n        initializer=final_init,\n        name='output_projection')(final_act)\n\n\nclass FoldIteration(hk.Module):\n  \"\"\"A single iteration of the main structure module loop.\n\n  Jumper et al. (2021) Suppl. Alg. 20 \"StructureModule\" lines 6-21\n\n  First, each residue attends to all residues using InvariantPointAttention.\n  Then, we apply transition layers to update the hidden representations.\n  Finally, we use the hidden representations to produce an update to the\n  affine of each residue.\n  \"\"\"\n\n  def __init__(self, config, global_config,\n               name='fold_iteration'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               activations,\n               sequence_mask,\n               update_affine,\n               is_training,\n               initial_act,\n               safe_key=None,\n               static_feat_2d=None,\n               aatype=None):\n    c = self.config\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    def safe_dropout_fn(tensor, safe_key):\n      return prng.safe_dropout(\n          tensor=tensor,\n          safe_key=safe_key,\n          rate=c.dropout,\n          is_deterministic=self.global_config.deterministic,\n          is_training=is_training)\n\n    affine = quat_affine.QuatAffine.from_tensor(activations['affine'])\n\n    act = activations['act']\n    attention_module = InvariantPointAttention(self.config, self.global_config)\n    # Attention\n    attn = attention_module(\n        inputs_1d=act,\n        inputs_2d=static_feat_2d,\n        mask=sequence_mask,\n        affine=affine)\n    act += attn\n    safe_key, *sub_keys = safe_key.split(3)\n    sub_keys = iter(sub_keys)\n    act = safe_dropout_fn(act, next(sub_keys))\n    act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='attention_layer_norm')(\n            act)\n\n    final_init = 'zeros' if self.global_config.zero_init else 'linear'\n\n    # Transition\n    input_act = act\n    for i in range(c.num_layer_in_transition):\n      init = 'relu' if i < c.num_layer_in_transition - 1 else final_init\n      act = common_modules.Linear(\n          c.num_channel,\n          initializer=init,\n          name='transition')(\n              act)\n      if i < c.num_layer_in_transition - 1:\n        act = jax.nn.relu(act)\n    act += input_act\n    act = safe_dropout_fn(act, next(sub_keys))\n    act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='transition_layer_norm')(act)\n\n    if update_affine:\n      # This block corresponds to\n      # Jumper et al. (2021) Alg. 23 \"Backbone update\"\n      affine_update_size = 6\n\n      # Affine update\n      affine_update = common_modules.Linear(\n          affine_update_size,\n          initializer=final_init,\n          name='affine_update')(\n              act)\n\n      affine = affine.pre_compose(affine_update)\n\n    sc = MultiRigidSidechain(c.sidechain, self.global_config)(\n        affine.scale_translation(c.position_scale), [act, initial_act], aatype)\n\n    outputs = {'affine': affine.to_tensor(), 'sc': sc}\n\n    affine = affine.apply_rotation_tensor_fn(jax.lax.stop_gradient)\n\n    new_activations = {\n        'act': act,\n        'affine': affine.to_tensor()\n    }\n    return new_activations, outputs\n\n\ndef generate_affines(representations, batch, config, global_config,\n                     is_training, safe_key):\n  \"\"\"Generate predicted affines for a single chain.\n\n  Jumper et al. (2021) Suppl. Alg. 20 \"StructureModule\"\n\n  This is the main part of the structure module - it iteratively applies\n  folding to produce a set of predicted residue positions.\n\n  Args:\n    representations: Representations dictionary.\n    batch: Batch dictionary.\n    config: Config for the structure module.\n    global_config: Global config.\n    is_training: Whether the model is being trained.\n    safe_key: A prng.SafeKey object that wraps a PRNG key.\n\n  Returns:\n    A dictionary containing residue affines and sidechain positions.\n  \"\"\"\n  c = config\n  sequence_mask = batch['seq_mask'][:, None]\n\n  act = common_modules.LayerNorm(\n      axis=[-1],\n      create_scale=True,\n      create_offset=True,\n      name='single_layer_norm')(\n          representations['single'])\n\n  initial_act = act\n  act = common_modules.Linear(\n      c.num_channel, name='initial_projection')(\n          act)\n\n  affine = generate_new_affine(sequence_mask)\n\n  fold_iteration = FoldIteration(\n      c, global_config, name='fold_iteration')\n\n  assert len(batch['seq_mask'].shape) == 1\n\n  activations = {'act': act,\n                 'affine': affine.to_tensor(),\n                 }\n\n  act_2d = common_modules.LayerNorm(\n      axis=[-1],\n      create_scale=True,\n      create_offset=True,\n      name='pair_layer_norm')(\n          representations['pair'])\n\n  outputs = []\n  safe_keys = safe_key.split(c.num_layer)\n  for sub_key in safe_keys:\n    activations, output = fold_iteration(\n        activations,\n        initial_act=initial_act,\n        static_feat_2d=act_2d,\n        safe_key=sub_key,\n        sequence_mask=sequence_mask,\n        update_affine=True,\n        is_training=is_training,\n        aatype=batch['aatype'])\n    outputs.append(output)\n\n  output = jax.tree_map(lambda *x: jnp.stack(x), *outputs)\n  # Include the activations in the output dict for use by the LDDT-Head.\n  output['act'] = activations['act']\n\n  return output\n\n\nclass StructureModule(hk.Module):\n  \"\"\"StructureModule as a network head.\n\n  Jumper et al. (2021) Suppl. Alg. 20 \"StructureModule\"\n  \"\"\"\n\n  def __init__(self, config, global_config, compute_loss=True,\n               name='structure_module'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n    self.compute_loss = compute_loss\n\n  def __call__(self, representations, batch, is_training,\n               safe_key=None):\n    c = self.config\n    ret = {}\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    output = generate_affines(\n        representations=representations,\n        batch=batch,\n        config=self.config,\n        global_config=self.global_config,\n        is_training=is_training,\n        safe_key=safe_key)\n\n    ret['representations'] = {'structure_module': output['act']}\n\n    ret['traj'] = output['affine'] * jnp.array([1.] * 4 +\n                                               [c.position_scale] * 3)\n\n    ret['sidechains'] = output['sc']\n\n    atom14_pred_positions = r3.vecs_to_tensor(output['sc']['atom_pos'])[-1]\n    ret['final_atom14_positions'] = atom14_pred_positions  # (N, 14, 3)\n    ret['final_atom14_mask'] = batch['atom14_atom_exists']  # (N, 14)\n\n    atom37_pred_positions = all_atom.atom14_to_atom37(atom14_pred_positions,\n                                                      batch)\n    atom37_pred_positions *= batch['atom37_atom_exists'][:, :, None]\n    ret['final_atom_positions'] = atom37_pred_positions  # (N, 37, 3)\n\n    ret['final_atom_mask'] = batch['atom37_atom_exists']  # (N, 37)\n    ret['final_affines'] = ret['traj'][-1]\n\n    if self.compute_loss:\n      return ret\n    else:\n      no_loss_features = ['final_atom_positions', 'final_atom_mask',\n                          'representations']\n      no_loss_ret = {k: ret[k] for k in no_loss_features}\n      return no_loss_ret\n\n  def loss(self, value, batch):\n    ret = {'loss': 0.}\n\n    ret['metrics'] = {}\n    # If requested, compute in-graph metrics.\n    if self.config.compute_in_graph_metrics:\n      atom14_pred_positions = value['final_atom14_positions']\n      # Compute renaming and violations.\n      value.update(compute_renamed_ground_truth(batch, atom14_pred_positions))\n      value['violations'] = find_structural_violations(\n          batch, atom14_pred_positions, self.config)\n\n      # Several violation metrics:\n      violation_metrics = compute_violation_metrics(\n          batch=batch,\n          atom14_pred_positions=atom14_pred_positions,\n          violations=value['violations'])\n      ret['metrics'].update(violation_metrics)\n\n    backbone_loss(ret, batch, value, self.config)\n\n    if 'renamed_atom14_gt_positions' not in value:\n      value.update(compute_renamed_ground_truth(\n          batch, value['final_atom14_positions']))\n    sc_loss = sidechain_loss(batch, value, self.config)\n\n    ret['loss'] = ((1 - self.config.sidechain.weight_frac) * ret['loss'] +\n                   self.config.sidechain.weight_frac * sc_loss['loss'])\n    ret['sidechain_fape'] = sc_loss['fape']\n\n    supervised_chi_loss(ret, batch, value, self.config)\n\n    if self.config.structural_violation_loss_weight:\n      if 'violations' not in value:\n        value['violations'] = find_structural_violations(\n            batch, value['final_atom14_positions'], self.config)\n      structural_violation_loss(ret, batch, value, self.config)\n\n    return ret\n\n\ndef compute_renamed_ground_truth(\n    batch: Dict[str, jnp.ndarray],\n    atom14_pred_positions: jnp.ndarray,\n    ) -> Dict[str, jnp.ndarray]:\n  \"\"\"Find optimal renaming of ground truth based on the predicted positions.\n\n  Jumper et al. (2021) Suppl. Alg. 26 \"renameSymmetricGroundTruthAtoms\"\n\n  This renamed ground truth is then used for all losses,\n  such that each loss moves the atoms in the same direction.\n  Shape (N).\n\n  Args:\n    batch: Dictionary containing:\n      * atom14_gt_positions: Ground truth positions.\n      * atom14_alt_gt_positions: Ground truth positions with renaming swaps.\n      * atom14_atom_is_ambiguous: 1.0 for atoms that are affected by\n          renaming swaps.\n      * atom14_gt_exists: Mask for which atoms exist in ground truth.\n      * atom14_alt_gt_exists: Mask for which atoms exist in ground truth\n          after renaming.\n      * atom14_atom_exists: Mask for whether each atom is part of the given\n          amino acid type.\n    atom14_pred_positions: Array of atom positions in global frame with shape\n      (N, 14, 3).\n  Returns:\n    Dictionary containing:\n      alt_naming_is_better: Array with 1.0 where alternative swap is better.\n      renamed_atom14_gt_positions: Array of optimal ground truth positions\n        after renaming swaps are performed.\n      renamed_atom14_gt_exists: Mask after renaming swap is performed.\n  \"\"\"\n  alt_naming_is_better = all_atom.find_optimal_renaming(\n      atom14_gt_positions=batch['atom14_gt_positions'],\n      atom14_alt_gt_positions=batch['atom14_alt_gt_positions'],\n      atom14_atom_is_ambiguous=batch['atom14_atom_is_ambiguous'],\n      atom14_gt_exists=batch['atom14_gt_exists'],\n      atom14_pred_positions=atom14_pred_positions,\n      atom14_atom_exists=batch['atom14_atom_exists'])\n\n  renamed_atom14_gt_positions = (\n      (1. - alt_naming_is_better[:, None, None])\n      * batch['atom14_gt_positions']\n      + alt_naming_is_better[:, None, None]\n      * batch['atom14_alt_gt_positions'])\n\n  renamed_atom14_gt_mask = (\n      (1. - alt_naming_is_better[:, None]) * batch['atom14_gt_exists']\n      + alt_naming_is_better[:, None] * batch['atom14_alt_gt_exists'])\n\n  return {\n      'alt_naming_is_better': alt_naming_is_better,  # (N)\n      'renamed_atom14_gt_positions': renamed_atom14_gt_positions,  # (N, 14, 3)\n      'renamed_atom14_gt_exists': renamed_atom14_gt_mask,  # (N, 14)\n  }\n\n\ndef backbone_loss(ret, batch, value, config):\n  \"\"\"Backbone FAPE Loss.\n\n  Jumper et al. (2021) Suppl. Alg. 20 \"StructureModule\" line 17\n\n  Args:\n    ret: Dictionary to write outputs into, needs to contain 'loss'.\n    batch: Batch, needs to contain 'backbone_affine_tensor',\n      'backbone_affine_mask'.\n    value: Dictionary containing structure module output, needs to contain\n      'traj', a trajectory of rigids.\n    config: Configuration of loss, should contain 'fape.clamp_distance' and\n      'fape.loss_unit_distance'.\n  \"\"\"\n  affine_trajectory = quat_affine.QuatAffine.from_tensor(value['traj'])\n  rigid_trajectory = r3.rigids_from_quataffine(affine_trajectory)\n\n  gt_affine = quat_affine.QuatAffine.from_tensor(\n      batch['backbone_affine_tensor'])\n  gt_rigid = r3.rigids_from_quataffine(gt_affine)\n  backbone_mask = batch['backbone_affine_mask']\n\n  fape_loss_fn = functools.partial(\n      all_atom.frame_aligned_point_error,\n      l1_clamp_distance=config.fape.clamp_distance,\n      length_scale=config.fape.loss_unit_distance)\n\n  fape_loss_fn = jax.vmap(fape_loss_fn, (0, None, None, 0, None, None))\n  fape_loss = fape_loss_fn(rigid_trajectory, gt_rigid, backbone_mask,\n                           rigid_trajectory.trans, gt_rigid.trans,\n                           backbone_mask)\n\n  if 'use_clamped_fape' in batch:\n    # Jumper et al. (2021) Suppl. Sec. 1.11.5 \"Loss clamping details\"\n    use_clamped_fape = jnp.asarray(batch['use_clamped_fape'], jnp.float32)\n    unclamped_fape_loss_fn = functools.partial(\n        all_atom.frame_aligned_point_error,\n        l1_clamp_distance=None,\n        length_scale=config.fape.loss_unit_distance)\n    unclamped_fape_loss_fn = jax.vmap(unclamped_fape_loss_fn,\n                                      (0, None, None, 0, None, None))\n    fape_loss_unclamped = unclamped_fape_loss_fn(rigid_trajectory, gt_rigid,\n                                                 backbone_mask,\n                                                 rigid_trajectory.trans,\n                                                 gt_rigid.trans,\n                                                 backbone_mask)\n\n    fape_loss = (fape_loss * use_clamped_fape +\n                 fape_loss_unclamped * (1 - use_clamped_fape))\n\n  ret['fape'] = fape_loss[-1]\n  ret['loss'] += jnp.mean(fape_loss)\n\n\ndef sidechain_loss(batch, value, config):\n  \"\"\"All Atom FAPE Loss using renamed rigids.\"\"\"\n  # Rename Frames\n  # Jumper et al. (2021) Suppl. Alg. 26 \"renameSymmetricGroundTruthAtoms\" line 7\n  alt_naming_is_better = value['alt_naming_is_better']\n  renamed_gt_frames = (\n      (1. - alt_naming_is_better[:, None, None])\n      * batch['rigidgroups_gt_frames']\n      + alt_naming_is_better[:, None, None]\n      * batch['rigidgroups_alt_gt_frames'])\n\n  flat_gt_frames = r3.rigids_from_tensor_flat12(\n      jnp.reshape(renamed_gt_frames, [-1, 12]))\n  flat_frames_mask = jnp.reshape(batch['rigidgroups_gt_exists'], [-1])\n\n  flat_gt_positions = r3.vecs_from_tensor(\n      jnp.reshape(value['renamed_atom14_gt_positions'], [-1, 3]))\n  flat_positions_mask = jnp.reshape(value['renamed_atom14_gt_exists'], [-1])\n\n  # Compute frame_aligned_point_error score for the final layer.\n  pred_frames = value['sidechains']['frames']\n  pred_positions = value['sidechains']['atom_pos']\n\n  def _slice_last_layer_and_flatten(x):\n    return jnp.reshape(x[-1], [-1])\n  flat_pred_frames = jax.tree_map(\n      _slice_last_layer_and_flatten, pred_frames)\n  flat_pred_positions = jax.tree_map(\n      _slice_last_layer_and_flatten, pred_positions)\n  # FAPE Loss on sidechains\n  fape = all_atom.frame_aligned_point_error(\n      pred_frames=flat_pred_frames,\n      target_frames=flat_gt_frames,\n      frames_mask=flat_frames_mask,\n      pred_positions=flat_pred_positions,\n      target_positions=flat_gt_positions,\n      positions_mask=flat_positions_mask,\n      l1_clamp_distance=config.sidechain.atom_clamp_distance,\n      length_scale=config.sidechain.length_scale)\n\n  return {\n      'fape': fape,\n      'loss': fape}\n\n\ndef structural_violation_loss(ret, batch, value, config):\n  \"\"\"Computes loss for structural violations.\"\"\"\n  assert config.sidechain.weight_frac\n\n  # Put all violation losses together to one large loss.\n  violations = value['violations']\n  num_atoms = jnp.sum(batch['atom14_atom_exists']).astype(jnp.float32)\n  ret['loss'] += (config.structural_violation_loss_weight * (\n      violations['between_residues']['bonds_c_n_loss_mean'] +\n      violations['between_residues']['angles_ca_c_n_loss_mean'] +\n      violations['between_residues']['angles_c_n_ca_loss_mean'] +\n      jnp.sum(\n          violations['between_residues']['clashes_per_atom_loss_sum'] +\n          violations['within_residues']['per_atom_loss_sum']) /\n      (1e-6 + num_atoms)))\n\n\ndef find_structural_violations(\n    batch: Dict[str, jnp.ndarray],\n    atom14_pred_positions: jnp.ndarray,  # (N, 14, 3)\n    config: ml_collections.ConfigDict\n    ):\n  \"\"\"Computes several checks for structural violations.\"\"\"\n\n  # Compute between residue backbone violations of bonds and angles.\n  connection_violations = all_atom.between_residue_bond_loss(\n      pred_atom_positions=atom14_pred_positions,\n      pred_atom_mask=batch['atom14_atom_exists'].astype(jnp.float32),\n      residue_index=batch['residue_index'].astype(jnp.float32),\n      aatype=batch['aatype'],\n      tolerance_factor_soft=config.violation_tolerance_factor,\n      tolerance_factor_hard=config.violation_tolerance_factor)\n\n  # Compute the Van der Waals radius for every atom\n  # (the first letter of the atom name is the element type).\n  # Shape: (N, 14).\n  atomtype_radius = jnp.array([\n      residue_constants.van_der_waals_radius[name[0]]\n      for name in residue_constants.atom_types\n  ])\n  atom14_atom_radius = batch['atom14_atom_exists'] * utils.batched_gather(\n      atomtype_radius, batch['residx_atom14_to_atom37'])\n\n  # Compute the between residue clash loss.\n  between_residue_clashes = all_atom.between_residue_clash_loss(\n      atom14_pred_positions=atom14_pred_positions,\n      atom14_atom_exists=batch['atom14_atom_exists'],\n      atom14_atom_radius=atom14_atom_radius,\n      residue_index=batch['residue_index'],\n      overlap_tolerance_soft=config.clash_overlap_tolerance,\n      overlap_tolerance_hard=config.clash_overlap_tolerance)\n\n  # Compute all within-residue violations (clashes,\n  # bond length and angle violations).\n  restype_atom14_bounds = residue_constants.make_atom14_dists_bounds(\n      overlap_tolerance=config.clash_overlap_tolerance,\n      bond_length_tolerance_factor=config.violation_tolerance_factor)\n  atom14_dists_lower_bound = utils.batched_gather(\n      restype_atom14_bounds['lower_bound'], batch['aatype'])\n  atom14_dists_upper_bound = utils.batched_gather(\n      restype_atom14_bounds['upper_bound'], batch['aatype'])\n  within_residue_violations = all_atom.within_residue_violations(\n      atom14_pred_positions=atom14_pred_positions,\n      atom14_atom_exists=batch['atom14_atom_exists'],\n      atom14_dists_lower_bound=atom14_dists_lower_bound,\n      atom14_dists_upper_bound=atom14_dists_upper_bound,\n      tighten_bounds_for_loss=0.0)\n\n  # Combine them to a single per-residue violation mask (used later for LDDT).\n  per_residue_violations_mask = jnp.max(jnp.stack([\n      connection_violations['per_residue_violation_mask'],\n      jnp.max(between_residue_clashes['per_atom_clash_mask'], axis=-1),\n      jnp.max(within_residue_violations['per_atom_violations'],\n              axis=-1)]), axis=0)\n\n  return {\n      'between_residues': {\n          'bonds_c_n_loss_mean':\n              connection_violations['c_n_loss_mean'],  # ()\n          'angles_ca_c_n_loss_mean':\n              connection_violations['ca_c_n_loss_mean'],  # ()\n          'angles_c_n_ca_loss_mean':\n              connection_violations['c_n_ca_loss_mean'],  # ()\n          'connections_per_residue_loss_sum':\n              connection_violations['per_residue_loss_sum'],  # (N)\n          'connections_per_residue_violation_mask':\n              connection_violations['per_residue_violation_mask'],  # (N)\n          'clashes_mean_loss':\n              between_residue_clashes['mean_loss'],  # ()\n          'clashes_per_atom_loss_sum':\n              between_residue_clashes['per_atom_loss_sum'],  # (N, 14)\n          'clashes_per_atom_clash_mask':\n              between_residue_clashes['per_atom_clash_mask'],  # (N, 14)\n      },\n      'within_residues': {\n          'per_atom_loss_sum':\n              within_residue_violations['per_atom_loss_sum'],  # (N, 14)\n          'per_atom_violations':\n              within_residue_violations['per_atom_violations'],  # (N, 14),\n      },\n      'total_per_residue_violations_mask':\n          per_residue_violations_mask,  # (N)\n  }\n\n\ndef compute_violation_metrics(\n    batch: Dict[str, jnp.ndarray],\n    atom14_pred_positions: jnp.ndarray,  # (N, 14, 3)\n    violations: Dict[str, jnp.ndarray],\n    ) -> Dict[str, jnp.ndarray]:\n  \"\"\"Compute several metrics to assess the structural violations.\"\"\"\n\n  ret = {}\n  extreme_ca_ca_violations = all_atom.extreme_ca_ca_distance_violations(\n      pred_atom_positions=atom14_pred_positions,\n      pred_atom_mask=batch['atom14_atom_exists'].astype(jnp.float32),\n      residue_index=batch['residue_index'].astype(jnp.float32))\n  ret['violations_extreme_ca_ca_distance'] = extreme_ca_ca_violations\n  ret['violations_between_residue_bond'] = utils.mask_mean(\n      mask=batch['seq_mask'],\n      value=violations['between_residues'][\n          'connections_per_residue_violation_mask'])\n  ret['violations_between_residue_clash'] = utils.mask_mean(\n      mask=batch['seq_mask'],\n      value=jnp.max(\n          violations['between_residues']['clashes_per_atom_clash_mask'],\n          axis=-1))\n  ret['violations_within_residue'] = utils.mask_mean(\n      mask=batch['seq_mask'],\n      value=jnp.max(\n          violations['within_residues']['per_atom_violations'], axis=-1))\n  ret['violations_per_residue'] = utils.mask_mean(\n      mask=batch['seq_mask'],\n      value=violations['total_per_residue_violations_mask'])\n  return ret\n\n\ndef supervised_chi_loss(ret, batch, value, config):\n  \"\"\"Computes loss for direct chi angle supervision.\n\n  Jumper et al. (2021) Suppl. Alg. 27 \"torsionAngleLoss\"\n\n  Args:\n    ret: Dictionary to write outputs into, needs to contain 'loss'.\n    batch: Batch, needs to contain 'seq_mask', 'chi_mask', 'chi_angles'.\n    value: Dictionary containing structure module output, needs to contain\n      value['sidechains']['angles_sin_cos'] for angles and\n      value['sidechains']['unnormalized_angles_sin_cos'] for unnormalized\n      angles.\n    config: Configuration of loss, should contain 'chi_weight' and\n      'angle_norm_weight', 'angle_norm_weight' scales angle norm term,\n      'chi_weight' scales torsion term.\n  \"\"\"\n  eps = 1e-6\n\n  sequence_mask = batch['seq_mask']\n  num_res = sequence_mask.shape[0]\n  chi_mask = batch['chi_mask'].astype(jnp.float32)\n  pred_angles = jnp.reshape(\n      value['sidechains']['angles_sin_cos'], [-1, num_res, 7, 2])\n  pred_angles = pred_angles[:, :, 3:]\n\n  residue_type_one_hot = jax.nn.one_hot(\n      batch['aatype'], residue_constants.restype_num + 1,\n      dtype=jnp.float32)[None]\n  chi_pi_periodic = jnp.einsum('ijk, kl->ijl', residue_type_one_hot,\n                               jnp.asarray(residue_constants.chi_pi_periodic))\n\n  true_chi = batch['chi_angles'][None]\n  sin_true_chi = jnp.sin(true_chi)\n  cos_true_chi = jnp.cos(true_chi)\n  sin_cos_true_chi = jnp.stack([sin_true_chi, cos_true_chi], axis=-1)\n\n  # This is -1 if chi is pi-periodic and +1 if it's 2pi-periodic\n  shifted_mask = (1 - 2 * chi_pi_periodic)[..., None]\n  sin_cos_true_chi_shifted = shifted_mask * sin_cos_true_chi\n\n  sq_chi_error = jnp.sum(\n      squared_difference(sin_cos_true_chi, pred_angles), -1)\n  sq_chi_error_shifted = jnp.sum(\n      squared_difference(sin_cos_true_chi_shifted, pred_angles), -1)\n  sq_chi_error = jnp.minimum(sq_chi_error, sq_chi_error_shifted)\n\n  sq_chi_loss = utils.mask_mean(mask=chi_mask[None], value=sq_chi_error)\n  ret['chi_loss'] = sq_chi_loss\n  ret['loss'] += config.chi_weight * sq_chi_loss\n  unnormed_angles = jnp.reshape(\n      value['sidechains']['unnormalized_angles_sin_cos'], [-1, num_res, 7, 2])\n  angle_norm = jnp.sqrt(jnp.sum(jnp.square(unnormed_angles), axis=-1) + eps)\n  norm_error = jnp.abs(angle_norm - 1.)\n  angle_norm_loss = utils.mask_mean(mask=sequence_mask[None, :, None],\n                                    value=norm_error)\n\n  ret['angle_norm_loss'] = angle_norm_loss\n  ret['loss'] += config.angle_norm_weight * angle_norm_loss\n\n\ndef generate_new_affine(sequence_mask):\n  num_residues, _ = sequence_mask.shape\n  quaternion = jnp.tile(\n      jnp.reshape(jnp.asarray([1., 0., 0., 0.]), [1, 4]),\n      [num_residues, 1])\n\n  translation = jnp.zeros([num_residues, 3])\n  return quat_affine.QuatAffine(quaternion, translation, unstack_inputs=True)\n\n\ndef l2_normalize(x, axis=-1, epsilon=1e-12):\n  return x / jnp.sqrt(\n      jnp.maximum(jnp.sum(x**2, axis=axis, keepdims=True), epsilon))\n\n\nclass MultiRigidSidechain(hk.Module):\n  \"\"\"Class to make side chain atoms.\"\"\"\n\n  def __init__(self, config, global_config, name='rigid_sidechain'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, affine, representations_list, aatype):\n    \"\"\"Predict side chains using multi-rigid representations.\n\n    Args:\n      affine: The affines for each residue (translations in angstroms).\n      representations_list: A list of activations to predict side chains from.\n      aatype: Amino acid types.\n\n    Returns:\n      Dict containing atom positions and frames (in angstroms).\n    \"\"\"\n    act = [\n        common_modules.Linear(  # pylint: disable=g-complex-comprehension\n            self.config.num_channel,\n            name='input_projection')(jax.nn.relu(x))\n        for x in representations_list\n    ]\n    # Sum the activation list (equivalent to concat then Linear).\n    act = sum(act)\n\n    final_init = 'zeros' if self.global_config.zero_init else 'linear'\n\n    # Mapping with some residual blocks.\n    for _ in range(self.config.num_residual_block):\n      old_act = act\n      act = common_modules.Linear(\n          self.config.num_channel,\n          initializer='relu',\n          name='resblock1')(\n              jax.nn.relu(act))\n      act = common_modules.Linear(\n          self.config.num_channel,\n          initializer=final_init,\n          name='resblock2')(\n              jax.nn.relu(act))\n      act += old_act\n\n    # Map activations to torsion angles. Shape: (num_res, 14).\n    num_res = act.shape[0]\n    unnormalized_angles = common_modules.Linear(\n        14, name='unnormalized_angles')(\n            jax.nn.relu(act))\n    unnormalized_angles = jnp.reshape(\n        unnormalized_angles, [num_res, 7, 2])\n    angles = l2_normalize(unnormalized_angles, axis=-1)\n\n    outputs = {\n        'angles_sin_cos': angles,  # jnp.ndarray (N, 7, 2)\n        'unnormalized_angles_sin_cos':\n            unnormalized_angles,  # jnp.ndarray (N, 7, 2)\n    }\n\n    # Map torsion angles to frames.\n    backb_to_global = r3.rigids_from_quataffine(affine)\n\n    # Jumper et al. (2021) Suppl. Alg. 24 \"computeAllAtomCoordinates\"\n\n    # r3.Rigids with shape (N, 8).\n    all_frames_to_global = all_atom.torsion_angles_to_frames(\n        aatype,\n        backb_to_global,\n        angles)\n\n    # Use frames and literature positions to create the final atom coordinates.\n    # r3.Vecs with shape (N, 14).\n    pred_positions = all_atom.frames_and_literature_positions_to_atom14_pos(\n        aatype, all_frames_to_global)\n\n    outputs.update({\n        'atom_pos': pred_positions,  # r3.Vecs (N, 14)\n        'frames': all_frames_to_global,  # r3.Rigids (N, 8)\n    })\n    return outputs\n"
  },
  {
    "path": "alphafold/model/folding_multimer.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Modules and utilities for the structure module in the multimer system.\"\"\"\n\nimport functools\nimport numbers\nfrom typing import Any, Dict, Iterable, Mapping, Optional, Tuple, Union\n\nfrom alphafold.common import residue_constants\nfrom alphafold.model import all_atom_multimer\nfrom alphafold.model import common_modules\nfrom alphafold.model import geometry\nfrom alphafold.model import modules\nfrom alphafold.model import prng\nfrom alphafold.model import utils\nfrom alphafold.model.geometry import utils as geometry_utils\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\nimport ml_collections\nimport numpy as np\n\n\nEPSILON = 1e-8\nFloat = Union[float, jnp.ndarray]\n\n\ndef squared_difference(x: jnp.ndarray, y: jnp.ndarray) -> jnp.ndarray:\n  \"\"\"Computes Squared difference between two arrays.\"\"\"\n  return jnp.square(x - y)\n\n\ndef make_backbone_affine(\n    positions: geometry.Vec3Array,\n    mask: jnp.ndarray,\n    aatype: jnp.ndarray,\n    ) -> Tuple[geometry.Rigid3Array, jnp.ndarray]:\n  \"\"\"Make backbone Rigid3Array and mask.\"\"\"\n  del aatype\n  a = residue_constants.atom_order['N']\n  b = residue_constants.atom_order['CA']\n  c = residue_constants.atom_order['C']\n\n  rigid_mask = (mask[:, a] * mask[:, b] * mask[:, c]).astype(\n      jnp.float32)\n\n  rigid = all_atom_multimer.make_transform_from_reference(\n      a_xyz=positions[:, a], b_xyz=positions[:, b], c_xyz=positions[:, c])\n\n  return rigid, rigid_mask\n\n\nclass QuatRigid(hk.Module):\n  \"\"\"Module for projecting Rigids via a quaternion.\"\"\"\n\n  def __init__(self,\n               global_config: ml_collections.ConfigDict,\n               rigid_shape: Union[int, Iterable[int]] = tuple(),\n               full_quat: bool = False,\n               init: str = 'zeros',\n               name: str = 'quat_rigid'):\n    \"\"\"Module projecting a Rigid Object.\n\n    For this Module the Rotation is parametrized as a quaternion,\n    If 'full_quat' is True a 4 vector is produced for the rotation which is\n    normalized and treated as a quaternion.\n    When 'full_quat' is False a 3 vector is produced and the 1st component of\n    the quaternion is set to 1.\n\n    Args:\n      global_config: Global Config, used to set certain properties of underlying\n        Linear module, see common_modules.Linear for details.\n      rigid_shape: Shape of Rigids relative to shape of activations, e.g. when\n        activations have shape (n,) and this is (m,) output will be (n, m)\n      full_quat: Whether to parametrize rotation using full quaternion.\n      init: initializer to use, see common_modules.Linear for details\n      name: Name to use for module.\n    \"\"\"\n    self.init = init\n    self.global_config = global_config\n    if isinstance(rigid_shape, int):\n      self.rigid_shape = (rigid_shape,)\n    else:\n      self.rigid_shape = tuple(rigid_shape)\n    self.full_quat = full_quat\n    super(QuatRigid, self).__init__(name=name)\n\n  def __call__(self, activations: jnp.ndarray) -> geometry.Rigid3Array:\n    \"\"\"Executes Module.\n\n    This returns a set of rigid with the same shape as activations, projecting\n    the channel dimension, rigid_shape controls the trailing dimensions.\n    For example when activations is shape (12, 5) and rigid_shape is (3, 2)\n    then the shape of the output rigids will be (12, 3, 2).\n    This also supports passing in an empty tuple for rigid shape, in that case\n    the example would produce a rigid of shape (12,).\n\n    Args:\n      activations: Activations to use for projection, shape [..., num_channel]\n    Returns:\n      Rigid transformations with shape [...] + rigid_shape\n    \"\"\"\n    if self.full_quat:\n      rigid_dim = 7\n    else:\n      rigid_dim = 6\n    linear_dims = self.rigid_shape + (rigid_dim,)\n    rigid_flat = common_modules.Linear(\n        linear_dims,\n        initializer=self.init,\n        precision=jax.lax.Precision.HIGHEST,\n        name='rigid')(\n            activations)\n    rigid_flat = geometry_utils.unstack(rigid_flat)\n    if self.full_quat:\n      qw, qx, qy, qz = rigid_flat[:4]\n      translation = rigid_flat[4:]\n    else:\n      qx, qy, qz = rigid_flat[:3]\n      qw = jnp.ones_like(qx)\n      translation = rigid_flat[3:]\n    rotation = geometry.Rot3Array.from_quaternion(\n        qw, qx, qy, qz, normalize=True)\n    translation = geometry.Vec3Array(*translation)\n    return geometry.Rigid3Array(rotation, translation)\n\n\nclass PointProjection(hk.Module):\n  \"\"\"Given input reprensentation and frame produces points in global frame.\"\"\"\n\n  def __init__(self,\n               num_points: Union[Iterable[int], int],\n               global_config: ml_collections.ConfigDict,\n               return_local_points: bool = False,\n               name: str = 'point_projection'):\n    \"\"\"Constructs Linear Module.\n\n    Args:\n      num_points: number of points to project. Can be tuple when outputting\n          multiple dimensions\n      global_config: Global Config, passed through to underlying Linear\n      return_local_points: Whether to return points in local frame as well.\n      name: name of module, used for name scopes.\n    \"\"\"\n    if isinstance(num_points, numbers.Integral):\n      self.num_points = (num_points,)\n    else:\n      self.num_points = tuple(num_points)\n\n    self.return_local_points = return_local_points\n\n    self.global_config = global_config\n\n    super().__init__(name=name)\n\n  def __call__(\n      self, activations: jnp.ndarray, rigids: geometry.Rigid3Array\n  ) -> Union[geometry.Vec3Array, Tuple[geometry.Vec3Array, geometry.Vec3Array]]:\n    output_shape = self.num_points\n    output_shape = output_shape[:-1] + (3 * output_shape[-1],)\n    points_local = common_modules.Linear(\n        output_shape,\n        precision=jax.lax.Precision.HIGHEST,\n        name='point_projection')(\n            activations)\n    points_local = jnp.split(points_local, 3, axis=-1)\n    points_local = geometry.Vec3Array(*points_local)\n    rigids = rigids[(...,) + (None,) * len(output_shape)]\n    points_global = rigids.apply_to_point(points_local)\n    if self.return_local_points:\n      return points_global, points_local\n    else:\n      return points_global\n\n\nclass InvariantPointAttention(hk.Module):\n  \"\"\"Invariant point attention module.\n\n  The high-level idea is that this attention module works over a set of points\n  and associated orientations in 3D space (e.g. protein residues).\n\n  Each residue outputs a set of queries and keys as points in their local\n  reference frame.  The attention is then defined as the euclidean distance\n  between the queries and keys in the global frame.\n  \"\"\"\n\n  def __init__(self,\n               config: ml_collections.ConfigDict,\n               global_config: ml_collections.ConfigDict,\n               dist_epsilon: float = 1e-8,\n               name: str = 'invariant_point_attention'):\n    \"\"\"Initialize.\n\n    Args:\n      config: iterative Fold Head Config\n      global_config: Global Config of Model.\n      dist_epsilon: Small value to avoid NaN in distance calculation.\n      name: Sonnet name.\n    \"\"\"\n    super().__init__(name=name)\n\n    self._dist_epsilon = dist_epsilon\n    self._zero_initialize_last = global_config.zero_init\n\n    self.config = config\n\n    self.global_config = global_config\n\n  def __call__(\n      self,\n      inputs_1d: jnp.ndarray,\n      inputs_2d: jnp.ndarray,\n      mask: jnp.ndarray,\n      rigid: geometry.Rigid3Array,\n      ) -> jnp.ndarray:\n    \"\"\"Compute geometric aware attention.\n\n    Given a set of query residues (defined by affines and associated scalar\n    features), this function computes geometric aware attention between the\n    query residues and target residues.\n\n    The residues produce points in their local reference frame, which\n    are converted into the global frame to get attention via euclidean distance.\n\n    Equivalently the target residues produce points in their local frame to be\n    used as attention values, which are converted into the query residues local\n    frames.\n\n    Args:\n      inputs_1d: (N, C) 1D input embedding that is the basis for the\n        scalar queries.\n      inputs_2d: (N, M, C') 2D input embedding, used for biases values in the\n        attention between query_inputs_1d and target_inputs_1d.\n      mask: (N, 1) mask to indicate query_inputs_1d that participate in\n        the attention.\n      rigid: Rigid object describing the position and orientation of\n        every element in query_inputs_1d.\n\n    Returns:\n      Transformation of the input embedding.\n    \"\"\"\n\n    num_head = self.config.num_head\n\n    attn_logits = 0.\n\n    num_point_qk = self.config.num_point_qk\n    # Each point pair (q, k) contributes Var [0.5 ||q||^2 - <q, k>] = 9 / 2\n    point_variance = max(num_point_qk, 1) * 9. / 2\n    point_weights = np.sqrt(1.0 / point_variance)\n\n    # This is equivalent to jax.nn.softplus, but avoids a bug in the test...\n    softplus = lambda x: jnp.logaddexp(x, jnp.zeros_like(x))\n    raw_point_weights = hk.get_parameter(\n        'trainable_point_weights',\n        shape=[num_head],\n        # softplus^{-1} (1)\n        init=hk.initializers.Constant(np.log(np.exp(1.) - 1.)))\n\n    # Trainable per-head weights for points.\n    trainable_point_weights = softplus(raw_point_weights)\n    point_weights *= trainable_point_weights\n    q_point = PointProjection([num_head, num_point_qk],\n                              self.global_config,\n                              name='q_point_projection')(inputs_1d,\n                                                         rigid)\n\n    k_point = PointProjection([num_head, num_point_qk],\n                              self.global_config,\n                              name='k_point_projection')(inputs_1d,\n                                                         rigid)\n\n    dist2 = geometry.square_euclidean_distance(\n        q_point[:, None, :, :], k_point[None, :, :, :], epsilon=0.)\n    attn_qk_point = -0.5 * jnp.sum(point_weights[:, None] * dist2, axis=-1)\n    attn_logits += attn_qk_point\n\n    num_scalar_qk = self.config.num_scalar_qk\n    # We assume that all queries and keys come iid from N(0, 1) distribution\n    # and compute the variances of the attention logits.\n    # Each scalar pair (q, k) contributes Var q*k = 1\n    scalar_variance = max(num_scalar_qk, 1) * 1.\n    scalar_weights = np.sqrt(1.0 / scalar_variance)\n    q_scalar = common_modules.Linear([num_head, num_scalar_qk],\n                                     use_bias=False,\n                                     name='q_scalar_projection')(\n                                         inputs_1d)\n\n    k_scalar = common_modules.Linear([num_head, num_scalar_qk],\n                                     use_bias=False,\n                                     name='k_scalar_projection')(\n                                         inputs_1d)\n    q_scalar *= scalar_weights\n    attn_logits += jnp.einsum('qhc,khc->qkh', q_scalar, k_scalar)\n\n    attention_2d = common_modules.Linear(\n        num_head, name='attention_2d')(inputs_2d)\n    attn_logits += attention_2d\n\n    mask_2d = mask * jnp.swapaxes(mask, -1, -2)\n    attn_logits -= 1e5 * (1. - mask_2d[..., None])\n\n    attn_logits *= np.sqrt(1. / 3)     # Normalize by number of logit terms (3)\n    attn = jax.nn.softmax(attn_logits, axis=-2)\n\n    num_scalar_v = self.config.num_scalar_v\n\n    v_scalar = common_modules.Linear([num_head, num_scalar_v],\n                                     use_bias=False,\n                                     name='v_scalar_projection')(\n                                         inputs_1d)\n\n    # [num_query_residues, num_head, num_scalar_v]\n    result_scalar = jnp.einsum('qkh, khc->qhc', attn, v_scalar)\n\n    num_point_v = self.config.num_point_v\n    v_point = PointProjection([num_head, num_point_v],\n                              self.global_config,\n                              name='v_point_projection')(inputs_1d,\n                                                         rigid)\n\n    result_point_global = jax.tree_map(\n        lambda x: jnp.sum(attn[..., None] * x, axis=-3), v_point[None])\n\n    # Features used in the linear output projection. Should have the size\n    # [num_query_residues, ?]\n    output_features = []\n    num_query_residues, _ = inputs_1d.shape\n\n    flat_shape = [num_query_residues, -1]\n\n    result_scalar = jnp.reshape(result_scalar, flat_shape)\n    output_features.append(result_scalar)\n\n    result_point_global = jax.tree_map(lambda r: jnp.reshape(r, flat_shape),\n                                       result_point_global)\n    result_point_local = rigid[..., None].apply_inverse_to_point(\n        result_point_global)\n    output_features.extend(\n        [result_point_local.x, result_point_local.y, result_point_local.z])\n\n    point_norms = result_point_local.norm(self._dist_epsilon)\n    output_features.append(point_norms)\n\n    # Dimensions: h = heads, i and j = residues,\n    # c = inputs_2d channels\n    # Contraction happens over the second residue dimension, similarly to how\n    # the usual attention is performed.\n    result_attention_over_2d = jnp.einsum('ijh, ijc->ihc', attn, inputs_2d)\n    output_features.append(jnp.reshape(result_attention_over_2d, flat_shape))\n\n    final_init = 'zeros' if self._zero_initialize_last else 'linear'\n\n    final_act = jnp.concatenate(output_features, axis=-1)\n\n    return common_modules.Linear(\n        self.config.num_channel,\n        initializer=final_init,\n        name='output_projection')(final_act)\n\n\nclass FoldIteration(hk.Module):\n  \"\"\"A single iteration of iterative folding.\n\n  First, each residue attends to all residues using InvariantPointAttention.\n  Then, we apply transition layers to update the hidden representations.\n  Finally, we use the hidden representations to produce an update to the\n  affine of each residue.\n  \"\"\"\n\n  def __init__(self,\n               config: ml_collections.ConfigDict,\n               global_config: ml_collections.ConfigDict,\n               name: str = 'fold_iteration'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(\n      self,\n      activations: Mapping[str, Any],\n      aatype: jnp.ndarray,\n      sequence_mask: jnp.ndarray,\n      update_rigid: bool,\n      is_training: bool,\n      initial_act: jnp.ndarray,\n      safe_key: Optional[prng.SafeKey] = None,\n      static_feat_2d: Optional[jnp.ndarray] = None,\n  ) -> Tuple[Dict[str, Any], Dict[str, Any]]:\n\n    c = self.config\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    def safe_dropout_fn(tensor, safe_key):\n      return modules.apply_dropout(\n          tensor=tensor,\n          safe_key=safe_key,\n          rate=0.0 if self.global_config.deterministic else c.dropout,\n          is_training=is_training)\n\n    rigid = activations['rigid']\n\n    act = activations['act']\n    attention_module = InvariantPointAttention(\n        self.config, self.global_config)\n    # Attention\n    act += attention_module(\n        inputs_1d=act,\n        inputs_2d=static_feat_2d,\n        mask=sequence_mask,\n        rigid=rigid)\n\n    safe_key, *sub_keys = safe_key.split(3)\n    sub_keys = iter(sub_keys)\n    act = safe_dropout_fn(act, next(sub_keys))\n    act = common_modules.LayerNorm(\n        axis=-1,\n        create_scale=True,\n        create_offset=True,\n        name='attention_layer_norm')(\n            act)\n    final_init = 'zeros' if self.global_config.zero_init else 'linear'\n\n    # Transition\n    input_act = act\n    for i in range(c.num_layer_in_transition):\n      init = 'relu' if i < c.num_layer_in_transition - 1 else final_init\n      act = common_modules.Linear(\n          c.num_channel,\n          initializer=init,\n          name='transition')(\n              act)\n      if i < c.num_layer_in_transition - 1:\n        act = jax.nn.relu(act)\n    act += input_act\n    act = safe_dropout_fn(act, next(sub_keys))\n    act = common_modules.LayerNorm(\n        axis=-1,\n        create_scale=True,\n        create_offset=True,\n        name='transition_layer_norm')(act)\n    if update_rigid:\n      # Rigid update\n      rigid_update = QuatRigid(\n          self.global_config, init=final_init)(\n              act)\n      rigid = rigid @ rigid_update\n\n    sc = MultiRigidSidechain(c.sidechain, self.global_config)(\n        rigid.scale_translation(c.position_scale), [act, initial_act], aatype)\n\n    outputs = {'rigid': rigid, 'sc': sc}\n\n    rotation = jax.tree_map(jax.lax.stop_gradient, rigid.rotation)\n    rigid = geometry.Rigid3Array(rotation, rigid.translation)\n\n    new_activations = {\n        'act': act,\n        'rigid': rigid\n    }\n    return new_activations, outputs\n\n\ndef generate_monomer_rigids(representations: Mapping[str, jnp.ndarray],\n                            batch: Mapping[str, jnp.ndarray],\n                            config: ml_collections.ConfigDict,\n                            global_config: ml_collections.ConfigDict,\n                            is_training: bool,\n                            safe_key: prng.SafeKey\n                            ) -> Dict[str, Any]:\n  \"\"\"Generate predicted Rigid's for a single chain.\n\n  This is the main part of the iterative fold head - it iteratively applies\n  folding to produce a set of predicted residue positions.\n\n  Args:\n    representations: Embeddings dictionary.\n    batch: Batch dictionary.\n    config: config for the iterative fold head.\n    global_config: global config.\n    is_training: is training.\n    safe_key: A prng.SafeKey object that wraps a PRNG key.\n\n  Returns:\n    A dictionary containing residue Rigid's and sidechain positions.\n  \"\"\"\n  c = config\n  sequence_mask = batch['seq_mask'][:, None]\n  act = common_modules.LayerNorm(\n      axis=-1, create_scale=True, create_offset=True, name='single_layer_norm')(\n          representations['single'])\n\n  initial_act = act\n  act = common_modules.Linear(\n      c.num_channel, name='initial_projection')(act)\n\n  # Sequence Mask has extra 1 at the end.\n  rigid = geometry.Rigid3Array.identity(sequence_mask.shape[:-1])\n\n  fold_iteration = FoldIteration(\n      c, global_config, name='fold_iteration')\n\n  assert len(batch['seq_mask'].shape) == 1\n\n  activations = {\n      'act':\n          act,\n      'rigid':\n          rigid\n  }\n\n  act_2d = common_modules.LayerNorm(\n      axis=-1,\n      create_scale=True,\n      create_offset=True,\n      name='pair_layer_norm')(\n          representations['pair'])\n\n  safe_keys = safe_key.split(c.num_layer)\n  outputs = []\n  for key in safe_keys:\n\n    activations, output = fold_iteration(\n        activations,\n        initial_act=initial_act,\n        static_feat_2d=act_2d,\n        aatype=batch['aatype'],\n        safe_key=key,\n        sequence_mask=sequence_mask,\n        update_rigid=True,\n        is_training=is_training,\n        )\n    outputs.append(output)\n\n  output = jax.tree_map(lambda *x: jnp.stack(x), *outputs)\n  # Pass along for LDDT-Head.\n  output['act'] = activations['act']\n\n  return output\n\n\nclass StructureModule(hk.Module):\n  \"\"\"StructureModule as a network head.\n\n  Jumper et al. (2021) Suppl. Alg. 20 \"StructureModule\"\n  \"\"\"\n\n  def __init__(self,\n               config: ml_collections.ConfigDict,\n               global_config: ml_collections.ConfigDict,\n               name: str = 'structure_module'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               representations: Mapping[str, jnp.ndarray],\n               batch: Mapping[str, Any],\n               is_training: bool,\n               safe_key: Optional[prng.SafeKey] = None,\n               compute_loss: bool = False\n               ) -> Dict[str, Any]:\n    c = self.config\n    ret = {}\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    output = generate_monomer_rigids(\n        representations=representations,\n        batch=batch,\n        config=self.config,\n        global_config=self.global_config,\n        is_training=is_training,\n        safe_key=safe_key)\n\n    ret['traj'] = output['rigid'].scale_translation(c.position_scale).to_array()\n    ret['sidechains'] = output['sc']\n    ret['sidechains']['atom_pos'] = ret['sidechains']['atom_pos'].to_array()\n    ret['sidechains']['frames'] = ret['sidechains']['frames'].to_array()\n    if 'local_atom_pos' in ret['sidechains']:\n      ret['sidechains']['local_atom_pos'] = ret['sidechains'][\n          'local_atom_pos'].to_array()\n      ret['sidechains']['local_frames'] = ret['sidechains'][\n          'local_frames'].to_array()\n\n    aatype = batch['aatype']\n    seq_mask = batch['seq_mask']\n\n    atom14_pred_mask = all_atom_multimer.get_atom14_mask(\n        aatype) * seq_mask[:, None]\n    atom14_pred_positions = output['sc']['atom_pos'][-1]\n    ret['final_atom14_positions'] = atom14_pred_positions  # (N, 14, 3)\n    ret['final_atom14_mask'] = atom14_pred_mask  # (N, 14)\n\n    atom37_mask = all_atom_multimer.get_atom37_mask(aatype) * seq_mask[:, None]\n    atom37_pred_positions = all_atom_multimer.atom14_to_atom37(\n        atom14_pred_positions, aatype)\n    atom37_pred_positions *= atom37_mask[:, :, None]\n    ret['final_atom_positions'] = atom37_pred_positions  # (N, 37, 3)\n    ret['final_atom_mask'] = atom37_mask  # (N, 37)\n    ret['final_rigids'] = ret['traj'][-1]\n\n    ret['act'] = output['act']\n\n    if compute_loss:\n      return ret\n    else:\n      no_loss_features = ['final_atom_positions', 'final_atom_mask', 'act']\n      no_loss_ret = {k: ret[k] for k in no_loss_features}\n      return no_loss_ret\n\n  def loss(self,\n           value: Mapping[str, Any],\n           batch: Mapping[str, Any]\n           ) -> Dict[str, Any]:\n\n    raise NotImplementedError(\n        'This function should be called on a batch with reordered chains (see '\n        'Evans et al (2021) Section 7.3. Multi-Chain Permutation Alignment.')\n\n    ret = {'loss': 0.}\n\n    ret['metrics'] = {}\n\n    aatype = batch['aatype']\n    all_atom_positions = batch['all_atom_positions']\n    all_atom_positions = geometry.Vec3Array.from_array(all_atom_positions)\n    all_atom_mask = batch['all_atom_mask']\n    seq_mask = batch['seq_mask']\n    residue_index = batch['residue_index']\n\n    gt_rigid, gt_affine_mask = make_backbone_affine(all_atom_positions,\n                                                    all_atom_mask,\n                                                    aatype)\n\n    chi_angles, chi_mask = all_atom_multimer.compute_chi_angles(\n        all_atom_positions, all_atom_mask, aatype)\n\n    pred_mask = all_atom_multimer.get_atom14_mask(aatype)\n    pred_mask *= seq_mask[:, None]\n    pred_positions = value['final_atom14_positions']\n    pred_positions = geometry.Vec3Array.from_array(pred_positions)\n\n    gt_positions, gt_mask, alt_naming_is_better = compute_atom14_gt(\n        aatype, all_atom_positions, all_atom_mask, pred_positions)\n\n    violations = find_structural_violations(\n        aatype=aatype,\n        residue_index=residue_index,\n        mask=pred_mask,\n        pred_positions=pred_positions,\n        config=self.config,\n        asym_id=batch['asym_id'])\n\n    sidechains = value['sidechains']\n\n    gt_chi_angles = get_renamed_chi_angles(aatype, chi_angles,\n                                           alt_naming_is_better)\n\n    # Several violation metrics:\n    violation_metrics = compute_violation_metrics(\n        residue_index=residue_index,\n        mask=pred_mask,\n        seq_mask=seq_mask,\n        pred_positions=pred_positions,\n        violations=violations)\n    ret['metrics'].update(violation_metrics)\n\n    target_rigid = geometry.Rigid3Array.from_array(value['traj'])\n    gt_frames_mask = gt_affine_mask\n\n    # Split the loss into within-chain and between-chain components.\n    intra_chain_mask = batch['asym_id'][:, None] == batch['asym_id'][None, :]\n    intra_chain_bb_loss, intra_chain_fape = backbone_loss(\n        gt_rigid=gt_rigid,\n        gt_frames_mask=gt_frames_mask,\n        gt_positions_mask=gt_affine_mask,\n        target_rigid=target_rigid,\n        config=self.config.intra_chain_fape,\n        pair_mask=intra_chain_mask)\n    interface_bb_loss, interface_fape = backbone_loss(\n        gt_rigid=gt_rigid,\n        gt_frames_mask=gt_frames_mask,\n        gt_positions_mask=gt_affine_mask,\n        target_rigid=target_rigid,\n        config=self.config.interface_fape,\n        pair_mask=1. - intra_chain_mask)\n\n    bb_loss = intra_chain_bb_loss + interface_bb_loss\n    ret['fape'] = intra_chain_fape + interface_fape\n    ret['bb_loss'] = bb_loss\n    ret['loss'] += bb_loss\n\n    pred_frames = geometry.Rigid3Array.from_array(sidechains['frames'])\n    pred_positions = geometry.Vec3Array.from_array(sidechains['atom_pos'])\n    gt_sc_frames, gt_sc_frames_mask = compute_frames(\n        aatype=aatype,\n        all_atom_positions=all_atom_positions,\n        all_atom_mask=all_atom_mask,\n        use_alt=alt_naming_is_better)\n\n    sc_loss = sidechain_loss(\n        gt_frames=gt_sc_frames,\n        gt_frames_mask=gt_sc_frames_mask,\n        gt_positions=gt_positions,\n        gt_mask=gt_mask,\n        pred_frames=pred_frames,\n        pred_positions=pred_positions,\n        config=self.config)\n\n    ret['loss'] = ((1 - self.config.sidechain.weight_frac) * ret['loss'] +\n                   self.config.sidechain.weight_frac * sc_loss['loss'])\n    ret['sidechain_fape'] = sc_loss['fape']\n\n    unnormed_angles = sidechains['unnormalized_angles_sin_cos']\n    pred_angles = sidechains['angles_sin_cos']\n\n    sup_chi_loss, ret['chi_loss'], ret[\n        'angle_norm_loss'] = supervised_chi_loss(\n            sequence_mask=seq_mask,\n            target_chi_mask=chi_mask,\n            target_chi_angles=gt_chi_angles,\n            aatype=aatype,\n            pred_angles=pred_angles,\n            unnormed_angles=unnormed_angles,\n            config=self.config)\n    ret['loss'] += sup_chi_loss\n\n    if self.config.structural_violation_loss_weight:\n\n      ret['loss'] += structural_violation_loss(\n          mask=pred_mask, violations=violations, config=self.config)\n\n    return ret\n\n\ndef compute_atom14_gt(\n    aatype: jnp.ndarray,\n    all_atom_positions: geometry.Vec3Array,\n    all_atom_mask: jnp.ndarray,\n    pred_pos: geometry.Vec3Array\n) -> Tuple[geometry.Vec3Array, jnp.ndarray, jnp.ndarray]:\n  \"\"\"Find atom14 positions, this includes finding the correct renaming.\"\"\"\n  gt_positions, gt_mask = all_atom_multimer.atom37_to_atom14(\n      aatype, all_atom_positions,\n      all_atom_mask)\n  alt_gt_positions, alt_gt_mask = all_atom_multimer.get_alt_atom14(\n      aatype, gt_positions, gt_mask)\n  atom_is_ambiguous = all_atom_multimer.get_atom14_is_ambiguous(aatype)\n\n  alt_naming_is_better = all_atom_multimer.find_optimal_renaming(\n      gt_positions=gt_positions,\n      alt_gt_positions=alt_gt_positions,\n      atom_is_ambiguous=atom_is_ambiguous,\n      gt_exists=gt_mask,\n      pred_positions=pred_pos)\n\n  use_alt = alt_naming_is_better[:, None]\n\n  gt_mask = (1. - use_alt) * gt_mask + use_alt * alt_gt_mask\n  gt_positions = (1. - use_alt) * gt_positions + use_alt * alt_gt_positions\n\n  return gt_positions, alt_gt_mask, alt_naming_is_better\n\n\ndef backbone_loss(gt_rigid: geometry.Rigid3Array,\n                  gt_frames_mask: jnp.ndarray,\n                  gt_positions_mask: jnp.ndarray,\n                  target_rigid: geometry.Rigid3Array,\n                  config: ml_collections.ConfigDict,\n                  pair_mask: jnp.ndarray\n                  ) -> Tuple[Float, jnp.ndarray]:\n  \"\"\"Backbone FAPE Loss.\"\"\"\n  loss_fn = functools.partial(\n      all_atom_multimer.frame_aligned_point_error,\n      l1_clamp_distance=config.atom_clamp_distance,\n      length_scale=config.loss_unit_distance)\n\n  loss_fn = jax.vmap(loss_fn, (0, None, None, 0, None, None, None))\n  fape = loss_fn(target_rigid, gt_rigid, gt_frames_mask,\n                 target_rigid.translation, gt_rigid.translation,\n                 gt_positions_mask, pair_mask)\n\n  return jnp.mean(fape), fape[-1]\n\n\ndef compute_frames(\n    aatype: jnp.ndarray,\n    all_atom_positions: geometry.Vec3Array,\n    all_atom_mask: jnp.ndarray,\n    use_alt: jnp.ndarray\n    ) -> Tuple[geometry.Rigid3Array, jnp.ndarray]:\n  \"\"\"Compute Frames from all atom positions.\n\n  Args:\n    aatype: array of aatypes, int of [N]\n    all_atom_positions: Vector of all atom positions, shape [N, 37]\n    all_atom_mask: mask, shape [N]\n    use_alt: whether to use alternative orientation for ambiguous aatypes\n             shape [N]\n  Returns:\n    Rigid corresponding to Frames w shape [N, 8],\n    mask which Rigids are present w shape [N, 8]\n  \"\"\"\n  frames_batch = all_atom_multimer.atom37_to_frames(aatype, all_atom_positions,\n                                                    all_atom_mask)\n  gt_frames = frames_batch['rigidgroups_gt_frames']\n  alt_gt_frames = frames_batch['rigidgroups_alt_gt_frames']\n  use_alt = use_alt[:, None]\n\n  renamed_gt_frames = jax.tree_map(\n      lambda x, y: (1. - use_alt) * x + use_alt * y, gt_frames, alt_gt_frames)\n\n  return renamed_gt_frames, frames_batch['rigidgroups_gt_exists']\n\n\ndef sidechain_loss(gt_frames: geometry.Rigid3Array,\n                   gt_frames_mask: jnp.ndarray,\n                   gt_positions: geometry.Vec3Array,\n                   gt_mask: jnp.ndarray,\n                   pred_frames: geometry.Rigid3Array,\n                   pred_positions: geometry.Vec3Array,\n                   config: ml_collections.ConfigDict\n                   ) -> Dict[str, jnp.ndarray]:\n  \"\"\"Sidechain Loss using cleaned up rigids.\"\"\"\n\n  flat_gt_frames = jax.tree_map(jnp.ravel, gt_frames)\n  flat_frames_mask = jnp.ravel(gt_frames_mask)\n\n  flat_gt_positions = jax.tree_map(jnp.ravel, gt_positions)\n  flat_positions_mask = jnp.ravel(gt_mask)\n\n  # Compute frame_aligned_point_error score for the final layer.\n  def _slice_last_layer_and_flatten(x):\n    return jnp.ravel(x[-1])\n\n  flat_pred_frames = jax.tree_map(_slice_last_layer_and_flatten, pred_frames)\n  flat_pred_positions = jax.tree_map(_slice_last_layer_and_flatten,\n                                     pred_positions)\n  fape = all_atom_multimer.frame_aligned_point_error(\n      pred_frames=flat_pred_frames,\n      target_frames=flat_gt_frames,\n      frames_mask=flat_frames_mask,\n      pred_positions=flat_pred_positions,\n      target_positions=flat_gt_positions,\n      positions_mask=flat_positions_mask,\n      pair_mask=None,\n      length_scale=config.sidechain.loss_unit_distance,\n      l1_clamp_distance=config.sidechain.atom_clamp_distance)\n\n  return {\n      'fape': fape,\n      'loss': fape}\n\n\ndef structural_violation_loss(mask: jnp.ndarray,\n                              violations: Mapping[str, Float],\n                              config: ml_collections.ConfigDict\n                              ) -> Float:\n  \"\"\"Computes Loss for structural Violations.\"\"\"\n  # Put all violation losses together to one large loss.\n  num_atoms = jnp.sum(mask).astype(jnp.float32) + 1e-6\n  between_residues = violations['between_residues']\n  within_residues = violations['within_residues']\n  return (config.structural_violation_loss_weight *\n          (between_residues['bonds_c_n_loss_mean'] +\n           between_residues['angles_ca_c_n_loss_mean']  +\n           between_residues['angles_c_n_ca_loss_mean'] +\n           jnp.sum(between_residues['clashes_per_atom_loss_sum'] +\n                   within_residues['per_atom_loss_sum']) / num_atoms\n           ))\n\n\ndef find_structural_violations(\n    aatype: jnp.ndarray,\n    residue_index: jnp.ndarray,\n    mask: jnp.ndarray,\n    pred_positions: geometry.Vec3Array,  # (N, 14)\n    config: ml_collections.ConfigDict,\n    asym_id: jnp.ndarray,\n    ) -> Dict[str, Any]:\n  \"\"\"Computes several checks for structural Violations.\"\"\"\n\n  # Compute between residue backbone violations of bonds and angles.\n  connection_violations = all_atom_multimer.between_residue_bond_loss(\n      pred_atom_positions=pred_positions,\n      pred_atom_mask=mask.astype(jnp.float32),\n      residue_index=residue_index.astype(jnp.float32),\n      aatype=aatype,\n      tolerance_factor_soft=config.violation_tolerance_factor,\n      tolerance_factor_hard=config.violation_tolerance_factor)\n\n  # Compute the van der Waals radius for every atom\n  # (the first letter of the atom name is the element type).\n  # shape (N, 14)\n  atomtype_radius = jnp.array([\n      residue_constants.van_der_waals_radius[name[0]]\n      for name in residue_constants.atom_types\n  ])\n  residx_atom14_to_atom37 = all_atom_multimer.get_atom14_to_atom37_map(aatype)\n  atom_radius = mask * utils.batched_gather(atomtype_radius,\n                                            residx_atom14_to_atom37)\n\n  # Compute the between residue clash loss.\n  between_residue_clashes = all_atom_multimer.between_residue_clash_loss(\n      pred_positions=pred_positions,\n      atom_exists=mask,\n      atom_radius=atom_radius,\n      residue_index=residue_index,\n      overlap_tolerance_soft=config.clash_overlap_tolerance,\n      overlap_tolerance_hard=config.clash_overlap_tolerance,\n      asym_id=asym_id)\n\n  # Compute all within-residue violations (clashes,\n  # bond length and angle violations).\n  restype_atom14_bounds = residue_constants.make_atom14_dists_bounds(\n      overlap_tolerance=config.clash_overlap_tolerance,\n      bond_length_tolerance_factor=config.violation_tolerance_factor)\n  dists_lower_bound = utils.batched_gather(restype_atom14_bounds['lower_bound'],\n                                           aatype)\n  dists_upper_bound = utils.batched_gather(restype_atom14_bounds['upper_bound'],\n                                           aatype)\n  within_residue_violations = all_atom_multimer.within_residue_violations(\n      pred_positions=pred_positions,\n      atom_exists=mask,\n      dists_lower_bound=dists_lower_bound,\n      dists_upper_bound=dists_upper_bound,\n      tighten_bounds_for_loss=0.0)\n\n  # Combine them to a single per-residue violation mask (used later for LDDT).\n  per_residue_violations_mask = jnp.max(jnp.stack([\n      connection_violations['per_residue_violation_mask'],\n      jnp.max(between_residue_clashes['per_atom_clash_mask'], axis=-1),\n      jnp.max(within_residue_violations['per_atom_violations'],\n              axis=-1)]), axis=0)\n\n  return {\n      'between_residues': {\n          'bonds_c_n_loss_mean':\n              connection_violations['c_n_loss_mean'],  # ()\n          'angles_ca_c_n_loss_mean':\n              connection_violations['ca_c_n_loss_mean'],  # ()\n          'angles_c_n_ca_loss_mean':\n              connection_violations['c_n_ca_loss_mean'],  # ()\n          'connections_per_residue_loss_sum':\n              connection_violations['per_residue_loss_sum'],  # (N)\n          'connections_per_residue_violation_mask':\n              connection_violations['per_residue_violation_mask'],  # (N)\n          'clashes_mean_loss':\n              between_residue_clashes['mean_loss'],  # ()\n          'clashes_per_atom_loss_sum':\n              between_residue_clashes['per_atom_loss_sum'],  # (N, 14)\n          'clashes_per_atom_clash_mask':\n              between_residue_clashes['per_atom_clash_mask'],  # (N, 14)\n      },\n      'within_residues': {\n          'per_atom_loss_sum':\n              within_residue_violations['per_atom_loss_sum'],  # (N, 14)\n          'per_atom_violations':\n              within_residue_violations['per_atom_violations'],  # (N, 14),\n      },\n      'total_per_residue_violations_mask':\n          per_residue_violations_mask,  # (N)\n  }\n\n\ndef compute_violation_metrics(\n    residue_index: jnp.ndarray,\n    mask: jnp.ndarray,\n    seq_mask: jnp.ndarray,\n    pred_positions: geometry.Vec3Array,  # (N, 14)\n    violations: Mapping[str, jnp.ndarray],\n) -> Dict[str, jnp.ndarray]:\n  \"\"\"Compute several metrics to assess the structural violations.\"\"\"\n  ret = {}\n  between_residues = violations['between_residues']\n  within_residues = violations['within_residues']\n  extreme_ca_ca_violations = all_atom_multimer.extreme_ca_ca_distance_violations(\n      positions=pred_positions,\n      mask=mask.astype(jnp.float32),\n      residue_index=residue_index.astype(jnp.float32))\n  ret['violations_extreme_ca_ca_distance'] = extreme_ca_ca_violations\n  ret['violations_between_residue_bond'] = utils.mask_mean(\n      mask=seq_mask,\n      value=between_residues['connections_per_residue_violation_mask'])\n  ret['violations_between_residue_clash'] = utils.mask_mean(\n      mask=seq_mask,\n      value=jnp.max(between_residues['clashes_per_atom_clash_mask'], axis=-1))\n  ret['violations_within_residue'] = utils.mask_mean(\n      mask=seq_mask,\n      value=jnp.max(within_residues['per_atom_violations'], axis=-1))\n  ret['violations_per_residue'] = utils.mask_mean(\n      mask=seq_mask, value=violations['total_per_residue_violations_mask'])\n  return ret\n\n\ndef supervised_chi_loss(\n    sequence_mask: jnp.ndarray,\n    target_chi_mask: jnp.ndarray,\n    aatype: jnp.ndarray,\n    target_chi_angles: jnp.ndarray,\n    pred_angles: jnp.ndarray,\n    unnormed_angles: jnp.ndarray,\n    config: ml_collections.ConfigDict) -> Tuple[Float, Float, Float]:\n  \"\"\"Computes loss for direct chi angle supervision.\"\"\"\n  eps = 1e-6\n  chi_mask = target_chi_mask.astype(jnp.float32)\n\n  pred_angles = pred_angles[:, :, 3:]\n\n  residue_type_one_hot = jax.nn.one_hot(\n      aatype, residue_constants.restype_num + 1, dtype=jnp.float32)[None]\n  chi_pi_periodic = jnp.einsum('ijk, kl->ijl', residue_type_one_hot,\n                               jnp.asarray(residue_constants.chi_pi_periodic))\n\n  true_chi = target_chi_angles[None]\n  sin_true_chi = jnp.sin(true_chi)\n  cos_true_chi = jnp.cos(true_chi)\n  sin_cos_true_chi = jnp.stack([sin_true_chi, cos_true_chi], axis=-1)\n\n  # This is -1 if chi is pi periodic and +1 if it's 2 pi periodic\n  shifted_mask = (1 - 2 * chi_pi_periodic)[..., None]\n  sin_cos_true_chi_shifted = shifted_mask * sin_cos_true_chi\n\n  sq_chi_error = jnp.sum(\n      squared_difference(sin_cos_true_chi, pred_angles), -1)\n  sq_chi_error_shifted = jnp.sum(\n      squared_difference(sin_cos_true_chi_shifted, pred_angles), -1)\n  sq_chi_error = jnp.minimum(sq_chi_error, sq_chi_error_shifted)\n\n  sq_chi_loss = utils.mask_mean(mask=chi_mask[None], value=sq_chi_error)\n  angle_norm = jnp.sqrt(jnp.sum(jnp.square(unnormed_angles), axis=-1) + eps)\n  norm_error = jnp.abs(angle_norm - 1.)\n  angle_norm_loss = utils.mask_mean(mask=sequence_mask[None, :, None],\n                                    value=norm_error)\n  loss = (config.chi_weight * sq_chi_loss\n          + config.angle_norm_weight * angle_norm_loss)\n  return loss, sq_chi_loss, angle_norm_loss\n\n\ndef l2_normalize(x: jnp.ndarray,\n                 axis: int = -1,\n                 epsilon: float = 1e-12\n                 ) -> jnp.ndarray:\n  return x / jnp.sqrt(\n      jnp.maximum(jnp.sum(x**2, axis=axis, keepdims=True), epsilon))\n\n\ndef get_renamed_chi_angles(aatype: jnp.ndarray,\n                           chi_angles: jnp.ndarray,\n                           alt_is_better: jnp.ndarray\n                           ) -> jnp.ndarray:\n  \"\"\"Return renamed chi angles.\"\"\"\n  chi_angle_is_ambiguous = utils.batched_gather(\n      jnp.array(residue_constants.chi_pi_periodic, dtype=jnp.float32), aatype)\n  alt_chi_angles = chi_angles + np.pi * chi_angle_is_ambiguous\n  # Map back to [-pi, pi].\n  alt_chi_angles = alt_chi_angles - 2 * np.pi * (alt_chi_angles > np.pi).astype(\n      jnp.float32)\n  alt_is_better = alt_is_better[:, None]\n  return (1. - alt_is_better) * chi_angles + alt_is_better * alt_chi_angles\n\n\nclass MultiRigidSidechain(hk.Module):\n  \"\"\"Class to make side chain atoms.\"\"\"\n\n  def __init__(self,\n               config: ml_collections.ConfigDict,\n               global_config: ml_collections.ConfigDict,\n               name: str = 'rigid_sidechain'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               rigid: geometry.Rigid3Array,\n               representations_list: Iterable[jnp.ndarray],\n               aatype: jnp.ndarray\n               ) -> Dict[str, Any]:\n    \"\"\"Predict sidechains using multi-rigid representations.\n\n    Args:\n      rigid: The Rigid's for each residue (translations in angstoms)\n      representations_list: A list of activations to predict sidechains from.\n      aatype: amino acid types.\n\n    Returns:\n      dict containing atom positions and frames (in angstrom)\n    \"\"\"\n    act = [\n        common_modules.Linear(  # pylint: disable=g-complex-comprehension\n            self.config.num_channel,\n            name='input_projection')(jax.nn.relu(x))\n        for x in representations_list]\n    # Sum the activation list (equivalent to concat then Conv1D)\n    act = sum(act)\n\n    final_init = 'zeros' if self.global_config.zero_init else 'linear'\n\n    # Mapping with some residual blocks.\n    for _ in range(self.config.num_residual_block):\n      old_act = act\n      act = common_modules.Linear(\n          self.config.num_channel,\n          initializer='relu',\n          name='resblock1')(\n              jax.nn.relu(act))\n      act = common_modules.Linear(\n          self.config.num_channel,\n          initializer=final_init,\n          name='resblock2')(\n              jax.nn.relu(act))\n      act += old_act\n\n    # Map activations to torsion angles.\n    # [batch_size, num_res, 14]\n    num_res = act.shape[0]\n    unnormalized_angles = common_modules.Linear(\n        14, name='unnormalized_angles')(\n            jax.nn.relu(act))\n    unnormalized_angles = jnp.reshape(\n        unnormalized_angles, [num_res, 7, 2])\n    angles = l2_normalize(unnormalized_angles, axis=-1)\n\n    outputs = {\n        'angles_sin_cos': angles,  # jnp.ndarray (N, 7, 2)\n        'unnormalized_angles_sin_cos':\n            unnormalized_angles,  # jnp.ndarray (N, 7, 2)\n    }\n\n    # Map torsion angles to frames.\n    # geometry.Rigid3Array with shape (N, 8)\n    all_frames_to_global = all_atom_multimer.torsion_angles_to_frames(\n        aatype,\n        rigid,\n        angles)\n\n    # Use frames and literature positions to create the final atom coordinates.\n    # geometry.Vec3Array with shape (N, 14)\n    pred_positions = all_atom_multimer.frames_and_literature_positions_to_atom14_pos(\n        aatype, all_frames_to_global)\n\n    outputs.update({\n        'atom_pos': pred_positions,  # geometry.Vec3Array (N, 14)\n        'frames': all_frames_to_global,  # geometry.Rigid3Array (N, 8)\n    })\n    return outputs\n"
  },
  {
    "path": "alphafold/model/geometry/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Geometry Module.\"\"\"\n\nfrom alphafold.model.geometry import rigid_matrix_vector\nfrom alphafold.model.geometry import rotation_matrix\nfrom alphafold.model.geometry import struct_of_array\nfrom alphafold.model.geometry import vector\n\nRot3Array = rotation_matrix.Rot3Array\nRigid3Array = rigid_matrix_vector.Rigid3Array\n\nStructOfArray = struct_of_array.StructOfArray\n\nVec3Array = vector.Vec3Array\nsquare_euclidean_distance = vector.square_euclidean_distance\neuclidean_distance = vector.euclidean_distance\ndihedral_angle = vector.dihedral_angle\ndot = vector.dot\ncross = vector.cross\n"
  },
  {
    "path": "alphafold/model/geometry/rigid_matrix_vector.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Rigid3Array Transformations represented by a Matrix and a Vector.\"\"\"\n\nfrom __future__ import annotations\nfrom typing import Union\n\nfrom alphafold.model.geometry import rotation_matrix\nfrom alphafold.model.geometry import struct_of_array\nfrom alphafold.model.geometry import vector\nimport jax\nimport jax.numpy as jnp\n\nFloat = Union[float, jnp.ndarray]\n\nVERSION = '0.1'\n\n\n@struct_of_array.StructOfArray(same_dtype=True)\nclass Rigid3Array:\n  \"\"\"Rigid Transformation, i.e. element of special euclidean group.\"\"\"\n\n  rotation: rotation_matrix.Rot3Array\n  translation: vector.Vec3Array\n\n  def __matmul__(self, other: Rigid3Array) -> Rigid3Array:\n    new_rotation = self.rotation @ other.rotation\n    new_translation = self.apply_to_point(other.translation)\n    return Rigid3Array(new_rotation, new_translation)\n\n  def inverse(self) -> Rigid3Array:\n    \"\"\"Return Rigid3Array corresponding to inverse transform.\"\"\"\n    inv_rotation = self.rotation.inverse()\n    inv_translation = inv_rotation.apply_to_point(-self.translation)\n    return Rigid3Array(inv_rotation, inv_translation)\n\n  def apply_to_point(self, point: vector.Vec3Array) -> vector.Vec3Array:\n    \"\"\"Apply Rigid3Array transform to point.\"\"\"\n    return self.rotation.apply_to_point(point) + self.translation\n\n  def apply_inverse_to_point(self, point: vector.Vec3Array) -> vector.Vec3Array:\n    \"\"\"Apply inverse Rigid3Array transform to point.\"\"\"\n    new_point = point - self.translation\n    return self.rotation.apply_inverse_to_point(new_point)\n\n  def compose_rotation(self, other_rotation):\n    rot = self.rotation @ other_rotation\n    trans = jax.tree_map(lambda x: jnp.broadcast_to(x, rot.shape),\n                         self.translation)\n    return Rigid3Array(rot, trans)\n\n  @classmethod\n  def identity(cls, shape, dtype=jnp.float32) -> Rigid3Array:\n    \"\"\"Return identity Rigid3Array of given shape.\"\"\"\n    return cls(\n        rotation_matrix.Rot3Array.identity(shape, dtype=dtype),\n        vector.Vec3Array.zeros(shape, dtype=dtype))  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  def scale_translation(self, factor: Float) -> Rigid3Array:\n    \"\"\"Scale translation in Rigid3Array by 'factor'.\"\"\"\n    return Rigid3Array(self.rotation, self.translation * factor)\n\n  def to_array(self):\n    rot_array = self.rotation.to_array()\n    vec_array = self.translation.to_array()\n    return jnp.concatenate([rot_array, vec_array[..., None]], axis=-1)\n\n  @classmethod\n  def from_array(cls, array):\n    rot = rotation_matrix.Rot3Array.from_array(array[..., :3])\n    vec = vector.Vec3Array.from_array(array[..., -1])\n    return cls(rot, vec)  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  @classmethod\n  def from_array4x4(cls, array: jnp.ndarray) -> Rigid3Array:\n    \"\"\"Construct Rigid3Array from homogeneous 4x4 array.\"\"\"\n    assert array.shape[-1] == 4\n    assert array.shape[-2] == 4\n    rotation = rotation_matrix.Rot3Array(\n        array[..., 0, 0], array[..., 0, 1], array[..., 0, 2],\n        array[..., 1, 0], array[..., 1, 1], array[..., 1, 2],\n        array[..., 2, 0], array[..., 2, 1], array[..., 2, 2]\n        )\n    translation = vector.Vec3Array(\n        array[..., 0, 3], array[..., 1, 3], array[..., 2, 3])\n    return cls(rotation, translation)  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  def __getstate__(self):\n    return (VERSION, (self.rotation, self.translation))\n\n  def __setstate__(self, state):\n    version, (rot, trans) = state\n    del version\n    object.__setattr__(self, 'rotation', rot)\n    object.__setattr__(self, 'translation', trans)\n"
  },
  {
    "path": "alphafold/model/geometry/rotation_matrix.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Rot3Array Matrix Class.\"\"\"\n\nfrom __future__ import annotations\nimport dataclasses\n\nfrom alphafold.model.geometry import struct_of_array\nfrom alphafold.model.geometry import utils\nfrom alphafold.model.geometry import vector\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\nCOMPONENTS = ['xx', 'xy', 'xz', 'yx', 'yy', 'yz', 'zx', 'zy', 'zz']\n\nVERSION = '0.1'\n\n\n@struct_of_array.StructOfArray(same_dtype=True)\nclass Rot3Array:\n  \"\"\"Rot3Array Matrix in 3 dimensional Space implemented as struct of arrays.\"\"\"\n\n  xx: jnp.ndarray = dataclasses.field(metadata={'dtype': jnp.float32})\n  xy: jnp.ndarray\n  xz: jnp.ndarray\n  yx: jnp.ndarray\n  yy: jnp.ndarray\n  yz: jnp.ndarray\n  zx: jnp.ndarray\n  zy: jnp.ndarray\n  zz: jnp.ndarray\n\n  __array_ufunc__ = None\n\n  def inverse(self) -> Rot3Array:\n    \"\"\"Returns inverse of Rot3Array.\"\"\"\n    return Rot3Array(self.xx, self.yx, self.zx,\n                     self.xy, self.yy, self.zy,\n                     self.xz, self.yz, self.zz)\n\n  def apply_to_point(self, point: vector.Vec3Array) -> vector.Vec3Array:\n    \"\"\"Applies Rot3Array to point.\"\"\"\n    return vector.Vec3Array(\n        self.xx * point.x + self.xy * point.y + self.xz * point.z,\n        self.yx * point.x + self.yy * point.y + self.yz * point.z,\n        self.zx * point.x + self.zy * point.y + self.zz * point.z)\n\n  def apply_inverse_to_point(self, point: vector.Vec3Array) -> vector.Vec3Array:\n    \"\"\"Applies inverse Rot3Array to point.\"\"\"\n    return self.inverse().apply_to_point(point)\n\n  def __matmul__(self, other: Rot3Array) -> Rot3Array:\n    \"\"\"Composes two Rot3Arrays.\"\"\"\n    c0 = self.apply_to_point(vector.Vec3Array(other.xx, other.yx, other.zx))\n    c1 = self.apply_to_point(vector.Vec3Array(other.xy, other.yy, other.zy))\n    c2 = self.apply_to_point(vector.Vec3Array(other.xz, other.yz, other.zz))\n    return Rot3Array(c0.x, c1.x, c2.x, c0.y, c1.y, c2.y, c0.z, c1.z, c2.z)\n\n  @classmethod\n  def identity(cls, shape, dtype=jnp.float32) -> Rot3Array:\n    \"\"\"Returns identity of given shape.\"\"\"\n    ones = jnp.ones(shape, dtype=dtype)\n    zeros = jnp.zeros(shape, dtype=dtype)\n    return cls(ones, zeros, zeros, zeros, ones, zeros, zeros, zeros, ones)  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  @classmethod\n  def from_two_vectors(cls, e0: vector.Vec3Array,\n                       e1: vector.Vec3Array) -> Rot3Array:\n    \"\"\"Construct Rot3Array from two Vectors.\n\n    Rot3Array is constructed such that in the corresponding frame 'e0' lies on\n    the positive x-Axis and 'e1' lies in the xy plane with positive sign of y.\n\n    Args:\n      e0: Vector\n      e1: Vector\n    Returns:\n      Rot3Array\n    \"\"\"\n    # Normalize the unit vector for the x-axis, e0.\n    e0 = e0.normalized()\n    # make e1 perpendicular to e0.\n    c = e1.dot(e0)\n    e1 = (e1 - c * e0).normalized()\n    # Compute e2 as cross product of e0 and e1.\n    e2 = e0.cross(e1)\n    return cls(e0.x, e1.x, e2.x, e0.y, e1.y, e2.y, e0.z, e1.z, e2.z)  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  @classmethod\n  def from_array(cls, array: jnp.ndarray) -> Rot3Array:\n    \"\"\"Construct Rot3Array Matrix from array of shape. [..., 3, 3].\"\"\"\n    unstacked = utils.unstack(array, axis=-2)\n    unstacked = sum([utils.unstack(x, axis=-1) for x in unstacked], [])\n    return cls(*unstacked)\n\n  def to_array(self) -> jnp.ndarray:\n    \"\"\"Convert Rot3Array to array of shape [..., 3, 3].\"\"\"\n    return jnp.stack(\n        [jnp.stack([self.xx, self.xy, self.xz], axis=-1),\n         jnp.stack([self.yx, self.yy, self.yz], axis=-1),\n         jnp.stack([self.zx, self.zy, self.zz], axis=-1)],\n        axis=-2)\n\n  @classmethod\n  def from_quaternion(cls,\n                      w: jnp.ndarray,\n                      x: jnp.ndarray,\n                      y: jnp.ndarray,\n                      z: jnp.ndarray,\n                      normalize: bool = True,\n                      epsilon: float = 1e-6) -> Rot3Array:\n    \"\"\"Construct Rot3Array from components of quaternion.\"\"\"\n    if normalize:\n      inv_norm = jax.lax.rsqrt(jnp.maximum(epsilon, w**2 + x**2 + y**2 + z**2))\n      w *= inv_norm\n      x *= inv_norm\n      y *= inv_norm\n      z *= inv_norm\n    xx = 1 - 2 * (jnp.square(y) + jnp.square(z))\n    xy = 2 * (x * y - w * z)\n    xz = 2 * (x * z + w * y)\n    yx = 2 * (x * y + w * z)\n    yy = 1 - 2 * (jnp.square(x) + jnp.square(z))\n    yz = 2 * (y * z - w * x)\n    zx = 2 * (x * z - w * y)\n    zy = 2 * (y * z + w * x)\n    zz = 1 - 2 * (jnp.square(x) + jnp.square(y))\n    return cls(xx, xy, xz, yx, yy, yz, zx, zy, zz)  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  @classmethod\n  def random_uniform(cls, key, shape, dtype=jnp.float32) -> Rot3Array:\n    \"\"\"Samples uniform random Rot3Array according to Haar Measure.\"\"\"\n    quat_array = jax.random.normal(key, tuple(shape) + (4,), dtype=dtype)\n    quats = utils.unstack(quat_array)\n    return cls.from_quaternion(*quats)\n\n  def __getstate__(self):\n    return (VERSION,\n            [np.asarray(getattr(self, field)) for field in COMPONENTS])\n\n  def __setstate__(self, state):\n    version, state = state\n    del version\n    for i, field in enumerate(COMPONENTS):\n      object.__setattr__(self, field, state[i])\n"
  },
  {
    "path": "alphafold/model/geometry/struct_of_array.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Class decorator to represent (nested) struct of arrays.\"\"\"\n\nimport dataclasses\n\nimport jax\n\n\ndef get_item(instance, key):\n  sliced = {}\n  for field in get_array_fields(instance):\n    num_trailing_dims = field.metadata.get('num_trailing_dims', 0)\n    this_key = key\n    if isinstance(key, tuple) and Ellipsis in this_key:\n      this_key += (slice(None),) * num_trailing_dims\n    sliced[field.name] = getattr(instance, field.name)[this_key]\n  return dataclasses.replace(instance, **sliced)\n\n\n@property\ndef get_shape(instance):\n  \"\"\"Returns Shape for given instance of dataclass.\"\"\"\n  first_field = dataclasses.fields(instance)[0]\n  num_trailing_dims = first_field.metadata.get('num_trailing_dims', None)\n  value = getattr(instance, first_field.name)\n  if num_trailing_dims:\n    return value.shape[:-num_trailing_dims]\n  else:\n    return value.shape\n\n\ndef get_len(instance):\n  \"\"\"Returns length for given instance of dataclass.\"\"\"\n  shape = instance.shape\n  if shape:\n    return shape[0]\n  else:\n    raise TypeError('len() of unsized object')  # Match jax.numpy behavior.\n\n\n@property\ndef get_dtype(instance):\n  \"\"\"Returns Dtype for given instance of dataclass.\"\"\"\n  fields = dataclasses.fields(instance)\n  sets_dtype = [\n      field.name for field in fields if field.metadata.get('sets_dtype', False)\n  ]\n  if sets_dtype:\n    assert len(sets_dtype) == 1, 'at most field can set dtype'\n    field_value = getattr(instance, sets_dtype[0])\n  elif instance.same_dtype:\n    field_value = getattr(instance, fields[0].name)\n  else:\n    # Should this be Value Error?\n    raise AttributeError('Trying to access Dtype on Struct of Array without'\n                         'either \"same_dtype\" or field setting dtype')\n\n  if hasattr(field_value, 'dtype'):\n    return field_value.dtype\n  else:\n    # Should this be Value Error?\n    raise AttributeError(f'field_value {field_value} does not have dtype')\n\n\ndef replace(instance, **kwargs):\n  return dataclasses.replace(instance, **kwargs)\n\n\ndef post_init(instance):\n  \"\"\"Validate instance has same shapes & dtypes.\"\"\"\n  array_fields = get_array_fields(instance)\n  arrays = list(get_array_fields(instance, return_values=True).values())\n  first_field = array_fields[0]\n  # These slightly weird constructions about checking whether the leaves are\n  # actual arrays is since e.g. vmap internally relies on being able to\n  # construct pytree's with object() as leaves, this would break the checking\n  # as such we are only validating the object when the entries in the dataclass\n  # Are arrays or other dataclasses of arrays.\n  try:\n    dtype = instance.dtype\n  except AttributeError:\n    dtype = None\n  if dtype is not None:\n    first_shape = instance.shape\n    for array, field in zip(arrays, array_fields):\n      field_shape = array.shape\n      num_trailing_dims = field.metadata.get('num_trailing_dims', None)\n      if num_trailing_dims:\n        array_shape = array.shape\n        field_shape = array_shape[:-num_trailing_dims]\n        msg = (f'field {field} should have number of trailing dims'\n               ' {num_trailing_dims}')\n        assert len(array_shape) == len(first_shape) + num_trailing_dims, msg\n      else:\n        field_shape = array.shape\n\n      shape_msg = (f\"Stripped Shape {field_shape} of field {field} doesn't \"\n                   f\"match shape {first_shape} of field {first_field}\")\n      assert field_shape == first_shape, shape_msg\n\n      field_dtype = array.dtype\n\n      allowed_metadata_dtypes = field.metadata.get('allowed_dtypes', [])\n      if allowed_metadata_dtypes:\n        msg = f'Dtype is {field_dtype} but must be in {allowed_metadata_dtypes}'\n        assert field_dtype in allowed_metadata_dtypes, msg\n\n      if 'dtype' in field.metadata:\n        target_dtype = field.metadata['dtype']\n      else:\n        target_dtype = dtype\n\n      msg = f'Dtype is {field_dtype} but must be {target_dtype}'\n      assert field_dtype == target_dtype, msg\n\n\ndef flatten(instance):\n  \"\"\"Flatten Struct of Array instance.\"\"\"\n  array_likes = list(get_array_fields(instance, return_values=True).values())\n  flat_array_likes = []\n  inner_treedefs = []\n  num_arrays = []\n  for array_like in array_likes:\n    flat_array_like, inner_treedef = jax.tree_util.tree_flatten(array_like)\n    inner_treedefs.append(inner_treedef)\n    flat_array_likes += flat_array_like\n    num_arrays.append(len(flat_array_like))\n  metadata = get_metadata_fields(instance, return_values=True)\n  metadata = type(instance).metadata_cls(**metadata)\n  return flat_array_likes, (inner_treedefs, metadata, num_arrays)\n\n\ndef make_metadata_class(cls):\n  metadata_fields = get_fields(cls,\n                               lambda x: x.metadata.get('is_metadata', False))\n  metadata_cls = dataclasses.make_dataclass(\n      cls_name='Meta' + cls.__name__,\n      fields=[(field.name, field.type, field) for field in metadata_fields],\n      frozen=True,\n      eq=True)\n  return metadata_cls\n\n\ndef get_fields(cls_or_instance, filterfn, return_values=False):\n  fields = dataclasses.fields(cls_or_instance)\n  fields = [field for field in fields if filterfn(field)]\n  if return_values:\n    return {\n        field.name: getattr(cls_or_instance, field.name) for field in fields\n    }\n  else:\n    return fields\n\n\ndef get_array_fields(cls, return_values=False):\n  return get_fields(\n      cls,\n      lambda x: not x.metadata.get('is_metadata', False),\n      return_values=return_values)\n\n\ndef get_metadata_fields(cls, return_values=False):\n  return get_fields(\n      cls,\n      lambda x: x.metadata.get('is_metadata', False),\n      return_values=return_values)\n\n\nclass StructOfArray:\n  \"\"\"Class Decorator for Struct Of Arrays.\"\"\"\n\n  def __init__(self, same_dtype=True):\n    self.same_dtype = same_dtype\n\n  def __call__(self, cls):\n    cls.__array_ufunc__ = None\n    cls.replace = replace\n    cls.same_dtype = self.same_dtype\n    cls.dtype = get_dtype\n    cls.shape = get_shape\n    cls.__len__ = get_len\n    cls.__getitem__ = get_item\n    cls.__post_init__ = post_init\n    new_cls = dataclasses.dataclass(cls, frozen=True, eq=False)  # pytype: disable=wrong-keyword-args\n    # pytree claims to require metadata to be hashable, not sure why,\n    # But making derived dataclass that can just hold metadata\n    new_cls.metadata_cls = make_metadata_class(new_cls)\n\n    def unflatten(aux, data):\n      inner_treedefs, metadata, num_arrays = aux\n      array_fields = [field.name for field in get_array_fields(new_cls)]\n      value_dict = {}\n      array_start = 0\n      for num_array, inner_treedef, array_field in zip(num_arrays,\n                                                       inner_treedefs,\n                                                       array_fields):\n        value_dict[array_field] = jax.tree_util.tree_unflatten(\n            inner_treedef, data[array_start:array_start + num_array])\n        array_start += num_array\n      metadata_fields = get_metadata_fields(new_cls)\n      for field in metadata_fields:\n        value_dict[field.name] = getattr(metadata, field.name)\n\n      return new_cls(**value_dict)\n\n    jax.tree_util.register_pytree_node(\n        nodetype=new_cls, flatten_func=flatten, unflatten_func=unflatten)\n    return new_cls\n"
  },
  {
    "path": "alphafold/model/geometry/test_utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Shared utils for tests.\"\"\"\n\nimport dataclasses\n\nfrom alphafold.model.geometry import rigid_matrix_vector\nfrom alphafold.model.geometry import rotation_matrix\nfrom alphafold.model.geometry import vector\nimport jax.numpy as jnp\nimport numpy as np\n\n\ndef assert_rotation_matrix_equal(matrix1: rotation_matrix.Rot3Array,\n                                 matrix2: rotation_matrix.Rot3Array):\n  for field in dataclasses.fields(rotation_matrix.Rot3Array):\n    field = field.name\n    np.testing.assert_array_equal(\n        getattr(matrix1, field), getattr(matrix2, field))\n\n\ndef assert_rotation_matrix_close(mat1: rotation_matrix.Rot3Array,\n                                 mat2: rotation_matrix.Rot3Array):\n  np.testing.assert_array_almost_equal(mat1.to_array(), mat2.to_array(), 6)\n\n\ndef assert_array_equal_to_rotation_matrix(array: jnp.ndarray,\n                                          matrix: rotation_matrix.Rot3Array):\n  \"\"\"Check that array and Matrix match.\"\"\"\n  np.testing.assert_array_equal(matrix.xx, array[..., 0, 0])\n  np.testing.assert_array_equal(matrix.xy, array[..., 0, 1])\n  np.testing.assert_array_equal(matrix.xz, array[..., 0, 2])\n  np.testing.assert_array_equal(matrix.yx, array[..., 1, 0])\n  np.testing.assert_array_equal(matrix.yy, array[..., 1, 1])\n  np.testing.assert_array_equal(matrix.yz, array[..., 1, 2])\n  np.testing.assert_array_equal(matrix.zx, array[..., 2, 0])\n  np.testing.assert_array_equal(matrix.zy, array[..., 2, 1])\n  np.testing.assert_array_equal(matrix.zz, array[..., 2, 2])\n\n\ndef assert_array_close_to_rotation_matrix(array: jnp.ndarray,\n                                          matrix: rotation_matrix.Rot3Array):\n  np.testing.assert_array_almost_equal(matrix.to_array(), array, 6)\n\n\ndef assert_vectors_equal(vec1: vector.Vec3Array, vec2: vector.Vec3Array):\n  np.testing.assert_array_equal(vec1.x, vec2.x)\n  np.testing.assert_array_equal(vec1.y, vec2.y)\n  np.testing.assert_array_equal(vec1.z, vec2.z)\n\n\ndef assert_vectors_close(vec1: vector.Vec3Array, vec2: vector.Vec3Array):\n  np.testing.assert_allclose(vec1.x, vec2.x, atol=1e-6, rtol=0.)\n  np.testing.assert_allclose(vec1.y, vec2.y, atol=1e-6, rtol=0.)\n  np.testing.assert_allclose(vec1.z, vec2.z, atol=1e-6, rtol=0.)\n\n\ndef assert_array_close_to_vector(array: jnp.ndarray, vec: vector.Vec3Array):\n  np.testing.assert_allclose(vec.to_array(), array, atol=1e-6, rtol=0.)\n\n\ndef assert_array_equal_to_vector(array: jnp.ndarray, vec: vector.Vec3Array):\n  np.testing.assert_array_equal(vec.to_array(), array)\n\n\ndef assert_rigid_equal_to_rigid(rigid1: rigid_matrix_vector.Rigid3Array,\n                                rigid2: rigid_matrix_vector.Rigid3Array):\n  assert_rot_trans_equal_to_rigid(rigid1.rotation, rigid1.translation, rigid2)\n\n\ndef assert_rigid_close_to_rigid(rigid1: rigid_matrix_vector.Rigid3Array,\n                                rigid2: rigid_matrix_vector.Rigid3Array):\n  assert_rot_trans_close_to_rigid(rigid1.rotation, rigid1.translation, rigid2)\n\n\ndef assert_rot_trans_equal_to_rigid(rot: rotation_matrix.Rot3Array,\n                                    trans: vector.Vec3Array,\n                                    rigid: rigid_matrix_vector.Rigid3Array):\n  assert_rotation_matrix_equal(rot, rigid.rotation)\n  assert_vectors_equal(trans, rigid.translation)\n\n\ndef assert_rot_trans_close_to_rigid(rot: rotation_matrix.Rot3Array,\n                                    trans: vector.Vec3Array,\n                                    rigid: rigid_matrix_vector.Rigid3Array):\n  assert_rotation_matrix_close(rot, rigid.rotation)\n  assert_vectors_close(trans, rigid.translation)\n"
  },
  {
    "path": "alphafold/model/geometry/utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Utils for geometry library.\"\"\"\n\nfrom typing import List\n\nimport jax.numpy as jnp\n\n\ndef unstack(value: jnp.ndarray, axis: int = -1) -> List[jnp.ndarray]:\n  return [jnp.squeeze(v, axis=axis)\n          for v in jnp.split(value, value.shape[axis], axis=axis)]\n"
  },
  {
    "path": "alphafold/model/geometry/vector.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Vec3Array Class.\"\"\"\n\nfrom __future__ import annotations\nimport dataclasses\nfrom typing import Union\n\nfrom alphafold.model.geometry import struct_of_array\nfrom alphafold.model.geometry import utils\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\nFloat = Union[float, jnp.ndarray]\n\nVERSION = '0.1'\n\n\n@struct_of_array.StructOfArray(same_dtype=True)\nclass Vec3Array:\n  \"\"\"Vec3Array in 3 dimensional Space implemented as struct of arrays.\n\n  This is done in order to improve performance and precision.\n  On TPU small matrix multiplications are very suboptimal and will waste large\n  compute ressources, furthermore any matrix multiplication on tpu happen in\n  mixed bfloat16/float32 precision, which is often undesirable when handling\n  physical coordinates.\n  In most cases this will also be faster on cpu's/gpu's since it allows for\n  easier use of vector instructions.\n  \"\"\"\n\n  x: jnp.ndarray = dataclasses.field(metadata={'dtype': jnp.float32})\n  y: jnp.ndarray\n  z: jnp.ndarray\n\n  def __post_init__(self):\n    if hasattr(self.x, 'dtype'):\n      assert self.x.dtype == self.y.dtype\n      assert self.x.dtype == self.z.dtype\n      assert all([x == y for x, y in zip(self.x.shape, self.y.shape)])\n      assert all([x == z for x, z in zip(self.x.shape, self.z.shape)])\n\n  def __add__(self, other: Vec3Array) -> Vec3Array:\n    return jax.tree_map(lambda x, y: x + y, self, other)\n\n  def __sub__(self, other: Vec3Array) -> Vec3Array:\n    return jax.tree_map(lambda x, y: x - y, self, other)\n\n  def __mul__(self, other: Float) -> Vec3Array:\n    return jax.tree_map(lambda x: x * other, self)\n\n  def __rmul__(self, other: Float) -> Vec3Array:\n    return self * other\n\n  def __truediv__(self, other: Float) -> Vec3Array:\n    return jax.tree_map(lambda x: x / other, self)\n\n  def __neg__(self) -> Vec3Array:\n    return jax.tree_map(lambda x: -x, self)\n\n  def __pos__(self) -> Vec3Array:\n    return jax.tree_map(lambda x: x, self)\n\n  def cross(self, other: Vec3Array) -> Vec3Array:\n    \"\"\"Compute cross product between 'self' and 'other'.\"\"\"\n    new_x = self.y * other.z - self.z * other.y\n    new_y = self.z * other.x - self.x * other.z\n    new_z = self.x * other.y - self.y * other.x\n    return Vec3Array(new_x, new_y, new_z)\n\n  def dot(self, other: Vec3Array) -> Float:\n    \"\"\"Compute dot product between 'self' and 'other'.\"\"\"\n    return self.x * other.x + self.y * other.y + self.z * other.z\n\n  def norm(self, epsilon: float = 1e-6) -> Float:\n    \"\"\"Compute Norm of Vec3Array, clipped to epsilon.\"\"\"\n    # To avoid NaN on the backward pass, we must use maximum before the sqrt\n    norm2 = self.dot(self)\n    if epsilon:\n      norm2 = jnp.maximum(norm2, epsilon**2)\n    return jnp.sqrt(norm2)\n\n  def norm2(self):\n    return self.dot(self)\n\n  def normalized(self, epsilon: float = 1e-6) -> Vec3Array:\n    \"\"\"Return unit vector with optional clipping.\"\"\"\n    return self / self.norm(epsilon)\n\n  @classmethod\n  def zeros(cls, shape, dtype=jnp.float32):\n    \"\"\"Return Vec3Array corresponding to zeros of given shape.\"\"\"\n    return cls(\n        jnp.zeros(shape, dtype), jnp.zeros(shape, dtype),\n        jnp.zeros(shape, dtype))  # pytype: disable=wrong-arg-count  # trace-all-classes\n\n  def to_array(self) -> jnp.ndarray:\n    return jnp.stack([self.x, self.y, self.z], axis=-1)\n\n  @classmethod\n  def from_array(cls, array):\n    return cls(*utils.unstack(array))\n\n  def __getstate__(self):\n    return (VERSION,\n            [np.asarray(self.x),\n             np.asarray(self.y),\n             np.asarray(self.z)])\n\n  def __setstate__(self, state):\n    version, state = state\n    del version\n    for i, letter in enumerate('xyz'):\n      object.__setattr__(self, letter, state[i])\n\n\ndef square_euclidean_distance(vec1: Vec3Array,\n                              vec2: Vec3Array,\n                              epsilon: float = 1e-6) -> Float:\n  \"\"\"Computes square of euclidean distance between 'vec1' and 'vec2'.\n\n  Args:\n    vec1: Vec3Array to compute  distance to\n    vec2: Vec3Array to compute  distance from, should be\n          broadcast compatible with 'vec1'\n    epsilon: distance is clipped from below to be at least epsilon\n\n  Returns:\n    Array of square euclidean distances;\n    shape will be result of broadcasting 'vec1' and 'vec2'\n  \"\"\"\n  difference = vec1 - vec2\n  distance = difference.dot(difference)\n  if epsilon:\n    distance = jnp.maximum(distance, epsilon)\n  return distance\n\n\ndef dot(vector1: Vec3Array, vector2: Vec3Array) -> Float:\n  return vector1.dot(vector2)\n\n\ndef cross(vector1: Vec3Array, vector2: Vec3Array) -> Float:\n  return vector1.cross(vector2)\n\n\ndef norm(vector: Vec3Array, epsilon: float = 1e-6) -> Float:\n  return vector.norm(epsilon)\n\n\ndef normalized(vector: Vec3Array, epsilon: float = 1e-6) -> Vec3Array:\n  return vector.normalized(epsilon)\n\n\ndef euclidean_distance(vec1: Vec3Array,\n                       vec2: Vec3Array,\n                       epsilon: float = 1e-6) -> Float:\n  \"\"\"Computes euclidean distance between 'vec1' and 'vec2'.\n\n  Args:\n    vec1: Vec3Array to compute euclidean distance to\n    vec2: Vec3Array to compute euclidean distance from, should be\n          broadcast compatible with 'vec1'\n    epsilon: distance is clipped from below to be at least epsilon\n\n  Returns:\n    Array of euclidean distances;\n    shape will be result of broadcasting 'vec1' and 'vec2'\n  \"\"\"\n  distance_sq = square_euclidean_distance(vec1, vec2, epsilon**2)\n  distance = jnp.sqrt(distance_sq)\n  return distance\n\n\ndef dihedral_angle(a: Vec3Array, b: Vec3Array, c: Vec3Array,\n                   d: Vec3Array) -> Float:\n  \"\"\"Computes torsion angle for a quadruple of points.\n\n  For points (a, b, c, d), this is the angle between the planes defined by\n  points (a, b, c) and (b, c, d). It is also known as the dihedral angle.\n\n  Arguments:\n    a: A Vec3Array of coordinates.\n    b: A Vec3Array of coordinates.\n    c: A Vec3Array of coordinates.\n    d: A Vec3Array of coordinates.\n\n  Returns:\n    A tensor of angles in radians: [-pi, pi].\n  \"\"\"\n  v1 = a - b\n  v2 = b - c\n  v3 = d - c\n\n  c1 = v1.cross(v2)\n  c2 = v3.cross(v2)\n  c3 = c2.cross(c1)\n\n  v2_mag = v2.norm()\n  return jnp.arctan2(c3.dot(v2), v2_mag * c1.dot(c2))\n\n\ndef random_gaussian_vector(shape, key, dtype=jnp.float32):\n  vec_array = jax.random.normal(key, shape + (3,), dtype)\n  return Vec3Array.from_array(vec_array)\n"
  },
  {
    "path": "alphafold/model/layer_stack.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Function to stack repeats of a layer function without shared parameters.\"\"\"\n\nimport collections\nimport contextlib\nimport functools\nimport inspect\nfrom typing import Any, Callable, Optional, Tuple, Union\n\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\n\nLayerStackCarry = collections.namedtuple('LayerStackCarry', ['x', 'rng'])\nLayerStackScanned = collections.namedtuple('LayerStackScanned',\n                                           ['i', 'args_ys'])\n\n# WrappedFn should take in arbitrarily nested `jnp.ndarray`, and return the\n# exact same type. We cannot express this with `typing`. So we just use it\n# to inform the user. In reality, the typing below will accept anything.\nNestedArray = Any\nWrappedFn = Callable[..., Union[NestedArray, Tuple[NestedArray]]]\n\n\ndef _check_no_varargs(f):\n  if list(inspect.signature(\n      f).parameters.values())[0].kind == inspect.Parameter.VAR_POSITIONAL:\n    raise ValueError(\n        'The function `f` should not have any `varargs` (that is *args) '\n        'argument. Instead, it should only use explicit positional'\n        'arguments.')\n\n\n@contextlib.contextmanager\ndef nullcontext():\n  yield\n\n\ndef maybe_with_rng(key):\n  if key is not None:\n    return hk.with_rng(key)\n  else:\n    return nullcontext()\n\n\ndef maybe_fold_in(key, data):\n  if key is not None:\n    return jax.random.fold_in(key, data)\n  else:\n    return None\n\n\nclass _LayerStack(hk.Module):\n  \"\"\"Module to compose parameterized functions, implemented as a scan.\"\"\"\n\n  def __init__(self,\n               count: int,\n               unroll: int,\n               name: Optional[str] = None):\n    \"\"\"Iterate a function `f` `count` times, with non-shared parameters.\"\"\"\n    super().__init__(name=name)\n    self._count = count\n    self._unroll = unroll\n\n  def __call__(self, x, *args_ys):\n    count = self._count\n    if hk.running_init():\n      # At initialization time, we run just one layer but add an extra first\n      # dimension to every initialized tensor, making sure to use different\n      # random keys for different slices.\n      def creator(next_creator, shape, dtype, init, context):\n        del context\n\n        def multi_init(shape, dtype):\n          assert shape[0] == count\n          key = hk.maybe_next_rng_key()\n\n          def rng_context_init(slice_idx):\n            slice_key = maybe_fold_in(key, slice_idx)\n            with maybe_with_rng(slice_key):\n              return init(shape[1:], dtype)\n\n          return jax.vmap(rng_context_init)(jnp.arange(count))\n\n        return next_creator((count,) + tuple(shape), dtype, multi_init)\n\n      def getter(next_getter, value, context):\n        trailing_dims = len(context.original_shape) + 1\n        sliced_value = jax.lax.index_in_dim(\n            value, index=0, axis=value.ndim - trailing_dims, keepdims=False)\n        return next_getter(sliced_value)\n\n      with hk.experimental.custom_creator(\n          creator), hk.experimental.custom_getter(getter):\n        if len(args_ys) == 1 and args_ys[0] is None:\n          args0 = (None,)\n        else:\n          args0 = [\n              jax.lax.dynamic_index_in_dim(ys, 0, keepdims=False)\n              for ys in args_ys\n          ]\n        x, z = self._call_wrapped(x, *args0)\n        if z is None:\n          return x, z\n\n        # Broadcast state to hold each layer state.\n        def broadcast_state(layer_state):\n          return jnp.broadcast_to(\n              layer_state, [count,] + list(layer_state.shape))\n        zs = jax.tree_util.tree_map(broadcast_state, z)\n        return x, zs\n    else:\n      # Use scan during apply, threading through random seed so that it's\n      # unique for each layer.\n      def layer(carry: LayerStackCarry, scanned: LayerStackScanned):\n        rng = carry.rng\n\n        def getter(next_getter, value, context):\n          # Getter slices the full param at the current loop index.\n          trailing_dims = len(context.original_shape) + 1\n          assert value.shape[value.ndim - trailing_dims] == count, (\n              f'Attempting to use a parameter stack of size '\n              f'{value.shape[value.ndim - trailing_dims]} for a LayerStack of '\n              f'size {count}.')\n\n          sliced_value = jax.lax.dynamic_index_in_dim(\n              value, scanned.i, axis=value.ndim - trailing_dims, keepdims=False)\n          return next_getter(sliced_value)\n\n        with hk.experimental.custom_getter(getter):\n          if rng is None:\n            out_x, z = self._call_wrapped(carry.x, *scanned.args_ys)\n          else:\n            rng, rng_ = jax.random.split(rng)\n            with hk.with_rng(rng_):\n              out_x, z = self._call_wrapped(carry.x, *scanned.args_ys)\n        return LayerStackCarry(x=out_x, rng=rng), z\n\n      carry = LayerStackCarry(x=x, rng=hk.maybe_next_rng_key())\n      scanned = LayerStackScanned(i=jnp.arange(count, dtype=jnp.int32),\n                                  args_ys=args_ys)\n\n      carry, zs = hk.scan(\n          layer, carry, scanned, length=count, unroll=self._unroll)\n      return carry.x, zs\n\n  def _call_wrapped(self,\n                    x: jnp.ndarray,\n                    *args,\n                    ) -> Tuple[jnp.ndarray, Optional[jnp.ndarray]]:\n    raise NotImplementedError()\n\n\nclass _LayerStackNoState(_LayerStack):\n  \"\"\"_LayerStack impl with no per-layer state provided to the function.\"\"\"\n\n  def __init__(self,\n               f: WrappedFn,\n               count: int,\n               unroll: int,\n               name: Optional[str] = None):\n    super().__init__(count=count, unroll=unroll, name=name)\n    _check_no_varargs(f)\n    self._f = f\n\n  @hk.transparent\n  def _call_wrapped(self, args, y):\n    del y\n    ret = self._f(*args)\n    if len(args) == 1:\n      # If the function takes a single argument, the wrapped function receives\n      # a tuple of length 1, and therefore it must return a tuple of length 1.\n      ret = (ret,)\n    return ret, None\n\n\nclass _LayerStackWithState(_LayerStack):\n  \"\"\"_LayerStack impl with per-layer state provided to the function.\"\"\"\n\n  def __init__(self,\n               f: WrappedFn,\n               count: int,\n               unroll: int,\n               name: Optional[str] = None):\n    super().__init__(count=count, unroll=unroll, name=name)\n    self._f = f\n\n  @hk.transparent\n  def _call_wrapped(self, x, *args):\n    return self._f(x, *args)\n\n\ndef layer_stack(num_layers: int,\n                with_state=False,\n                unroll: int = 1,\n                name: Optional[str] = None):\n  \"\"\"Utility to wrap a Haiku function and recursively apply it to an input.\n\n  A function is valid if it uses only explicit position parameters, and\n  its return type matches its input type. The position parameters can be\n  arbitrarily nested structures with `jnp.ndarray` at the leaf nodes. Note\n  that kwargs are not supported, neither are functions with variable number\n  of parameters (specified by `*args`).\n\n  If `with_state=False` then the new, wrapped function can be understood as\n  performing the following:\n  ```\n  for i in range(num_layers):\n    x = f(x)\n  return x\n  ```\n\n  And if `with_state=True`, assuming `f` takes two arguments on top of `x`:\n  ```\n  for i in range(num_layers):\n    x, zs[i] = f(x, ys_0[i], ys_1[i])\n  return x, zs\n  ```\n  The code using `layer_stack` for the above function would be:\n  ```\n  def f(x, y_0, y_1):\n    ...\n    return new_x, z\n  x, zs = layer_stack.layer_stack(num_layers,\n                                  with_state=True)(f)(x, ys_0, ys_1)\n  ```\n\n  Crucially, any parameters created inside `f` will not be shared across\n  iterations.\n\n  Args:\n    num_layers: The number of times to iterate the wrapped function.\n    with_state: Whether or not to pass per-layer state to the wrapped function.\n    unroll: the unroll used by `scan`.\n    name: Name of the Haiku context.\n\n  Returns:\n    Callable that will produce a layer stack when called with a valid function.\n  \"\"\"\n  def iterate(f):\n    if with_state:\n      @functools.wraps(f)\n      def wrapped(x, *args):\n        for ys in args:\n          assert ys.shape[0] == num_layers\n        return _LayerStackWithState(\n            f, num_layers, unroll=unroll, name=name)(x, *args)\n    else:\n      _check_no_varargs(f)\n      @functools.wraps(f)\n      def wrapped(*args):\n        ret = _LayerStackNoState(\n            f, num_layers, unroll=unroll, name=name)(args, None)[0]\n        if len(args) == 1:\n          # If the function takes a single argument, we must also return a\n          # single value, and not a tuple of length 1.\n          ret = ret[0]\n        return ret\n\n    return wrapped\n  return iterate\n"
  },
  {
    "path": "alphafold/model/layer_stack_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for layer_stack.\"\"\"\n\nimport functools\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.model import layer_stack\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\nimport scipy.stats\n\n\n# Suffixes applied by Haiku for repeated module names.\nsuffixes = [''] + [f'_{i}' for i in range(1, 100)]\n\n\ndef _slice_layers_params(layers_params):\n  sliced_layers_params = {}\n  for k, v in layers_params.items():\n    for inner_k in v:\n      for var_slice, suffix in zip(v[inner_k], suffixes):\n        k_new = k.split('/')[-1] + suffix\n        if k_new not in sliced_layers_params:\n          sliced_layers_params[k_new] = {}\n        sliced_layers_params[k_new][inner_k] = var_slice\n  return sliced_layers_params\n\n\nclass LayerStackTest(parameterized.TestCase):\n\n  @parameterized.parameters([1, 2, 4])\n  def test_layer_stack(self, unroll):\n    \"\"\"Compare layer_stack to the equivalent unrolled stack.\n\n    Tests that the layer_stack application of a Haiku layer function is\n    equivalent to repeatedly applying the layer function in an unrolled loop.\n\n    Args:\n      unroll: Number of unrolled layers.\n    \"\"\"\n    num_layers = 20\n\n    def inner_fn(x):\n      x += hk.Linear(100, name='linear1')(x)\n      x += hk.Linear(100, name='linear2')(x)\n      return x\n\n    def outer_fn_unrolled(x):\n      for _ in range(num_layers):\n        x = inner_fn(x)\n      return x\n\n    def outer_fn_layer_stack(x):\n      stack = layer_stack.layer_stack(num_layers, unroll=unroll)(inner_fn)\n      return stack(x)\n\n    unrolled_fn = hk.transform(outer_fn_unrolled)\n    layer_stack_fn = hk.transform(outer_fn_layer_stack)\n\n    x = jax.random.uniform(jax.random.PRNGKey(0), [10, 256, 100])\n\n    rng_init = jax.random.PRNGKey(42)\n\n    params = layer_stack_fn.init(rng_init, x)\n\n    sliced_params = _slice_layers_params(params)\n\n    unrolled_pred = unrolled_fn.apply(sliced_params, None, x)\n    layer_stack_pred = layer_stack_fn.apply(params, None, x)\n\n    np.testing.assert_allclose(unrolled_pred, layer_stack_pred)\n\n  def test_layer_stack_multi_args(self):\n    \"\"\"Compare layer_stack to the equivalent unrolled stack.\n\n    Similar to `test_layer_stack`, but use a function that takes more than one\n    argument.\n    \"\"\"\n    num_layers = 20\n\n    def inner_fn(x, y):\n      x_out = x + hk.Linear(100, name='linear1')(y)\n      y_out = y + hk.Linear(100, name='linear2')(x)\n      return x_out, y_out\n\n    def outer_fn_unrolled(x, y):\n      for _ in range(num_layers):\n        x, y = inner_fn(x, y)\n      return x, y\n\n    def outer_fn_layer_stack(x, y):\n      stack = layer_stack.layer_stack(num_layers)(inner_fn)\n      return stack(x, y)\n\n    unrolled_fn = hk.transform(outer_fn_unrolled)\n    layer_stack_fn = hk.transform(outer_fn_layer_stack)\n\n    x = jax.random.uniform(jax.random.PRNGKey(0), [10, 256, 100])\n    y = jax.random.uniform(jax.random.PRNGKey(1), [10, 256, 100])\n\n    rng_init = jax.random.PRNGKey(42)\n\n    params = layer_stack_fn.init(rng_init, x, y)\n\n    sliced_params = _slice_layers_params(params)\n\n    unrolled_x, unrolled_y = unrolled_fn.apply(sliced_params, None, x, y)\n    layer_stack_x, layer_stack_y = layer_stack_fn.apply(params, None, x, y)\n\n    np.testing.assert_allclose(unrolled_x, layer_stack_x)\n    np.testing.assert_allclose(unrolled_y, layer_stack_y)\n\n  def test_layer_stack_no_varargs(self):\n    \"\"\"Test an error is raised when using a function with varargs.\"\"\"\n\n    class VarArgsModule(hk.Module):\n      \"\"\"When used, this module should cause layer_stack to raise an Error.\"\"\"\n\n      def __call__(self, *args):\n        return args\n\n    class NoVarArgsModule(hk.Module):\n      \"\"\"This module should be fine to use with layer_stack.\"\"\"\n\n      def __call__(self, x):\n        return x\n\n    def build_and_init_stack(module_class):\n      def stack_fn(x):\n        module = module_class()\n        return layer_stack.layer_stack(1)(module)(x)\n\n      stack = hk.without_apply_rng(hk.transform(stack_fn))\n      stack.init(jax.random.PRNGKey(1729), jnp.ones([5]))\n\n    build_and_init_stack(NoVarArgsModule)\n    with self.assertRaisesRegex(\n        ValueError, 'The function `f` should not have any `varargs`'):\n      build_and_init_stack(VarArgsModule)\n\n  @parameterized.parameters([1, 2, 4])\n  def test_layer_stack_grads(self, unroll):\n    \"\"\"Compare layer_stack gradients to the equivalent unrolled stack.\n\n    Tests that the layer_stack application of a Haiku layer function is\n    equivalent to repeatedly applying the layer function in an unrolled loop.\n\n    Args:\n      unroll: Number of unrolled layers.\n    \"\"\"\n    num_layers = 20\n\n    def inner_fn(x):\n      x += hk.Linear(100, name='linear1')(x)\n      x += hk.Linear(100, name='linear2')(x)\n      return x\n\n    def outer_fn_unrolled(x):\n      for _ in range(num_layers):\n        x = inner_fn(x)\n      return x\n\n    def outer_fn_layer_stack(x):\n      stack = layer_stack.layer_stack(num_layers, unroll=unroll)(inner_fn)\n      return stack(x)\n\n    unrolled_fn = hk.transform(outer_fn_unrolled)\n    layer_stack_fn = hk.transform(outer_fn_layer_stack)\n\n    x = jax.random.uniform(jax.random.PRNGKey(0), [10, 256, 100])\n\n    rng_init = jax.random.PRNGKey(42)\n\n    params = layer_stack_fn.init(rng_init, x)\n\n    sliced_params = _slice_layers_params(params)\n\n    unrolled_grad = jax.grad(\n        lambda p, x: jnp.mean(unrolled_fn.apply(p, None, x)))(sliced_params, x)\n    layer_stack_grad = jax.grad(\n        lambda p, x: jnp.mean(layer_stack_fn.apply(p, None, x)))(params, x)\n\n    assert_fn = functools.partial(\n        np.testing.assert_allclose, atol=1e-4, rtol=1e-4)\n\n    jax.tree_map(assert_fn, unrolled_grad,\n                 _slice_layers_params(layer_stack_grad))\n\n  def test_random(self):\n    \"\"\"Random numbers should be handled correctly.\"\"\"\n    n = 100\n\n    @hk.transform\n    @layer_stack.layer_stack(n)\n    def add_random(x):\n      x = x + jax.random.normal(hk.next_rng_key())\n      return x\n\n    # Evaluate a bunch of times\n    key, *keys = jax.random.split(jax.random.PRNGKey(7), 1024 + 1)\n    params = add_random.init(key, 0.)\n    apply_fn = jax.jit(add_random.apply)\n    values = [apply_fn(params, key, 0.) for key in keys]\n\n    # Should be roughly N(0, sqrt(n))\n    cdf = scipy.stats.norm(scale=np.sqrt(n)).cdf\n    _, p = scipy.stats.kstest(values, cdf)\n    self.assertLess(0.3, p)\n\n  def test_threading(self):\n    \"\"\"Test @layer_stack when the function gets per-layer state.\"\"\"\n    n = 5\n\n    @layer_stack.layer_stack(n, with_state=True)\n    def f(x, y):\n      x = x + y * jax.nn.one_hot(y, len(x)) / 10\n      return x, 2 * y\n\n    @hk.without_apply_rng\n    @hk.transform\n    def g(x, ys):\n      x, zs = f(x, ys)\n      # Check here to catch issues at init time\n      self.assertEqual(zs.shape, (n,))\n      return x, zs\n\n    rng = jax.random.PRNGKey(7)\n    x = np.zeros(n)\n    ys = np.arange(n).astype(np.float32)\n    params = g.init(rng, x, ys)\n    x, zs = g.apply(params, x, ys)\n    self.assertTrue(np.allclose(x, [0, .1, .2, .3, .4]))\n    self.assertTrue(np.all(zs == 2 * ys))\n\n  def test_nested_stacks(self):\n    def stack_fn(x):\n      def layer_fn(x):\n        return hk.Linear(100)(x)\n\n      outer_fn = layer_stack.layer_stack(10)(layer_fn)\n\n      layer_outer = layer_stack.layer_stack(20)(outer_fn)\n      return layer_outer(x)\n\n    hk_mod = hk.transform(stack_fn)\n    apply_rng, init_rng = jax.random.split(jax.random.PRNGKey(0))\n\n    params = hk_mod.init(init_rng, jnp.zeros([10, 100]))\n\n    hk_mod.apply(params, apply_rng, jnp.zeros([10, 100]))\n\n    p, = params.values()\n\n    assert p['w'].shape == (10, 20, 100, 100)\n    assert p['b'].shape == (10, 20, 100)\n\n  def test_with_state_multi_args(self):\n    \"\"\"Test layer_stack with state with multiple arguments.\"\"\"\n    width = 4\n    batch_size = 5\n    stack_height = 3\n\n    def f_with_multi_args(x, a, b):\n      return hk.Linear(\n          width, w_init=hk.initializers.Constant(\n              jnp.eye(width)))(x) * a + b, None\n\n    @hk.without_apply_rng\n    @hk.transform\n    def hk_fn(x):\n      return layer_stack.layer_stack(\n          stack_height,\n          with_state=True)(f_with_multi_args)(x, jnp.full([stack_height], 2.),\n                                              jnp.ones([stack_height]))\n\n    x = jnp.zeros([batch_size, width])\n    key_seq = hk.PRNGSequence(19)\n    params = hk_fn.init(next(key_seq), x)\n    output, z = hk_fn.apply(params, x)\n    self.assertIsNone(z)\n    self.assertEqual(output.shape, (batch_size, width))\n    np.testing.assert_equal(output, np.full([batch_size, width], 7.))\n\n  def test_with_container_state(self):\n    width = 2\n    batch_size = 2\n    stack_height = 3\n\n    def f_with_container_state(x):\n      hk_layer = hk.Linear(\n          width, w_init=hk.initializers.Constant(jnp.eye(width)))\n      layer_output = hk_layer(x)\n      layer_state = {\n          'raw_output': layer_output,\n          'output_projection': jnp.sum(layer_output)\n      }\n      return layer_output + jnp.ones_like(layer_output), layer_state\n\n    @hk.without_apply_rng\n    @hk.transform\n    def hk_fn(x):\n      return layer_stack.layer_stack(\n          stack_height,\n          with_state=True)(f_with_container_state)(x)\n\n    x = jnp.zeros([batch_size, width])\n    key_seq = hk.PRNGSequence(19)\n    params = hk_fn.init(next(key_seq), x)\n    output, z = hk_fn.apply(params, x)\n    self.assertEqual(z['raw_output'].shape, (stack_height, batch_size, width))\n    self.assertEqual(output.shape, (batch_size, width))\n    self.assertEqual(z['output_projection'].shape, (stack_height,))\n    np.testing.assert_equal(np.sum(z['output_projection']), np.array(12.))\n    np.testing.assert_equal(\n        np.all(z['raw_output'] == np.array([0., 1., 2.])[..., None, None]),\n        np.array(True))\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/model/lddt.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"lDDT protein distance score.\"\"\"\nimport jax.numpy as jnp\n\n\ndef lddt(predicted_points,\n         true_points,\n         true_points_mask,\n         cutoff=15.,\n         per_residue=False):\n  \"\"\"Measure (approximate) lDDT for a batch of coordinates.\n\n  lDDT reference:\n  Mariani, V., Biasini, M., Barbato, A. & Schwede, T. lDDT: A local\n  superposition-free score for comparing protein structures and models using\n  distance difference tests. Bioinformatics 29, 2722–2728 (2013).\n\n  lDDT is a measure of the difference between the true distance matrix and the\n  distance matrix of the predicted points.  The difference is computed only on\n  points closer than cutoff *in the true structure*.\n\n  This function does not compute the exact lDDT value that the original paper\n  describes because it does not include terms for physical feasibility\n  (e.g. bond length violations). Therefore this is only an approximate\n  lDDT score.\n\n  Args:\n    predicted_points: (batch, length, 3) array of predicted 3D points\n    true_points: (batch, length, 3) array of true 3D points\n    true_points_mask: (batch, length, 1) binary-valued float array.  This mask\n      should be 1 for points that exist in the true points.\n    cutoff: Maximum distance for a pair of points to be included\n    per_residue: If true, return score for each residue.  Note that the overall\n      lDDT is not exactly the mean of the per_residue lDDT's because some\n      residues have more contacts than others.\n\n  Returns:\n    An (approximate, see above) lDDT score in the range 0-1.\n  \"\"\"\n\n  assert len(predicted_points.shape) == 3\n  assert predicted_points.shape[-1] == 3\n  assert true_points_mask.shape[-1] == 1\n  assert len(true_points_mask.shape) == 3\n\n  # Compute true and predicted distance matrices.\n  dmat_true = jnp.sqrt(1e-10 + jnp.sum(\n      (true_points[:, :, None] - true_points[:, None, :])**2, axis=-1))\n\n  dmat_predicted = jnp.sqrt(1e-10 + jnp.sum(\n      (predicted_points[:, :, None] -\n       predicted_points[:, None, :])**2, axis=-1))\n\n  dists_to_score = (\n      (dmat_true < cutoff).astype(jnp.float32) * true_points_mask *\n      jnp.transpose(true_points_mask, [0, 2, 1]) *\n      (1. - jnp.eye(dmat_true.shape[1]))  # Exclude self-interaction.\n  )\n\n  # Shift unscored distances to be far away.\n  dist_l1 = jnp.abs(dmat_true - dmat_predicted)\n\n  # True lDDT uses a number of fixed bins.\n  # We ignore the physical plausibility correction to lDDT, though.\n  score = 0.25 * ((dist_l1 < 0.5).astype(jnp.float32) +\n                  (dist_l1 < 1.0).astype(jnp.float32) +\n                  (dist_l1 < 2.0).astype(jnp.float32) +\n                  (dist_l1 < 4.0).astype(jnp.float32))\n\n  # Normalize over the appropriate axes.\n  reduce_axes = (-1,) if per_residue else (-2, -1)\n  norm = 1. / (1e-10 + jnp.sum(dists_to_score, axis=reduce_axes))\n  score = norm * (1e-10 + jnp.sum(dists_to_score * score, axis=reduce_axes))\n\n  return score\n"
  },
  {
    "path": "alphafold/model/lddt_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for lddt.\"\"\"\n\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.model import lddt\nimport numpy as np\n\n\nclass LddtTest(parameterized.TestCase, absltest.TestCase):\n\n  @parameterized.named_parameters(\n      ('same',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [1, 1, 1]),\n      ('all_shifted',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[-1, 0, 0], [4, 0, 0], [9, 0, 0]],\n       [1, 1, 1]),\n      ('all_rotated',\n       [[0, 0, 0], [5, 0, 0], [10, 0, 0]],\n       [[0, 0, 0], [0, 5, 0], [0, 10, 0]],\n       [1, 1, 1]),\n      ('half_a_dist',\n       [[0, 0, 0], [5, 0, 0]],\n       [[0, 0, 0], [5.5-1e-5, 0, 0]],\n       [1, 1]),\n      ('one_a_dist',\n       [[0, 0, 0], [5, 0, 0]],\n       [[0, 0, 0], [6-1e-5, 0, 0]],\n       [0.75, 0.75]),\n      ('two_a_dist',\n       [[0, 0, 0], [5, 0, 0]],\n       [[0, 0, 0], [7-1e-5, 0, 0]],\n       [0.5, 0.5]),\n      ('four_a_dist',\n       [[0, 0, 0], [5, 0, 0]],\n       [[0, 0, 0], [9-1e-5, 0, 0]],\n       [0.25, 0.25],),\n      ('five_a_dist',\n       [[0, 0, 0], [16-1e-5, 0, 0]],\n       [[0, 0, 0], [11, 0, 0]],\n       [0, 0]),\n      ('no_pairs',\n       [[0, 0, 0], [20, 0, 0]],\n       [[0, 0, 0], [25-1e-5, 0, 0]],\n       [1, 1]),\n  )\n  def test_lddt(\n      self, predicted_pos, true_pos, exp_lddt):\n    predicted_pos = np.array([predicted_pos], dtype=np.float32)\n    true_points_mask = np.array([[[1]] * len(true_pos)], dtype=np.float32)\n    true_pos = np.array([true_pos], dtype=np.float32)\n    cutoff = 15.0\n    per_residue = True\n\n    result = lddt.lddt(\n        predicted_pos, true_pos, true_points_mask, cutoff,\n        per_residue)\n\n    np.testing.assert_almost_equal(result, [exp_lddt], decimal=4)\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/model/mapping.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Specialized mapping functions.\"\"\"\n\nimport functools\nimport inspect\n\nfrom typing import Any, Callable, Optional, Sequence, Union\n\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\n\n\nPYTREE = Any\nPYTREE_JAX_ARRAY = Any\n\npartial = functools.partial\nPROXY = object()\n\n\ndef _maybe_slice(array, i, slice_size, axis):\n  if axis is PROXY:\n    return array\n  else:\n    return jax.lax.dynamic_slice_in_dim(\n        array, i, slice_size=slice_size, axis=axis)\n\n\ndef _maybe_get_size(array, axis):\n  if axis == PROXY:\n    return -1\n  else:\n    return array.shape[axis]\n\n\ndef _expand_axes(axes, values, name='sharded_apply'):\n  values_tree_def = jax.tree_util.tree_flatten(values)[1]\n  flat_axes = jax.api_util.flatten_axes(name, values_tree_def, axes)\n  # Replace None's with PROXY\n  flat_axes = [PROXY if x is None else x for x in flat_axes]\n  return jax.tree_util.tree_unflatten(values_tree_def, flat_axes)\n\n\ndef sharded_map(\n    fun: Callable[..., PYTREE_JAX_ARRAY],\n    shard_size: Union[int, None] = 1,\n    in_axes: Union[int, PYTREE] = 0,\n    out_axes: Union[int, PYTREE] = 0) -> Callable[..., PYTREE_JAX_ARRAY]:\n  \"\"\"Sharded vmap.\n\n  Maps `fun` over axes, in a way similar to vmap, but does so in shards of\n  `shard_size`. This allows a smooth trade-off between memory usage\n  (as in a plain map) vs higher throughput (as in a vmap).\n\n  Args:\n    fun: Function to apply smap transform to.\n    shard_size: Integer denoting shard size.\n    in_axes: Either integer or pytree describing which axis to map over for each\n      input to `fun`, None denotes broadcasting.\n    out_axes: integer or pytree denoting to what axis in the output the mapped\n      over axis maps.\n\n  Returns:\n    function with smap applied.\n  \"\"\"\n  if 'split_rng' in inspect.signature(hk.vmap).parameters:\n    vmapped_fun = hk.vmap(fun, in_axes, out_axes, split_rng=False)\n  else:\n    # TODO(tomhennigan): Remove this when older versions of Haiku aren't used.\n    vmapped_fun = hk.vmap(fun, in_axes, out_axes)\n  return sharded_apply(vmapped_fun, shard_size, in_axes, out_axes)\n\n\ndef sharded_apply(\n    fun: Callable[..., PYTREE_JAX_ARRAY],  # pylint: disable=g-bare-generic\n    shard_size: Union[int, None] = 1,\n    in_axes: Union[int, PYTREE] = 0,\n    out_axes: Union[int, PYTREE] = 0,\n    new_out_axes: bool = False) -> Callable[..., PYTREE_JAX_ARRAY]:\n  \"\"\"Sharded apply.\n\n  Applies `fun` over shards to axes, in a way similar to vmap,\n  but does so in shards of `shard_size`. Shards are stacked after.\n  This allows a smooth trade-off between\n  memory usage (as in a plain map) vs higher throughput (as in a vmap).\n\n  Args:\n    fun: Function to apply smap transform to.\n    shard_size: Integer denoting shard size.\n    in_axes: Either integer or pytree describing which axis to map over for each\n      input to `fun`, None denotes broadcasting.\n    out_axes: integer or pytree denoting to what axis in the output the mapped\n      over axis maps.\n    new_out_axes: whether to stack outputs on new axes. This assumes that the\n      output sizes for each shard (including the possible remainder shard) are\n      the same.\n\n  Returns:\n    function with smap applied.\n  \"\"\"\n  docstr = ('Mapped version of {fun}. Takes similar arguments to {fun} '\n            'but with additional array axes over which {fun} is mapped.')\n  if new_out_axes:\n    raise NotImplementedError('New output axes not yet implemented.')\n\n  # shard size None denotes no sharding\n  if shard_size is None:\n    return fun\n\n  @jax.util.wraps(fun, docstr=docstr)\n  def mapped_fn(*args):\n    # Expand in axes and Determine Loop range\n    in_axes_ = _expand_axes(in_axes, args)\n\n    in_sizes = jax.tree_map(_maybe_get_size, args, in_axes_)\n    flat_sizes = jax.tree_util.tree_flatten(in_sizes)[0]\n    in_size = max(flat_sizes)\n    assert all(i in {in_size, -1} for i in flat_sizes)\n\n    num_extra_shards = (in_size - 1) // shard_size\n\n    # Fix Up if necessary\n    last_shard_size = in_size % shard_size\n    last_shard_size = shard_size if last_shard_size == 0 else last_shard_size\n\n    def apply_fun_to_slice(slice_start, slice_size):\n      input_slice = jax.tree_map(\n          lambda array, axis: _maybe_slice(array, slice_start, slice_size, axis\n                                          ), args, in_axes_)\n      return fun(*input_slice)\n\n    remainder_shape_dtype = hk.eval_shape(\n        partial(apply_fun_to_slice, 0, last_shard_size))\n    out_dtypes = jax.tree_map(lambda x: x.dtype, remainder_shape_dtype)\n    out_shapes = jax.tree_map(lambda x: x.shape, remainder_shape_dtype)\n    out_axes_ = _expand_axes(out_axes, remainder_shape_dtype)\n\n    if num_extra_shards > 0:\n      regular_shard_shape_dtype = hk.eval_shape(\n          partial(apply_fun_to_slice, 0, shard_size))\n      shard_shapes = jax.tree_map(lambda x: x.shape, regular_shard_shape_dtype)\n\n      def make_output_shape(axis, shard_shape, remainder_shape):\n        return shard_shape[:axis] + (\n            shard_shape[axis] * num_extra_shards +\n            remainder_shape[axis],) + shard_shape[axis + 1:]\n\n      out_shapes = jax.tree_map(make_output_shape, out_axes_, shard_shapes,\n                                out_shapes)\n\n    # Calls dynamic Update slice with different argument order\n    # This is here since tree_map only works with positional arguments\n    def dynamic_update_slice_in_dim(full_array, update, axis, i):\n      return jax.lax.dynamic_update_slice_in_dim(full_array, update, i, axis)\n\n    def compute_shard(outputs, slice_start, slice_size):\n      slice_out = apply_fun_to_slice(slice_start, slice_size)\n      update_slice = partial(\n          dynamic_update_slice_in_dim, i=slice_start)\n      return jax.tree_map(update_slice, outputs, slice_out, out_axes_)\n\n    def scan_iteration(outputs, i):\n      new_outputs = compute_shard(outputs, i, shard_size)\n      return new_outputs, ()\n\n    slice_starts = jnp.arange(0, in_size - shard_size + 1, shard_size)\n\n    def allocate_buffer(dtype, shape):\n      return jnp.zeros(shape, dtype=dtype)\n\n    outputs = jax.tree_map(allocate_buffer, out_dtypes, out_shapes)\n\n    if slice_starts.shape[0] > 0:\n      outputs, _ = hk.scan(scan_iteration, outputs, slice_starts)\n\n    if last_shard_size != shard_size:\n      remainder_start = in_size - last_shard_size\n      outputs = compute_shard(outputs, remainder_start, last_shard_size)\n\n    return outputs\n\n  return mapped_fn\n\n\ndef inference_subbatch(\n    module: Callable[..., PYTREE_JAX_ARRAY],\n    subbatch_size: int,\n    batched_args: Sequence[PYTREE_JAX_ARRAY],\n    nonbatched_args: Sequence[PYTREE_JAX_ARRAY],\n    low_memory: bool = True,\n    input_subbatch_dim: int = 0,\n    output_subbatch_dim: Optional[int] = None) -> PYTREE_JAX_ARRAY:\n  \"\"\"Run through subbatches (like batch apply but with split and concat).\"\"\"\n  assert len(batched_args) > 0  # pylint: disable=g-explicit-length-test\n\n  if not low_memory:\n    args = list(batched_args) + list(nonbatched_args)\n    return module(*args)\n\n  if output_subbatch_dim is None:\n    output_subbatch_dim = input_subbatch_dim\n\n  def run_module(*batched_args):\n    args = list(batched_args) + list(nonbatched_args)\n    return module(*args)\n  sharded_module = sharded_apply(run_module,\n                                 shard_size=subbatch_size,\n                                 in_axes=input_subbatch_dim,\n                                 out_axes=output_subbatch_dim)\n  return sharded_module(*batched_args)\n"
  },
  {
    "path": "alphafold/model/model.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Code for constructing the model.\"\"\"\nfrom typing import Any, Mapping, Optional, Union\n\nfrom absl import logging\nfrom alphafold.common import confidence\nfrom alphafold.model import features\nfrom alphafold.model import modules\nfrom alphafold.model import modules_multimer\nimport haiku as hk\nimport jax\nimport ml_collections\nimport numpy as np\nimport tensorflow.compat.v1 as tf\nimport tree\n\n\ndef get_confidence_metrics(\n    prediction_result: Mapping[str, Any],\n    multimer_mode: bool) -> Mapping[str, Any]:\n  \"\"\"Post processes prediction_result to get confidence metrics.\"\"\"\n  confidence_metrics = {}\n  confidence_metrics['plddt'] = confidence.compute_plddt(\n      prediction_result['predicted_lddt']['logits'])\n  if 'predicted_aligned_error' in prediction_result:\n    confidence_metrics.update(confidence.compute_predicted_aligned_error(\n        logits=prediction_result['predicted_aligned_error']['logits'],\n        breaks=prediction_result['predicted_aligned_error']['breaks']))\n    confidence_metrics['ptm'] = confidence.predicted_tm_score(\n        logits=prediction_result['predicted_aligned_error']['logits'],\n        breaks=prediction_result['predicted_aligned_error']['breaks'],\n        asym_id=None)\n    if multimer_mode:\n      # Compute the ipTM only for the multimer model.\n      confidence_metrics['iptm'] = confidence.predicted_tm_score(\n          logits=prediction_result['predicted_aligned_error']['logits'],\n          breaks=prediction_result['predicted_aligned_error']['breaks'],\n          asym_id=prediction_result['predicted_aligned_error']['asym_id'],\n          interface=True)\n      confidence_metrics['ranking_confidence'] = (\n          0.8 * confidence_metrics['iptm'] + 0.2 * confidence_metrics['ptm'])\n\n  if not multimer_mode:\n    # Monomer models use mean pLDDT for model ranking.\n    confidence_metrics['ranking_confidence'] = np.mean(\n        confidence_metrics['plddt'])\n\n  return confidence_metrics\n\n\nclass RunModel:\n  \"\"\"Container for JAX model.\"\"\"\n\n  def __init__(self,\n               config: ml_collections.ConfigDict,\n               params: Optional[Mapping[str, Mapping[str, np.ndarray]]] = None):\n    self.config = config\n    self.params = params\n    self.multimer_mode = config.model.global_config.multimer_mode\n\n    if self.multimer_mode:\n      def _forward_fn(batch):\n        model = modules_multimer.AlphaFold(self.config.model)\n        return model(\n            batch,\n            is_training=False)\n    else:\n      def _forward_fn(batch):\n        model = modules.AlphaFold(self.config.model)\n        return model(\n            batch,\n            is_training=False,\n            compute_loss=False,\n            ensemble_representations=True)\n\n    self.apply = jax.jit(hk.transform(_forward_fn).apply)\n    self.init = jax.jit(hk.transform(_forward_fn).init)\n\n  def init_params(self, feat: features.FeatureDict, random_seed: int = 0):\n    \"\"\"Initializes the model parameters.\n\n    If none were provided when this class was instantiated then the parameters\n    are randomly initialized.\n\n    Args:\n      feat: A dictionary of NumPy feature arrays as output by\n        RunModel.process_features.\n      random_seed: A random seed to use to initialize the parameters if none\n        were set when this class was initialized.\n    \"\"\"\n    if not self.params:\n      # Init params randomly.\n      rng = jax.random.PRNGKey(random_seed)\n      self.params = hk.data_structures.to_mutable_dict(\n          self.init(rng, feat))\n      logging.warning('Initialized parameters randomly')\n\n  def process_features(\n      self,\n      raw_features: Union[tf.train.Example, features.FeatureDict],\n      random_seed: int) -> features.FeatureDict:\n    \"\"\"Processes features to prepare for feeding them into the model.\n\n    Args:\n      raw_features: The output of the data pipeline either as a dict of NumPy\n        arrays or as a tf.train.Example.\n      random_seed: The random seed to use when processing the features.\n\n    Returns:\n      A dict of NumPy feature arrays suitable for feeding into the model.\n    \"\"\"\n\n    if self.multimer_mode:\n      return raw_features\n\n    # Single-chain mode.\n    if isinstance(raw_features, dict):\n      return features.np_example_to_features(\n          np_example=raw_features,\n          config=self.config,\n          random_seed=random_seed)\n    else:\n      return features.tf_example_to_features(\n          tf_example=raw_features,\n          config=self.config,\n          random_seed=random_seed)\n\n  def eval_shape(self, feat: features.FeatureDict) -> jax.ShapeDtypeStruct:\n    self.init_params(feat)\n    logging.info('Running eval_shape with shape(feat) = %s',\n                 tree.map_structure(lambda x: x.shape, feat))\n    shape = jax.eval_shape(self.apply, self.params, jax.random.PRNGKey(0), feat)\n    logging.info('Output shape was %s', shape)\n    return shape\n\n  def predict(self,\n              feat: features.FeatureDict,\n              random_seed: int,\n              ) -> Mapping[str, Any]:\n    \"\"\"Makes a prediction by inferencing the model on the provided features.\n\n    Args:\n      feat: A dictionary of NumPy feature arrays as output by\n        RunModel.process_features.\n      random_seed: The random seed to use when running the model. In the\n        multimer model this controls the MSA sampling.\n\n    Returns:\n      A dictionary of model outputs.\n    \"\"\"\n    self.init_params(feat)\n    logging.info('Running predict with shape(feat) = %s',\n                 tree.map_structure(lambda x: x.shape, feat))\n    result = self.apply(self.params, jax.random.PRNGKey(random_seed), feat)\n\n    # This block is to ensure benchmark timings are accurate. Some blocking is\n    # already happening when computing get_confidence_metrics, and this ensures\n    # all outputs are blocked on.\n    jax.tree_map(lambda x: x.block_until_ready(), result)\n    result.update(\n        get_confidence_metrics(result, multimer_mode=self.multimer_mode))\n    logging.info('Output shape was %s',\n                 tree.map_structure(lambda x: x.shape, result))\n    return result\n"
  },
  {
    "path": "alphafold/model/modules.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Modules and code used in the core part of AlphaFold.\n\nThe structure generation code is in 'folding.py'.\n\"\"\"\nimport functools\nfrom alphafold.common import residue_constants\nfrom alphafold.model import all_atom\nfrom alphafold.model import common_modules\nfrom alphafold.model import folding\nfrom alphafold.model import layer_stack\nfrom alphafold.model import lddt\nfrom alphafold.model import mapping\nfrom alphafold.model import prng\nfrom alphafold.model import quat_affine\nfrom alphafold.model import utils\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\n\n\ndef softmax_cross_entropy(logits, labels):\n  \"\"\"Computes softmax cross entropy given logits and one-hot class labels.\"\"\"\n  loss = -jnp.sum(labels * jax.nn.log_softmax(logits), axis=-1)\n  return jnp.asarray(loss)\n\n\ndef sigmoid_cross_entropy(logits, labels):\n  \"\"\"Computes sigmoid cross entropy given logits and multiple class labels.\"\"\"\n  log_p = jax.nn.log_sigmoid(logits)\n  # log(1 - sigmoid(x)) = log_sigmoid(-x), the latter is more numerically stable\n  log_not_p = jax.nn.log_sigmoid(-logits)\n  loss = -labels * log_p - (1. - labels) * log_not_p\n  return jnp.asarray(loss)\n\n\ndef apply_dropout(*, tensor, safe_key, rate, is_training, broadcast_dim=None):\n  \"\"\"Applies dropout to a tensor.\"\"\"\n  if is_training and rate != 0.0:\n    shape = list(tensor.shape)\n    if broadcast_dim is not None:\n      shape[broadcast_dim] = 1\n    keep_rate = 1.0 - rate\n    keep = jax.random.bernoulli(safe_key.get(), keep_rate, shape=shape)\n    return keep * tensor / keep_rate\n  else:\n    return tensor\n\n\ndef dropout_wrapper(module,\n                    input_act,\n                    mask,\n                    safe_key,\n                    global_config,\n                    output_act=None,\n                    is_training=True,\n                    **kwargs):\n  \"\"\"Applies module + dropout + residual update.\"\"\"\n  if output_act is None:\n    output_act = input_act\n\n  gc = global_config\n  residual = module(input_act, mask, is_training=is_training, **kwargs)\n  dropout_rate = 0.0 if gc.deterministic else module.config.dropout_rate\n\n  # Will override `is_training` to True if want to use dropout.\n  should_apply_dropout = True if gc.eval_dropout else is_training\n\n  if module.config.shared_dropout:\n    if module.config.orientation == 'per_row':\n      broadcast_dim = 0\n    else:\n      broadcast_dim = 1\n  else:\n    broadcast_dim = None\n\n  residual = apply_dropout(tensor=residual,\n                           safe_key=safe_key,\n                           rate=dropout_rate,\n                           is_training=should_apply_dropout,\n                           broadcast_dim=broadcast_dim)\n\n  new_act = output_act + residual\n\n  return new_act\n\n\ndef create_extra_msa_feature(batch):\n  \"\"\"Expand extra_msa into 1hot and concat with other extra msa features.\n\n  We do this as late as possible as the one_hot extra msa can be very large.\n\n  Arguments:\n    batch: a dictionary with the following keys:\n     * 'extra_msa': [N_extra_seq, N_res] MSA that wasn't selected as a cluster\n       centre. Note, that this is not one-hot encoded.\n     * 'extra_has_deletion': [N_extra_seq, N_res] Whether there is a deletion to\n       the left of each position in the extra MSA.\n     * 'extra_deletion_value': [N_extra_seq, N_res] The number of deletions to\n       the left of each position in the extra MSA.\n\n  Returns:\n    Concatenated tensor of extra MSA features.\n  \"\"\"\n  # 23 = 20 amino acids + 'X' for unknown + gap + bert mask\n  msa_1hot = jax.nn.one_hot(batch['extra_msa'], 23)\n  msa_feat = [msa_1hot,\n              jnp.expand_dims(batch['extra_has_deletion'], axis=-1),\n              jnp.expand_dims(batch['extra_deletion_value'], axis=-1)]\n  return jnp.concatenate(msa_feat, axis=-1)\n\n\nclass AlphaFoldIteration(hk.Module):\n  \"\"\"A single recycling iteration of AlphaFold architecture.\n\n  Computes ensembled (averaged) representations from the provided features.\n  These representations are then passed to the various heads\n  that have been requested by the configuration file. Each head also returns a\n  loss which is combined as a weighted sum to produce the total loss.\n\n  Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 3-22\n  \"\"\"\n\n  def __init__(self, config, global_config, name='alphafold_iteration'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               ensembled_batch,\n               non_ensembled_batch,\n               is_training,\n               compute_loss=False,\n               ensemble_representations=False,\n               return_representations=False):\n\n    num_ensemble = jnp.asarray(ensembled_batch['seq_length'].shape[0])\n\n    if not ensemble_representations:\n      assert ensembled_batch['seq_length'].shape[0] == 1\n\n    def slice_batch(i):\n      b = {k: v[i] for k, v in ensembled_batch.items()}\n      b.update(non_ensembled_batch)\n      return b\n\n    # Compute representations for each batch element and average.\n    evoformer_module = EmbeddingsAndEvoformer(\n        self.config.embeddings_and_evoformer, self.global_config)\n    batch0 = slice_batch(0)\n    representations = evoformer_module(batch0, is_training)\n\n    # MSA representations are not ensembled so\n    # we don't pass tensor into the loop.\n    msa_representation = representations['msa']\n    del representations['msa']\n\n    # Average the representations (except MSA) over the batch dimension.\n    if ensemble_representations:\n      def body(x):\n        \"\"\"Add one element to the representations ensemble.\"\"\"\n        i, current_representations = x\n        feats = slice_batch(i)\n        representations_update = evoformer_module(\n            feats, is_training)\n\n        new_representations = {}\n        for k in current_representations:\n          new_representations[k] = (\n              current_representations[k] + representations_update[k])\n        return i+1, new_representations\n\n      if hk.running_init():\n        # When initializing the Haiku module, run one iteration of the\n        # while_loop to initialize the Haiku modules used in `body`.\n        _, representations = body((1, representations))\n      else:\n        _, representations = hk.while_loop(\n            lambda x: x[0] < num_ensemble,\n            body,\n            (1, representations))\n\n      for k in representations:\n        if k != 'msa':\n          representations[k] /= num_ensemble.astype(representations[k].dtype)\n\n    representations['msa'] = msa_representation\n    batch = batch0  # We are not ensembled from here on.\n\n    heads = {}\n    for head_name, head_config in sorted(self.config.heads.items()):\n      if not head_config.weight:\n        continue  # Do not instantiate zero-weight heads.\n\n      head_factory = {\n          'masked_msa': MaskedMsaHead,\n          'distogram': DistogramHead,\n          'structure_module': functools.partial(\n              folding.StructureModule, compute_loss=compute_loss),\n          'predicted_lddt': PredictedLDDTHead,\n          'predicted_aligned_error': PredictedAlignedErrorHead,\n          'experimentally_resolved': ExperimentallyResolvedHead,\n      }[head_name]\n      heads[head_name] = (head_config,\n                          head_factory(head_config, self.global_config))\n\n    total_loss = 0.\n    ret = {}\n    ret['representations'] = representations\n\n    def loss(module, head_config, ret, name, filter_ret=True):\n      if filter_ret:\n        value = ret[name]\n      else:\n        value = ret\n      loss_output = module.loss(value, batch)\n      ret[name].update(loss_output)\n      loss = head_config.weight * ret[name]['loss']\n      return loss\n\n    for name, (head_config, module) in heads.items():\n      # Skip PredictedLDDTHead and PredictedAlignedErrorHead until\n      # StructureModule is executed.\n      if name in ('predicted_lddt', 'predicted_aligned_error'):\n        continue\n      else:\n        ret[name] = module(representations, batch, is_training)\n        if 'representations' in ret[name]:\n          # Extra representations from the head. Used by the structure module\n          # to provide activations for the PredictedLDDTHead.\n          representations.update(ret[name].pop('representations'))\n      if compute_loss:\n        total_loss += loss(module, head_config, ret, name)\n\n    if self.config.heads.get('predicted_lddt.weight', 0.0):\n      # Add PredictedLDDTHead after StructureModule executes.\n      name = 'predicted_lddt'\n      # Feed all previous results to give access to structure_module result.\n      head_config, module = heads[name]\n      ret[name] = module(representations, batch, is_training)\n      if compute_loss:\n        total_loss += loss(module, head_config, ret, name, filter_ret=False)\n\n    if ('predicted_aligned_error' in self.config.heads\n        and self.config.heads.get('predicted_aligned_error.weight', 0.0)):\n      # Add PredictedAlignedErrorHead after StructureModule executes.\n      name = 'predicted_aligned_error'\n      # Feed all previous results to give access to structure_module result.\n      head_config, module = heads[name]\n      ret[name] = module(representations, batch, is_training)\n      if compute_loss:\n        total_loss += loss(module, head_config, ret, name, filter_ret=False)\n\n    if compute_loss:\n      return ret, total_loss\n    else:\n      return ret\n\n\nclass AlphaFold(hk.Module):\n  \"\"\"AlphaFold model with recycling.\n\n  Jumper et al. (2021) Suppl. Alg. 2 \"Inference\"\n  \"\"\"\n\n  def __init__(self, config, name='alphafold'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = config.global_config\n\n  def __call__(\n      self,\n      batch,\n      is_training,\n      compute_loss=False,\n      ensemble_representations=False,\n      return_representations=False):\n    \"\"\"Run the AlphaFold model.\n\n    Arguments:\n      batch: Dictionary with inputs to the AlphaFold model.\n      is_training: Whether the system is in training or inference mode.\n      compute_loss: Whether to compute losses (requires extra features\n        to be present in the batch and knowing the true structure).\n      ensemble_representations: Whether to use ensembling of representations.\n      return_representations: Whether to also return the intermediate\n        representations.\n\n    Returns:\n      When compute_loss is True:\n        a tuple of loss and output of AlphaFoldIteration.\n      When compute_loss is False:\n        just output of AlphaFoldIteration.\n\n      The output of AlphaFoldIteration is a nested dictionary containing\n      predictions from the various heads.\n    \"\"\"\n\n    impl = AlphaFoldIteration(self.config, self.global_config)\n    batch_size, num_residues = batch['aatype'].shape\n\n    def get_prev(ret):\n      new_prev = {\n          'prev_pos':\n              ret['structure_module']['final_atom_positions'],\n          'prev_msa_first_row': ret['representations']['msa_first_row'],\n          'prev_pair': ret['representations']['pair'],\n      }\n      return jax.tree_map(jax.lax.stop_gradient, new_prev)\n\n    def do_call(prev,\n                recycle_idx,\n                compute_loss=compute_loss):\n      if self.config.resample_msa_in_recycling:\n        num_ensemble = batch_size // (self.config.num_recycle + 1)\n        def slice_recycle_idx(x):\n          start = recycle_idx * num_ensemble\n          size = num_ensemble\n          return jax.lax.dynamic_slice_in_dim(x, start, size, axis=0)\n        ensembled_batch = jax.tree_map(slice_recycle_idx, batch)\n      else:\n        num_ensemble = batch_size\n        ensembled_batch = batch\n\n      non_ensembled_batch = jax.tree_map(lambda x: x, prev)\n\n      return impl(\n          ensembled_batch=ensembled_batch,\n          non_ensembled_batch=non_ensembled_batch,\n          is_training=is_training,\n          compute_loss=compute_loss,\n          ensemble_representations=ensemble_representations)\n\n    prev = {}\n    emb_config = self.config.embeddings_and_evoformer\n    if emb_config.recycle_pos:\n      prev['prev_pos'] = jnp.zeros(\n          [num_residues, residue_constants.atom_type_num, 3])\n    if emb_config.recycle_features:\n      prev['prev_msa_first_row'] = jnp.zeros(\n          [num_residues, emb_config.msa_channel])\n      prev['prev_pair'] = jnp.zeros(\n          [num_residues, num_residues, emb_config.pair_channel])\n\n    if self.config.num_recycle:\n      if 'num_iter_recycling' in batch:\n        # Training time: num_iter_recycling is in batch.\n        # The value for each ensemble batch is the same, so arbitrarily taking\n        # 0-th.\n        num_iter = batch['num_iter_recycling'][0]\n\n        # Add insurance that we will not run more\n        # recyclings than the model is configured to run.\n        num_iter = jnp.minimum(num_iter, self.config.num_recycle)\n      else:\n        # Eval mode or tests: use the maximum number of iterations.\n        num_iter = self.config.num_recycle\n\n      body = lambda x: (x[0] + 1,  # pylint: disable=g-long-lambda\n                        get_prev(do_call(x[1], recycle_idx=x[0],\n                                         compute_loss=False)))\n      if hk.running_init():\n        # When initializing the Haiku module, run one iteration of the\n        # while_loop to initialize the Haiku modules used in `body`.\n        _, prev = body((0, prev))\n      else:\n        _, prev = hk.while_loop(\n            lambda x: x[0] < num_iter,\n            body,\n            (0, prev))\n    else:\n      num_iter = 0\n\n    ret = do_call(prev=prev, recycle_idx=num_iter)\n    if compute_loss:\n      ret = ret[0], [ret[1]]\n\n    if not return_representations:\n      del (ret[0] if compute_loss else ret)['representations']  # pytype: disable=unsupported-operands\n    return ret\n\n\nclass TemplatePairStack(hk.Module):\n  \"\"\"Pair stack for the templates.\n\n  Jumper et al. (2021) Suppl. Alg. 16 \"TemplatePairStack\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='template_pair_stack'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, pair_act, pair_mask, is_training, safe_key=None):\n    \"\"\"Builds TemplatePairStack module.\n\n    Arguments:\n      pair_act: Pair activations for single template, shape [N_res, N_res, c_t].\n      pair_mask: Pair mask, shape [N_res, N_res].\n      is_training: Whether the module is in training mode.\n      safe_key: Safe key object encapsulating the random number generation key.\n\n    Returns:\n      Updated pair_act, shape [N_res, N_res, c_t].\n    \"\"\"\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    gc = self.global_config\n    c = self.config\n\n    if not c.num_block:\n      return pair_act\n\n    def block(x):\n      \"\"\"One block of the template pair stack.\"\"\"\n      pair_act, safe_key = x\n\n      dropout_wrapper_fn = functools.partial(\n          dropout_wrapper, is_training=is_training, global_config=gc)\n\n      safe_key, *sub_keys = safe_key.split(6)\n      sub_keys = iter(sub_keys)\n\n      pair_act = dropout_wrapper_fn(\n          TriangleAttention(c.triangle_attention_starting_node, gc,\n                            name='triangle_attention_starting_node'),\n          pair_act,\n          pair_mask,\n          next(sub_keys))\n      pair_act = dropout_wrapper_fn(\n          TriangleAttention(c.triangle_attention_ending_node, gc,\n                            name='triangle_attention_ending_node'),\n          pair_act,\n          pair_mask,\n          next(sub_keys))\n      pair_act = dropout_wrapper_fn(\n          TriangleMultiplication(c.triangle_multiplication_outgoing, gc,\n                                 name='triangle_multiplication_outgoing'),\n          pair_act,\n          pair_mask,\n          next(sub_keys))\n      pair_act = dropout_wrapper_fn(\n          TriangleMultiplication(c.triangle_multiplication_incoming, gc,\n                                 name='triangle_multiplication_incoming'),\n          pair_act,\n          pair_mask,\n          next(sub_keys))\n      pair_act = dropout_wrapper_fn(\n          Transition(c.pair_transition, gc, name='pair_transition'),\n          pair_act,\n          pair_mask,\n          next(sub_keys))\n\n      return pair_act, safe_key\n\n    if gc.use_remat:\n      block = hk.remat(block)\n\n    res_stack = layer_stack.layer_stack(c.num_block)(block)\n    pair_act, safe_key = res_stack((pair_act, safe_key))\n    return pair_act\n\n\nclass Transition(hk.Module):\n  \"\"\"Transition layer.\n\n  Jumper et al. (2021) Suppl. Alg. 9 \"MSATransition\"\n  Jumper et al. (2021) Suppl. Alg. 15 \"PairTransition\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='transition_block'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, act, mask, is_training=True):\n    \"\"\"Builds Transition module.\n\n    Arguments:\n      act: A tensor of queries of size [batch_size, N_res, N_channel].\n      mask: A tensor denoting the mask of size [batch_size, N_res].\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      A float32 tensor of size [batch_size, N_res, N_channel].\n    \"\"\"\n    _, _, nc = act.shape\n\n    num_intermediate = int(nc * self.config.num_intermediate_factor)\n    mask = jnp.expand_dims(mask, axis=-1)\n\n    act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='input_layer_norm')(\n            act)\n\n    transition_module = hk.Sequential([\n        common_modules.Linear(\n            num_intermediate,\n            initializer='relu',\n            name='transition1'), jax.nn.relu,\n        common_modules.Linear(\n            nc,\n            initializer=utils.final_init(self.global_config),\n            name='transition2')\n    ])\n\n    act = mapping.inference_subbatch(\n        transition_module,\n        self.global_config.subbatch_size,\n        batched_args=[act],\n        nonbatched_args=[],\n        low_memory=not is_training)\n\n    return act\n\n\ndef glorot_uniform():\n  return hk.initializers.VarianceScaling(scale=1.0,\n                                         mode='fan_avg',\n                                         distribution='uniform')\n\n\nclass Attention(hk.Module):\n  \"\"\"Multihead attention.\"\"\"\n\n  def __init__(self, config, global_config, output_dim, name='attention'):\n    super().__init__(name=name)\n\n    self.config = config\n    self.global_config = global_config\n    self.output_dim = output_dim\n\n  def __call__(self, q_data, m_data, bias, nonbatched_bias=None):\n    \"\"\"Builds Attention module.\n\n    Arguments:\n      q_data: A tensor of queries, shape [batch_size, N_queries, q_channels].\n      m_data: A tensor of memories from which the keys and values are\n        projected, shape [batch_size, N_keys, m_channels].\n      bias: A bias for the attention, shape [batch_size, N_queries, N_keys].\n      nonbatched_bias: Shared bias, shape [N_queries, N_keys].\n\n    Returns:\n      A float32 tensor of shape [batch_size, N_queries, output_dim].\n    \"\"\"\n    # Sensible default for when the config keys are missing\n    key_dim = self.config.get('key_dim', int(q_data.shape[-1]))\n    value_dim = self.config.get('value_dim', int(m_data.shape[-1]))\n    num_head = self.config.num_head\n    assert key_dim % num_head == 0\n    assert value_dim % num_head == 0\n    key_dim = key_dim // num_head\n    value_dim = value_dim // num_head\n\n    q_weights = hk.get_parameter(\n        'query_w', shape=(q_data.shape[-1], num_head, key_dim),\n        dtype=q_data.dtype,\n        init=glorot_uniform())\n    k_weights = hk.get_parameter(\n        'key_w', shape=(m_data.shape[-1], num_head, key_dim),\n        dtype=q_data.dtype,\n        init=glorot_uniform())\n    v_weights = hk.get_parameter(\n        'value_w', shape=(m_data.shape[-1], num_head, value_dim),\n        dtype=q_data.dtype,\n        init=glorot_uniform())\n\n    q = jnp.einsum('bqa,ahc->bqhc', q_data, q_weights) * key_dim**(-0.5)\n    k = jnp.einsum('bka,ahc->bkhc', m_data, k_weights)\n    v = jnp.einsum('bka,ahc->bkhc', m_data, v_weights)\n    logits = jnp.einsum('bqhc,bkhc->bhqk', q, k) + bias\n    if nonbatched_bias is not None:\n      logits += jnp.expand_dims(nonbatched_bias, axis=0)\n    weights = jax.nn.softmax(logits)\n    weighted_avg = jnp.einsum('bhqk,bkhc->bqhc', weights, v)\n\n    if self.global_config.zero_init:\n      init = hk.initializers.Constant(0.0)\n    else:\n      init = glorot_uniform()\n\n    if self.config.gating:\n      gating_weights = hk.get_parameter(\n          'gating_w',\n          shape=(q_data.shape[-1], num_head, value_dim),\n          dtype=q_data.dtype,\n          init=hk.initializers.Constant(0.0))\n      gating_bias = hk.get_parameter(\n          'gating_b',\n          shape=(num_head, value_dim),\n          dtype=q_data.dtype,\n          init=hk.initializers.Constant(1.0))\n\n      gate_values = jnp.einsum('bqc, chv->bqhv', q_data,\n                               gating_weights) + gating_bias\n\n      gate_values = jax.nn.sigmoid(gate_values)\n\n      weighted_avg *= gate_values\n\n    o_weights = hk.get_parameter(\n        'output_w', shape=(num_head, value_dim, self.output_dim),\n        dtype=q_data.dtype,\n        init=init)\n    o_bias = hk.get_parameter(\n        'output_b', shape=(self.output_dim,),\n        dtype=q_data.dtype,\n        init=hk.initializers.Constant(0.0))\n\n    output = jnp.einsum('bqhc,hco->bqo', weighted_avg, o_weights) + o_bias\n\n    return output\n\n\nclass GlobalAttention(hk.Module):\n  \"\"\"Global attention.\n\n  Jumper et al. (2021) Suppl. Alg. 19 \"MSAColumnGlobalAttention\" lines 2-7\n  \"\"\"\n\n  def __init__(self, config, global_config, output_dim, name='attention'):\n    super().__init__(name=name)\n\n    self.config = config\n    self.global_config = global_config\n    self.output_dim = output_dim\n\n  def __call__(self, q_data, m_data, q_mask):\n    \"\"\"Builds GlobalAttention module.\n\n    Arguments:\n      q_data: A tensor of queries with size [batch_size, N_queries,\n        q_channels]\n      m_data: A tensor of memories from which the keys and values\n        projected. Size [batch_size, N_keys, m_channels]\n      q_mask: A binary mask for q_data with zeros in the padded sequence\n        elements and ones otherwise. Size [batch_size, N_queries, q_channels]\n        (or broadcastable to this shape).\n\n    Returns:\n      A float32 tensor of size [batch_size, N_queries, output_dim].\n    \"\"\"\n    # Sensible default for when the config keys are missing\n    key_dim = self.config.get('key_dim', int(q_data.shape[-1]))\n    value_dim = self.config.get('value_dim', int(m_data.shape[-1]))\n    num_head = self.config.num_head\n    assert key_dim % num_head == 0\n    assert value_dim % num_head == 0\n    key_dim = key_dim // num_head\n    value_dim = value_dim // num_head\n\n    q_weights = hk.get_parameter(\n        'query_w', shape=(q_data.shape[-1], num_head, key_dim),\n        dtype=q_data.dtype,\n        init=glorot_uniform())\n    k_weights = hk.get_parameter(\n        'key_w', shape=(m_data.shape[-1], key_dim),\n        dtype=q_data.dtype,\n        init=glorot_uniform())\n    v_weights = hk.get_parameter(\n        'value_w', shape=(m_data.shape[-1], value_dim),\n        dtype=q_data.dtype,\n        init=glorot_uniform())\n\n    v = jnp.einsum('bka,ac->bkc', m_data, v_weights)\n\n    q_avg = utils.mask_mean(q_mask, q_data, axis=1)\n\n    q = jnp.einsum('ba,ahc->bhc', q_avg, q_weights) * key_dim**(-0.5)\n    k = jnp.einsum('bka,ac->bkc', m_data, k_weights)\n    bias = (1e9 * (q_mask[:, None, :, 0] - 1.))\n    logits = jnp.einsum('bhc,bkc->bhk', q, k) + bias\n    weights = jax.nn.softmax(logits)\n    weighted_avg = jnp.einsum('bhk,bkc->bhc', weights, v)\n\n    if self.global_config.zero_init:\n      init = hk.initializers.Constant(0.0)\n    else:\n      init = glorot_uniform()\n\n    o_weights = hk.get_parameter(\n        'output_w', shape=(num_head, value_dim, self.output_dim),\n        dtype=q_data.dtype,\n        init=init)\n    o_bias = hk.get_parameter(\n        'output_b', shape=(self.output_dim,),\n        dtype=q_data.dtype,\n        init=hk.initializers.Constant(0.0))\n\n    if self.config.gating:\n      gating_weights = hk.get_parameter(\n          'gating_w',\n          shape=(q_data.shape[-1], num_head, value_dim),\n          dtype=q_data.dtype,\n          init=hk.initializers.Constant(0.0))\n      gating_bias = hk.get_parameter(\n          'gating_b',\n          shape=(num_head, value_dim),\n          dtype=q_data.dtype,\n          init=hk.initializers.Constant(1.0))\n\n      gate_values = jnp.einsum('bqc, chv->bqhv', q_data, gating_weights)\n      gate_values = jax.nn.sigmoid(gate_values + gating_bias)\n      weighted_avg = weighted_avg[:, None] * gate_values\n      output = jnp.einsum('bqhc,hco->bqo', weighted_avg, o_weights) + o_bias\n    else:\n      output = jnp.einsum('bhc,hco->bo', weighted_avg, o_weights) + o_bias\n      output = output[:, None]\n    return output\n\n\nclass MSARowAttentionWithPairBias(hk.Module):\n  \"\"\"MSA per-row attention biased by the pair representation.\n\n  Jumper et al. (2021) Suppl. Alg. 7 \"MSARowAttentionWithPairBias\"\n  \"\"\"\n\n  def __init__(self, config, global_config,\n               name='msa_row_attention_with_pair_bias'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               msa_act,\n               msa_mask,\n               pair_act,\n               is_training=False):\n    \"\"\"Builds MSARowAttentionWithPairBias module.\n\n    Arguments:\n      msa_act: [N_seq, N_res, c_m] MSA representation.\n      msa_mask: [N_seq, N_res] mask of non-padded regions.\n      pair_act: [N_res, N_res, c_z] pair representation.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Update to msa_act, shape [N_seq, N_res, c_m].\n    \"\"\"\n    c = self.config\n\n    assert len(msa_act.shape) == 3\n    assert len(msa_mask.shape) == 2\n    assert c.orientation == 'per_row'\n\n    bias = (1e9 * (msa_mask - 1.))[:, None, None, :]\n    assert len(bias.shape) == 4\n\n    msa_act = common_modules.LayerNorm(\n        axis=[-1], create_scale=True, create_offset=True, name='query_norm')(\n            msa_act)\n\n    pair_act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='feat_2d_norm')(\n            pair_act)\n\n    init_factor = 1. / jnp.sqrt(int(pair_act.shape[-1]))\n    weights = hk.get_parameter(\n        'feat_2d_weights',\n        shape=(pair_act.shape[-1], c.num_head),\n        dtype=msa_act.dtype,\n        init=hk.initializers.RandomNormal(stddev=init_factor))\n    nonbatched_bias = jnp.einsum('qkc,ch->hqk', pair_act, weights)\n\n    attn_mod = Attention(\n        c, self.global_config, msa_act.shape[-1])\n    msa_act = mapping.inference_subbatch(\n        attn_mod,\n        self.global_config.subbatch_size,\n        batched_args=[msa_act, msa_act, bias],\n        nonbatched_args=[nonbatched_bias],\n        low_memory=not is_training)\n\n    return msa_act\n\n\nclass MSAColumnAttention(hk.Module):\n  \"\"\"MSA per-column attention.\n\n  Jumper et al. (2021) Suppl. Alg. 8 \"MSAColumnAttention\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='msa_column_attention'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               msa_act,\n               msa_mask,\n               is_training=False):\n    \"\"\"Builds MSAColumnAttention module.\n\n    Arguments:\n      msa_act: [N_seq, N_res, c_m] MSA representation.\n      msa_mask: [N_seq, N_res] mask of non-padded regions.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Update to msa_act, shape [N_seq, N_res, c_m]\n    \"\"\"\n    c = self.config\n\n    assert len(msa_act.shape) == 3\n    assert len(msa_mask.shape) == 2\n    assert c.orientation == 'per_column'\n\n    msa_act = jnp.swapaxes(msa_act, -2, -3)\n    msa_mask = jnp.swapaxes(msa_mask, -1, -2)\n\n    bias = (1e9 * (msa_mask - 1.))[:, None, None, :]\n    assert len(bias.shape) == 4\n\n    msa_act = common_modules.LayerNorm(\n        axis=[-1], create_scale=True, create_offset=True, name='query_norm')(\n            msa_act)\n\n    attn_mod = Attention(\n        c, self.global_config, msa_act.shape[-1])\n    msa_act = mapping.inference_subbatch(\n        attn_mod,\n        self.global_config.subbatch_size,\n        batched_args=[msa_act, msa_act, bias],\n        nonbatched_args=[],\n        low_memory=not is_training)\n\n    msa_act = jnp.swapaxes(msa_act, -2, -3)\n\n    return msa_act\n\n\nclass MSAColumnGlobalAttention(hk.Module):\n  \"\"\"MSA per-column global attention.\n\n  Jumper et al. (2021) Suppl. Alg. 19 \"MSAColumnGlobalAttention\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='msa_column_global_attention'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               msa_act,\n               msa_mask,\n               is_training=False):\n    \"\"\"Builds MSAColumnGlobalAttention module.\n\n    Arguments:\n      msa_act: [N_seq, N_res, c_m] MSA representation.\n      msa_mask: [N_seq, N_res] mask of non-padded regions.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Update to msa_act, shape [N_seq, N_res, c_m].\n    \"\"\"\n    c = self.config\n\n    assert len(msa_act.shape) == 3\n    assert len(msa_mask.shape) == 2\n    assert c.orientation == 'per_column'\n\n    msa_act = jnp.swapaxes(msa_act, -2, -3)\n    msa_mask = jnp.swapaxes(msa_mask, -1, -2)\n\n    bias = (1e9 * (msa_mask - 1.))[:, None, None, :]\n    assert len(bias.shape) == 4\n\n    msa_act = common_modules.LayerNorm(\n        axis=[-1], create_scale=True, create_offset=True, name='query_norm')(\n            msa_act)\n\n    attn_mod = GlobalAttention(\n        c, self.global_config, msa_act.shape[-1],\n        name='attention')\n    # [N_seq, N_res, 1]\n    msa_mask = jnp.expand_dims(msa_mask, axis=-1)\n    msa_act = mapping.inference_subbatch(\n        attn_mod,\n        self.global_config.subbatch_size,\n        batched_args=[msa_act, msa_act, msa_mask],\n        nonbatched_args=[],\n        low_memory=not is_training)\n\n    msa_act = jnp.swapaxes(msa_act, -2, -3)\n\n    return msa_act\n\n\nclass TriangleAttention(hk.Module):\n  \"\"\"Triangle Attention.\n\n  Jumper et al. (2021) Suppl. Alg. 13 \"TriangleAttentionStartingNode\"\n  Jumper et al. (2021) Suppl. Alg. 14 \"TriangleAttentionEndingNode\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='triangle_attention'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, pair_act, pair_mask, is_training=False):\n    \"\"\"Builds TriangleAttention module.\n\n    Arguments:\n      pair_act: [N_res, N_res, c_z] pair activations tensor\n      pair_mask: [N_res, N_res] mask of non-padded regions in the tensor.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Update to pair_act, shape [N_res, N_res, c_z].\n    \"\"\"\n    c = self.config\n\n    assert len(pair_act.shape) == 3\n    assert len(pair_mask.shape) == 2\n    assert c.orientation in ['per_row', 'per_column']\n\n    if c.orientation == 'per_column':\n      pair_act = jnp.swapaxes(pair_act, -2, -3)\n      pair_mask = jnp.swapaxes(pair_mask, -1, -2)\n\n    bias = (1e9 * (pair_mask - 1.))[:, None, None, :]\n    assert len(bias.shape) == 4\n\n    pair_act = common_modules.LayerNorm(\n        axis=[-1], create_scale=True, create_offset=True, name='query_norm')(\n            pair_act)\n\n    init_factor = 1. / jnp.sqrt(int(pair_act.shape[-1]))\n    weights = hk.get_parameter(\n        'feat_2d_weights',\n        shape=(pair_act.shape[-1], c.num_head),\n        dtype=pair_act.dtype,\n        init=hk.initializers.RandomNormal(stddev=init_factor))\n    nonbatched_bias = jnp.einsum('qkc,ch->hqk', pair_act, weights)\n\n    attn_mod = Attention(\n        c, self.global_config, pair_act.shape[-1])\n    pair_act = mapping.inference_subbatch(\n        attn_mod,\n        self.global_config.subbatch_size,\n        batched_args=[pair_act, pair_act, bias],\n        nonbatched_args=[nonbatched_bias],\n        low_memory=not is_training)\n\n    if c.orientation == 'per_column':\n      pair_act = jnp.swapaxes(pair_act, -2, -3)\n\n    return pair_act\n\n\nclass MaskedMsaHead(hk.Module):\n  \"\"\"Head to predict MSA at the masked locations.\n\n  The MaskedMsaHead employs a BERT-style objective to reconstruct a masked\n  version of the full MSA, based on a linear projection of\n  the MSA representation.\n  Jumper et al. (2021) Suppl. Sec. 1.9.9 \"Masked MSA prediction\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='masked_msa_head'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n    if global_config.multimer_mode:\n      self.num_output = len(residue_constants.restypes_with_x_and_gap)\n    else:\n      self.num_output = config.num_output\n\n  def __call__(self, representations, batch, is_training):\n    \"\"\"Builds MaskedMsaHead module.\n\n    Arguments:\n      representations: Dictionary of representations, must contain:\n        * 'msa': MSA representation, shape [N_seq, N_res, c_m].\n      batch: Batch, unused.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Dictionary containing:\n        * 'logits': logits of shape [N_seq, N_res, N_aatype] with\n            (unnormalized) log probabilies of predicted aatype at position.\n    \"\"\"\n    del batch\n    logits = common_modules.Linear(\n        self.num_output,\n        initializer=utils.final_init(self.global_config),\n        name='logits')(\n            representations['msa'])\n    return dict(logits=logits)\n\n  def loss(self, value, batch):\n    errors = softmax_cross_entropy(\n        labels=jax.nn.one_hot(batch['true_msa'], num_classes=self.num_output),\n        logits=value['logits'])\n    loss = (jnp.sum(errors * batch['bert_mask'], axis=(-2, -1)) /\n            (1e-8 + jnp.sum(batch['bert_mask'], axis=(-2, -1))))\n    return {'loss': loss}\n\n\nclass PredictedLDDTHead(hk.Module):\n  \"\"\"Head to predict the per-residue LDDT to be used as a confidence measure.\n\n  Jumper et al. (2021) Suppl. Sec. 1.9.6 \"Model confidence prediction (pLDDT)\"\n  Jumper et al. (2021) Suppl. Alg. 29 \"predictPerResidueLDDT_Ca\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='predicted_lddt_head'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, representations, batch, is_training):\n    \"\"\"Builds PredictedLDDTHead module.\n\n    Arguments:\n      representations: Dictionary of representations, must contain:\n        * 'structure_module': Single representation from the structure module,\n             shape [N_res, c_s].\n      batch: Batch, unused.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Dictionary containing :\n        * 'logits': logits of shape [N_res, N_bins] with\n            (unnormalized) log probabilies of binned predicted lDDT.\n    \"\"\"\n    act = representations['structure_module']\n\n    act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='input_layer_norm')(\n            act)\n\n    act = common_modules.Linear(\n        self.config.num_channels,\n        initializer='relu',\n        name='act_0')(\n            act)\n    act = jax.nn.relu(act)\n\n    act = common_modules.Linear(\n        self.config.num_channels,\n        initializer='relu',\n        name='act_1')(\n            act)\n    act = jax.nn.relu(act)\n\n    logits = common_modules.Linear(\n        self.config.num_bins,\n        initializer=utils.final_init(self.global_config),\n        name='logits')(\n            act)\n    # Shape (batch_size, num_res, num_bins)\n    return dict(logits=logits)\n\n  def loss(self, value, batch):\n    # Shape (num_res, 37, 3)\n    pred_all_atom_pos = value['structure_module']['final_atom_positions']\n    # Shape (num_res, 37, 3)\n    true_all_atom_pos = batch['all_atom_positions']\n    # Shape (num_res, 37)\n    all_atom_mask = batch['all_atom_mask']\n\n    # Shape (num_res,)\n    lddt_ca = lddt.lddt(\n        # Shape (batch_size, num_res, 3)\n        predicted_points=pred_all_atom_pos[None, :, 1, :],\n        # Shape (batch_size, num_res, 3)\n        true_points=true_all_atom_pos[None, :, 1, :],\n        # Shape (batch_size, num_res, 1)\n        true_points_mask=all_atom_mask[None, :, 1:2].astype(jnp.float32),\n        cutoff=15.,\n        per_residue=True)\n    lddt_ca = jax.lax.stop_gradient(lddt_ca)\n\n    num_bins = self.config.num_bins\n    bin_index = jnp.floor(lddt_ca * num_bins).astype(jnp.int32)\n\n    # protect against out of range for lddt_ca == 1\n    bin_index = jnp.minimum(bin_index, num_bins - 1)\n    lddt_ca_one_hot = jax.nn.one_hot(bin_index, num_classes=num_bins)\n\n    # Shape (num_res, num_channel)\n    logits = value['predicted_lddt']['logits']\n    errors = softmax_cross_entropy(labels=lddt_ca_one_hot, logits=logits)\n\n    # Shape (num_res,)\n    mask_ca = all_atom_mask[:, residue_constants.atom_order['CA']]\n    mask_ca = mask_ca.astype(jnp.float32)\n    loss = jnp.sum(errors * mask_ca) / (jnp.sum(mask_ca) + 1e-8)\n\n    if self.config.filter_by_resolution:\n      # NMR & distillation have resolution = 0\n      loss *= ((batch['resolution'] >= self.config.min_resolution)\n               & (batch['resolution'] <= self.config.max_resolution)).astype(\n                   jnp.float32)\n\n    output = {'loss': loss}\n    return output\n\n\nclass PredictedAlignedErrorHead(hk.Module):\n  \"\"\"Head to predict the distance errors in the backbone alignment frames.\n\n  Can be used to compute predicted TM-Score.\n  Jumper et al. (2021) Suppl. Sec. 1.9.7 \"TM-score prediction\"\n  \"\"\"\n\n  def __init__(self, config, global_config,\n               name='predicted_aligned_error_head'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, representations, batch, is_training):\n    \"\"\"Builds PredictedAlignedErrorHead module.\n\n    Arguments:\n      representations: Dictionary of representations, must contain:\n        * 'pair': pair representation, shape [N_res, N_res, c_z].\n      batch: Batch, unused.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Dictionary containing:\n        * logits: logits for aligned error, shape [N_res, N_res, N_bins].\n        * bin_breaks: array containing bin breaks, shape [N_bins - 1].\n    \"\"\"\n\n    act = representations['pair']\n\n    # Shape (num_res, num_res, num_bins)\n    logits = common_modules.Linear(\n        self.config.num_bins,\n        initializer=utils.final_init(self.global_config),\n        name='logits')(act)\n    # Shape (num_bins,)\n    breaks = jnp.linspace(\n        0., self.config.max_error_bin, self.config.num_bins - 1)\n    return dict(logits=logits, breaks=breaks)\n\n  def loss(self, value, batch):\n    # Shape (num_res, 7)\n    predicted_affine = quat_affine.QuatAffine.from_tensor(\n        value['structure_module']['final_affines'])\n    # Shape (num_res, 7)\n    true_affine = quat_affine.QuatAffine.from_tensor(\n        batch['backbone_affine_tensor'])\n    # Shape (num_res)\n    mask = batch['backbone_affine_mask']\n    # Shape (num_res, num_res)\n    square_mask = mask[:, None] * mask[None, :]\n    num_bins = self.config.num_bins\n    # (1, num_bins - 1)\n    breaks = value['predicted_aligned_error']['breaks']\n    # (1, num_bins)\n    logits = value['predicted_aligned_error']['logits']\n\n    # Compute the squared error for each alignment.\n    def _local_frame_points(affine):\n      points = [jnp.expand_dims(x, axis=-2) for x in affine.translation]\n      return affine.invert_point(points, extra_dims=1)\n    error_dist2_xyz = [\n        jnp.square(a - b)\n        for a, b in zip(_local_frame_points(predicted_affine),\n                        _local_frame_points(true_affine))]\n    error_dist2 = sum(error_dist2_xyz)\n    # Shape (num_res, num_res)\n    # First num_res are alignment frames, second num_res are the residues.\n    error_dist2 = jax.lax.stop_gradient(error_dist2)\n\n    sq_breaks = jnp.square(breaks)\n    true_bins = jnp.sum((\n        error_dist2[..., None] > sq_breaks).astype(jnp.int32), axis=-1)\n\n    errors = softmax_cross_entropy(\n        labels=jax.nn.one_hot(true_bins, num_bins, axis=-1), logits=logits)\n\n    loss = (jnp.sum(errors * square_mask, axis=(-2, -1)) /\n            (1e-8 + jnp.sum(square_mask, axis=(-2, -1))))\n\n    if self.config.filter_by_resolution:\n      # NMR & distillation have resolution = 0\n      loss *= ((batch['resolution'] >= self.config.min_resolution)\n               & (batch['resolution'] <= self.config.max_resolution)).astype(\n                   jnp.float32)\n\n    output = {'loss': loss}\n    return output\n\n\nclass ExperimentallyResolvedHead(hk.Module):\n  \"\"\"Predicts if an atom is experimentally resolved in a high-res structure.\n\n  Only trained on high-resolution X-ray crystals & cryo-EM.\n  Jumper et al. (2021) Suppl. Sec. 1.9.10 '\"Experimentally resolved\" prediction'\n  \"\"\"\n\n  def __init__(self, config, global_config,\n               name='experimentally_resolved_head'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, representations, batch, is_training):\n    \"\"\"Builds ExperimentallyResolvedHead module.\n\n    Arguments:\n      representations: Dictionary of representations, must contain:\n        * 'single': Single representation, shape [N_res, c_s].\n      batch: Batch, unused.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Dictionary containing:\n        * 'logits': logits of shape [N_res, 37],\n            log probability that an atom is resolved in atom37 representation,\n            can be converted to probability by applying sigmoid.\n    \"\"\"\n    logits = common_modules.Linear(\n        37,  # atom_exists.shape[-1]\n        initializer=utils.final_init(self.global_config),\n        name='logits')(representations['single'])\n    return dict(logits=logits)\n\n  def loss(self, value, batch):\n    logits = value['logits']\n    assert len(logits.shape) == 2\n\n    # Does the atom appear in the amino acid?\n    atom_exists = batch['atom37_atom_exists']\n    # Is the atom resolved in the experiment? Subset of atom_exists,\n    # *except for OXT*\n    all_atom_mask = batch['all_atom_mask'].astype(jnp.float32)\n\n    xent = sigmoid_cross_entropy(labels=all_atom_mask, logits=logits)\n    loss = jnp.sum(xent * atom_exists) / (1e-8 + jnp.sum(atom_exists))\n\n    if self.config.filter_by_resolution:\n      # NMR & distillation examples have resolution = 0.\n      loss *= ((batch['resolution'] >= self.config.min_resolution)\n               & (batch['resolution'] <= self.config.max_resolution)).astype(\n                   jnp.float32)\n\n    output = {'loss': loss}\n    return output\n\n\ndef _layer_norm(axis=-1, name='layer_norm'):\n  return common_modules.LayerNorm(\n      axis=axis,\n      create_scale=True,\n      create_offset=True,\n      eps=1e-5,\n      use_fast_variance=True,\n      scale_init=hk.initializers.Constant(1.),\n      offset_init=hk.initializers.Constant(0.),\n      param_axis=axis,\n      name=name)\n\n\nclass TriangleMultiplication(hk.Module):\n  \"\"\"Triangle multiplication layer (\"outgoing\" or \"incoming\").\n\n  Jumper et al. (2021) Suppl. Alg. 11 \"TriangleMultiplicationOutgoing\"\n  Jumper et al. (2021) Suppl. Alg. 12 \"TriangleMultiplicationIncoming\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='triangle_multiplication'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, left_act, left_mask, is_training=True):\n    \"\"\"Builds TriangleMultiplication module.\n\n    Arguments:\n      left_act: Pair activations, shape [N_res, N_res, c_z]\n      left_mask: Pair mask, shape [N_res, N_res].\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Outputs, same shape/type as left_act.\n    \"\"\"\n    del is_training\n\n    if self.config.fuse_projection_weights:\n      return self._fused_triangle_multiplication(left_act, left_mask)\n    else:\n      return self._triangle_multiplication(left_act, left_mask)\n\n  @hk.transparent\n  def _triangle_multiplication(self, left_act, left_mask):\n    \"\"\"Implementation of TriangleMultiplication used in AF2 and AF-M<2.3.\"\"\"\n    c = self.config\n    gc = self.global_config\n\n    mask = left_mask[..., None]\n\n    act = common_modules.LayerNorm(axis=[-1], create_scale=True, create_offset=True,\n                       name='layer_norm_input')(left_act)\n    input_act = act\n\n    left_projection = common_modules.Linear(\n        c.num_intermediate_channel,\n        name='left_projection')\n    left_proj_act = mask * left_projection(act)\n\n    right_projection = common_modules.Linear(\n        c.num_intermediate_channel,\n        name='right_projection')\n    right_proj_act = mask * right_projection(act)\n\n    left_gate_values = jax.nn.sigmoid(common_modules.Linear(\n        c.num_intermediate_channel,\n        bias_init=1.,\n        initializer=utils.final_init(gc),\n        name='left_gate')(act))\n\n    right_gate_values = jax.nn.sigmoid(common_modules.Linear(\n        c.num_intermediate_channel,\n        bias_init=1.,\n        initializer=utils.final_init(gc),\n        name='right_gate')(act))\n\n    left_proj_act *= left_gate_values\n    right_proj_act *= right_gate_values\n\n    # \"Outgoing\" edges equation: 'ikc,jkc->ijc'\n    # \"Incoming\" edges equation: 'kjc,kic->ijc'\n    # Note on the Suppl. Alg. 11 & 12 notation:\n    # For the \"outgoing\" edges, a = left_proj_act and b = right_proj_act\n    # For the \"incoming\" edges, it's swapped:\n    #   b = left_proj_act and a = right_proj_act\n    act = jnp.einsum(c.equation, left_proj_act, right_proj_act)\n\n    act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='center_layer_norm')(\n            act)\n\n    output_channel = int(input_act.shape[-1])\n\n    act = common_modules.Linear(\n        output_channel,\n        initializer=utils.final_init(gc),\n        name='output_projection')(act)\n\n    gate_values = jax.nn.sigmoid(common_modules.Linear(\n        output_channel,\n        bias_init=1.,\n        initializer=utils.final_init(gc),\n        name='gating_linear')(input_act))\n    act *= gate_values\n\n    return act\n\n  @hk.transparent\n  def _fused_triangle_multiplication(self, left_act, left_mask):\n    \"\"\"TriangleMultiplication with fused projection weights.\"\"\"\n    mask = left_mask[..., None]\n    c = self.config\n    gc = self.global_config\n\n    left_act = _layer_norm(axis=-1, name='left_norm_input')(left_act)\n\n    # Both left and right projections are fused into projection.\n    projection = common_modules.Linear(\n        2*c.num_intermediate_channel, name='projection')\n    proj_act = mask * projection(left_act)\n\n    # Both left + right gate are fused into gate_values.\n    gate_values = common_modules.Linear(\n        2 * c.num_intermediate_channel,\n        name='gate',\n        bias_init=1.,\n        initializer=utils.final_init(gc))(left_act)\n    proj_act *= jax.nn.sigmoid(gate_values)\n\n    left_proj_act = proj_act[:, :, :c.num_intermediate_channel]\n    right_proj_act = proj_act[:, :, c.num_intermediate_channel:]\n    act = jnp.einsum(c.equation, left_proj_act, right_proj_act)\n\n    act = _layer_norm(axis=-1, name='center_norm')(act)\n\n    output_channel = int(left_act.shape[-1])\n\n    act = common_modules.Linear(\n        output_channel,\n        initializer=utils.final_init(gc),\n        name='output_projection')(act)\n\n    gate_values = common_modules.Linear(\n        output_channel,\n        bias_init=1.,\n        initializer=utils.final_init(gc),\n        name='gating_linear')(left_act)\n    act *= jax.nn.sigmoid(gate_values)\n\n    return act\n\n\nclass DistogramHead(hk.Module):\n  \"\"\"Head to predict a distogram.\n\n  Jumper et al. (2021) Suppl. Sec. 1.9.8 \"Distogram prediction\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='distogram_head'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, representations, batch, is_training):\n    \"\"\"Builds DistogramHead module.\n\n    Arguments:\n      representations: Dictionary of representations, must contain:\n        * 'pair': pair representation, shape [N_res, N_res, c_z].\n      batch: Batch, unused.\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Dictionary containing:\n        * logits: logits for distogram, shape [N_res, N_res, N_bins].\n        * bin_breaks: array containing bin breaks, shape [N_bins - 1,].\n    \"\"\"\n    half_logits = common_modules.Linear(\n        self.config.num_bins,\n        initializer=utils.final_init(self.global_config),\n        name='half_logits')(\n            representations['pair'])\n\n    logits = half_logits + jnp.swapaxes(half_logits, -2, -3)\n    breaks = jnp.linspace(self.config.first_break, self.config.last_break,\n                          self.config.num_bins - 1)\n\n    return dict(logits=logits, bin_edges=breaks)\n\n  def loss(self, value, batch):\n    return _distogram_log_loss(value['logits'], value['bin_edges'],\n                               batch, self.config.num_bins)\n\n\ndef _distogram_log_loss(logits, bin_edges, batch, num_bins):\n  \"\"\"Log loss of a distogram.\"\"\"\n\n  assert len(logits.shape) == 3\n  positions = batch['pseudo_beta']\n  mask = batch['pseudo_beta_mask']\n\n  assert positions.shape[-1] == 3\n\n  sq_breaks = jnp.square(bin_edges)\n\n  dist2 = jnp.sum(\n      jnp.square(\n          jnp.expand_dims(positions, axis=-2) -\n          jnp.expand_dims(positions, axis=-3)),\n      axis=-1,\n      keepdims=True)\n\n  true_bins = jnp.sum(dist2 > sq_breaks, axis=-1)\n\n  errors = softmax_cross_entropy(\n      labels=jax.nn.one_hot(true_bins, num_bins), logits=logits)\n\n  square_mask = jnp.expand_dims(mask, axis=-2) * jnp.expand_dims(mask, axis=-1)\n\n  avg_error = (\n      jnp.sum(errors * square_mask, axis=(-2, -1)) /\n      (1e-6 + jnp.sum(square_mask, axis=(-2, -1))))\n  dist2 = dist2[..., 0]\n  return dict(loss=avg_error, true_dist=jnp.sqrt(1e-6 + dist2))\n\n\nclass OuterProductMean(hk.Module):\n  \"\"\"Computes mean outer product.\n\n  Jumper et al. (2021) Suppl. Alg. 10 \"OuterProductMean\"\n  \"\"\"\n\n  def __init__(self,\n               config,\n               global_config,\n               num_output_channel,\n               name='outer_product_mean'):\n    super().__init__(name=name)\n    self.global_config = global_config\n    self.config = config\n    self.num_output_channel = num_output_channel\n\n  def __call__(self, act, mask, is_training=True):\n    \"\"\"Builds OuterProductMean module.\n\n    Arguments:\n      act: MSA representation, shape [N_seq, N_res, c_m].\n      mask: MSA mask, shape [N_seq, N_res].\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      Update to pair representation, shape [N_res, N_res, c_z].\n    \"\"\"\n    gc = self.global_config\n    c = self.config\n\n    mask = mask[..., None]\n    act = common_modules.LayerNorm([-1], True, True, name='layer_norm_input')(act)\n\n    left_act = mask * common_modules.Linear(\n        c.num_outer_channel,\n        initializer='linear',\n        name='left_projection')(\n            act)\n\n    right_act = mask * common_modules.Linear(\n        c.num_outer_channel,\n        initializer='linear',\n        name='right_projection')(\n            act)\n\n    if gc.zero_init:\n      init_w = hk.initializers.Constant(0.0)\n    else:\n      init_w = hk.initializers.VarianceScaling(scale=2., mode='fan_in')\n\n    output_w = hk.get_parameter(\n        'output_w',\n        shape=(c.num_outer_channel, c.num_outer_channel,\n               self.num_output_channel),\n        dtype=act.dtype,\n        init=init_w)\n    output_b = hk.get_parameter(\n        'output_b', shape=(self.num_output_channel,),\n        dtype=act.dtype,\n        init=hk.initializers.Constant(0.0))\n\n    def compute_chunk(left_act):\n      # This is equivalent to\n      #\n      # act = jnp.einsum('abc,ade->dceb', left_act, right_act)\n      # act = jnp.einsum('dceb,cef->bdf', act, output_w) + output_b\n      #\n      # but faster.\n      left_act = jnp.transpose(left_act, [0, 2, 1])\n      act = jnp.einsum('acb,ade->dceb', left_act, right_act)\n      act = jnp.einsum('dceb,cef->dbf', act, output_w) + output_b\n      return jnp.transpose(act, [1, 0, 2])\n\n    act = mapping.inference_subbatch(\n        compute_chunk,\n        c.chunk_size,\n        batched_args=[left_act],\n        nonbatched_args=[],\n        low_memory=True,\n        input_subbatch_dim=1,\n        output_subbatch_dim=0)\n\n    epsilon = 1e-3\n    norm = jnp.einsum('abc,adc->bdc', mask, mask)\n    act /= epsilon + norm\n\n    return act\n\n\ndef dgram_from_positions(positions, num_bins, min_bin, max_bin):\n  \"\"\"Compute distogram from amino acid positions.\n\n  Arguments:\n    positions: [N_res, 3] Position coordinates.\n    num_bins: The number of bins in the distogram.\n    min_bin: The left edge of the first bin.\n    max_bin: The left edge of the final bin. The final bin catches\n        everything larger than `max_bin`.\n\n  Returns:\n    Distogram with the specified number of bins.\n  \"\"\"\n\n  def squared_difference(x, y):\n    return jnp.square(x - y)\n\n  lower_breaks = jnp.linspace(min_bin, max_bin, num_bins)\n  lower_breaks = jnp.square(lower_breaks)\n  upper_breaks = jnp.concatenate([lower_breaks[1:],\n                                  jnp.array([1e8], dtype=jnp.float32)], axis=-1)\n  dist2 = jnp.sum(\n      squared_difference(\n          jnp.expand_dims(positions, axis=-2),\n          jnp.expand_dims(positions, axis=-3)),\n      axis=-1, keepdims=True)\n\n  dgram = ((dist2 > lower_breaks).astype(jnp.float32) *\n           (dist2 < upper_breaks).astype(jnp.float32))\n  return dgram\n\n\ndef pseudo_beta_fn(aatype, all_atom_positions, all_atom_masks):\n  \"\"\"Create pseudo beta features.\"\"\"\n\n  is_gly = jnp.equal(aatype, residue_constants.restype_order['G'])\n  ca_idx = residue_constants.atom_order['CA']\n  cb_idx = residue_constants.atom_order['CB']\n  pseudo_beta = jnp.where(\n      jnp.tile(is_gly[..., None], [1] * len(is_gly.shape) + [3]),\n      all_atom_positions[..., ca_idx, :],\n      all_atom_positions[..., cb_idx, :])\n\n  if all_atom_masks is not None:\n    pseudo_beta_mask = jnp.where(\n        is_gly, all_atom_masks[..., ca_idx], all_atom_masks[..., cb_idx])\n    pseudo_beta_mask = pseudo_beta_mask.astype(jnp.float32)\n    return pseudo_beta, pseudo_beta_mask\n  else:\n    return pseudo_beta\n\n\nclass EvoformerIteration(hk.Module):\n  \"\"\"Single iteration (block) of Evoformer stack.\n\n  Jumper et al. (2021) Suppl. Alg. 6 \"EvoformerStack\" lines 2-10\n  \"\"\"\n\n  def __init__(self, config, global_config, is_extra_msa,\n               name='evoformer_iteration'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n    self.is_extra_msa = is_extra_msa\n\n  def __call__(self, activations, masks, is_training=True, safe_key=None):\n    \"\"\"Builds EvoformerIteration module.\n\n    Arguments:\n      activations: Dictionary containing activations:\n        * 'msa': MSA activations, shape [N_seq, N_res, c_m].\n        * 'pair': pair activations, shape [N_res, N_res, c_z].\n      masks: Dictionary of masks:\n        * 'msa': MSA mask, shape [N_seq, N_res].\n        * 'pair': pair mask, shape [N_res, N_res].\n      is_training: Whether the module is in training mode.\n      safe_key: prng.SafeKey encapsulating rng key.\n\n    Returns:\n      Outputs, same shape/type as act.\n    \"\"\"\n    c = self.config\n    gc = self.global_config\n\n    msa_act, pair_act = activations['msa'], activations['pair']\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    msa_mask, pair_mask = masks['msa'], masks['pair']\n\n    dropout_wrapper_fn = functools.partial(\n        dropout_wrapper,\n        is_training=is_training,\n        global_config=gc)\n\n    safe_key, *sub_keys = safe_key.split(10)\n    sub_keys = iter(sub_keys)\n\n    outer_module = OuterProductMean(\n        config=c.outer_product_mean,\n        global_config=self.global_config,\n        num_output_channel=int(pair_act.shape[-1]),\n        name='outer_product_mean')\n    if c.outer_product_mean.first:\n      pair_act = dropout_wrapper_fn(\n          outer_module,\n          msa_act,\n          msa_mask,\n          safe_key=next(sub_keys),\n          output_act=pair_act)\n\n    msa_act = dropout_wrapper_fn(\n        MSARowAttentionWithPairBias(\n            c.msa_row_attention_with_pair_bias, gc,\n            name='msa_row_attention_with_pair_bias'),\n        msa_act,\n        msa_mask,\n        safe_key=next(sub_keys),\n        pair_act=pair_act)\n\n    if not self.is_extra_msa:\n      attn_mod = MSAColumnAttention(\n          c.msa_column_attention, gc, name='msa_column_attention')\n    else:\n      attn_mod = MSAColumnGlobalAttention(\n          c.msa_column_attention, gc, name='msa_column_global_attention')\n    msa_act = dropout_wrapper_fn(\n        attn_mod,\n        msa_act,\n        msa_mask,\n        safe_key=next(sub_keys))\n\n    msa_act = dropout_wrapper_fn(\n        Transition(c.msa_transition, gc, name='msa_transition'),\n        msa_act,\n        msa_mask,\n        safe_key=next(sub_keys))\n\n    if not c.outer_product_mean.first:\n      pair_act = dropout_wrapper_fn(\n          outer_module,\n          msa_act,\n          msa_mask,\n          safe_key=next(sub_keys),\n          output_act=pair_act)\n\n    pair_act = dropout_wrapper_fn(\n        TriangleMultiplication(c.triangle_multiplication_outgoing, gc,\n                               name='triangle_multiplication_outgoing'),\n        pair_act,\n        pair_mask,\n        safe_key=next(sub_keys))\n    pair_act = dropout_wrapper_fn(\n        TriangleMultiplication(c.triangle_multiplication_incoming, gc,\n                               name='triangle_multiplication_incoming'),\n        pair_act,\n        pair_mask,\n        safe_key=next(sub_keys))\n\n    pair_act = dropout_wrapper_fn(\n        TriangleAttention(c.triangle_attention_starting_node, gc,\n                          name='triangle_attention_starting_node'),\n        pair_act,\n        pair_mask,\n        safe_key=next(sub_keys))\n    pair_act = dropout_wrapper_fn(\n        TriangleAttention(c.triangle_attention_ending_node, gc,\n                          name='triangle_attention_ending_node'),\n        pair_act,\n        pair_mask,\n        safe_key=next(sub_keys))\n\n    pair_act = dropout_wrapper_fn(\n        Transition(c.pair_transition, gc, name='pair_transition'),\n        pair_act,\n        pair_mask,\n        safe_key=next(sub_keys))\n\n    return {'msa': msa_act, 'pair': pair_act}\n\n\nclass EmbeddingsAndEvoformer(hk.Module):\n  \"\"\"Embeds the input data and runs Evoformer.\n\n  Produces the MSA, single and pair representations.\n  Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" line 5-18\n  \"\"\"\n\n  def __init__(self, config, global_config, name='evoformer'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, batch, is_training, safe_key=None):\n\n    c = self.config\n    gc = self.global_config\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    # Embed clustered MSA.\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" line 5\n    # Jumper et al. (2021) Suppl. Alg. 3 \"InputEmbedder\"\n    preprocess_1d = common_modules.Linear(\n        c.msa_channel, name='preprocess_1d')(\n            batch['target_feat'])\n\n    preprocess_msa = common_modules.Linear(\n        c.msa_channel, name='preprocess_msa')(\n            batch['msa_feat'])\n\n    msa_activations = jnp.expand_dims(preprocess_1d, axis=0) + preprocess_msa\n\n    left_single = common_modules.Linear(\n        c.pair_channel, name='left_single')(\n            batch['target_feat'])\n    right_single = common_modules.Linear(\n        c.pair_channel, name='right_single')(\n            batch['target_feat'])\n    pair_activations = left_single[:, None] + right_single[None]\n    mask_2d = batch['seq_mask'][:, None] * batch['seq_mask'][None, :]\n\n    # Inject previous outputs for recycling.\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" line 6\n    # Jumper et al. (2021) Suppl. Alg. 32 \"RecyclingEmbedder\"\n    if c.recycle_pos:\n      prev_pseudo_beta = pseudo_beta_fn(\n          batch['aatype'], batch['prev_pos'], None)\n      dgram = dgram_from_positions(prev_pseudo_beta, **self.config.prev_pos)\n      pair_activations += common_modules.Linear(\n          c.pair_channel, name='prev_pos_linear')(\n              dgram)\n\n    if c.recycle_features:\n      prev_msa_first_row = common_modules.LayerNorm(\n          axis=[-1],\n          create_scale=True,\n          create_offset=True,\n          name='prev_msa_first_row_norm')(\n              batch['prev_msa_first_row'])\n      msa_activations = msa_activations.at[0].add(prev_msa_first_row)\n\n      pair_activations += common_modules.LayerNorm(\n          axis=[-1],\n          create_scale=True,\n          create_offset=True,\n          name='prev_pair_norm')(\n              batch['prev_pair'])\n\n    # Relative position encoding.\n    # Jumper et al. (2021) Suppl. Alg. 4 \"relpos\"\n    # Jumper et al. (2021) Suppl. Alg. 5 \"one_hot\"\n    if c.max_relative_feature:\n      # Add one-hot-encoded clipped residue distances to the pair activations.\n      pos = batch['residue_index']\n      offset = pos[:, None] - pos[None, :]\n      rel_pos = jax.nn.one_hot(\n          jnp.clip(\n              offset + c.max_relative_feature,\n              a_min=0,\n              a_max=2 * c.max_relative_feature),\n          2 * c.max_relative_feature + 1)\n      pair_activations += common_modules.Linear(\n          c.pair_channel, name='pair_activiations')(\n              rel_pos)\n\n    # Embed templates into the pair activations.\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 9-13\n    if c.template.enabled:\n      template_batch = {k: batch[k] for k in batch if k.startswith('template_')}\n      template_pair_representation = TemplateEmbedding(c.template, gc)(\n          pair_activations,\n          template_batch,\n          mask_2d,\n          is_training=is_training)\n\n      pair_activations += template_pair_representation\n\n    # Embed extra MSA features.\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 14-16\n    extra_msa_feat = create_extra_msa_feature(batch)\n    extra_msa_activations = common_modules.Linear(\n        c.extra_msa_channel,\n        name='extra_msa_activations')(\n            extra_msa_feat)\n\n    # Extra MSA Stack.\n    # Jumper et al. (2021) Suppl. Alg. 18 \"ExtraMsaStack\"\n    extra_msa_stack_input = {\n        'msa': extra_msa_activations,\n        'pair': pair_activations,\n    }\n\n    extra_msa_stack_iteration = EvoformerIteration(\n        c.evoformer, gc, is_extra_msa=True, name='extra_msa_stack')\n\n    def extra_msa_stack_fn(x):\n      act, safe_key = x\n      safe_key, safe_subkey = safe_key.split()\n      extra_evoformer_output = extra_msa_stack_iteration(\n          activations=act,\n          masks={\n              'msa': batch['extra_msa_mask'],\n              'pair': mask_2d\n          },\n          is_training=is_training,\n          safe_key=safe_subkey)\n      return (extra_evoformer_output, safe_key)\n\n    if gc.use_remat:\n      extra_msa_stack_fn = hk.remat(extra_msa_stack_fn)\n\n    extra_msa_stack = layer_stack.layer_stack(\n        c.extra_msa_stack_num_block)(\n            extra_msa_stack_fn)\n    extra_msa_output, safe_key = extra_msa_stack(\n        (extra_msa_stack_input, safe_key))\n\n    pair_activations = extra_msa_output['pair']\n\n    evoformer_input = {\n        'msa': msa_activations,\n        'pair': pair_activations,\n    }\n\n    evoformer_masks = {'msa': batch['msa_mask'], 'pair': mask_2d}\n\n    # Append num_templ rows to msa_activations with template embeddings.\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 7-8\n    if c.template.enabled and c.template.embed_torsion_angles:\n      num_templ, num_res = batch['template_aatype'].shape\n\n      # Embed the templates aatypes.\n      aatype_one_hot = jax.nn.one_hot(batch['template_aatype'], 22, axis=-1)\n\n      # Embed the templates aatype, torsion angles and masks.\n      # Shape (templates, residues, msa_channels)\n      ret = all_atom.atom37_to_torsion_angles(\n          aatype=batch['template_aatype'],\n          all_atom_pos=batch['template_all_atom_positions'],\n          all_atom_mask=batch['template_all_atom_masks'],\n          # Ensure consistent behaviour during testing:\n          placeholder_for_undefined=not gc.zero_init)\n\n      template_features = jnp.concatenate([\n          aatype_one_hot,\n          jnp.reshape(\n              ret['torsion_angles_sin_cos'], [num_templ, num_res, 14]),\n          jnp.reshape(\n              ret['alt_torsion_angles_sin_cos'], [num_templ, num_res, 14]),\n          ret['torsion_angles_mask']], axis=-1)\n\n      template_activations = common_modules.Linear(\n          c.msa_channel,\n          initializer='relu',\n          name='template_single_embedding')(\n              template_features)\n      template_activations = jax.nn.relu(template_activations)\n      template_activations = common_modules.Linear(\n          c.msa_channel,\n          initializer='relu',\n          name='template_projection')(\n              template_activations)\n\n      # Concatenate the templates to the msa.\n      evoformer_input['msa'] = jnp.concatenate(\n          [evoformer_input['msa'], template_activations], axis=0)\n      # Concatenate templates masks to the msa masks.\n      # Use mask from the psi angle, as it only depends on the backbone atoms\n      # from a single residue.\n      torsion_angle_mask = ret['torsion_angles_mask'][:, :, 2]\n      torsion_angle_mask = torsion_angle_mask.astype(\n          evoformer_masks['msa'].dtype)\n      evoformer_masks['msa'] = jnp.concatenate(\n          [evoformer_masks['msa'], torsion_angle_mask], axis=0)\n\n    # Main trunk of the network\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 17-18\n    evoformer_iteration = EvoformerIteration(\n        c.evoformer, gc, is_extra_msa=False, name='evoformer_iteration')\n\n    def evoformer_fn(x):\n      act, safe_key = x\n      safe_key, safe_subkey = safe_key.split()\n      evoformer_output = evoformer_iteration(\n          activations=act,\n          masks=evoformer_masks,\n          is_training=is_training,\n          safe_key=safe_subkey)\n      return (evoformer_output, safe_key)\n\n    if gc.use_remat:\n      evoformer_fn = hk.remat(evoformer_fn)\n\n    evoformer_stack = layer_stack.layer_stack(c.evoformer_num_block)(\n        evoformer_fn)\n    evoformer_output, safe_key = evoformer_stack(\n        (evoformer_input, safe_key))\n\n    msa_activations = evoformer_output['msa']\n    pair_activations = evoformer_output['pair']\n\n    single_activations = common_modules.Linear(\n        c.seq_channel, name='single_activations')(\n            msa_activations[0])\n\n    num_sequences = batch['msa_feat'].shape[0]\n    output = {\n        'single': single_activations,\n        'pair': pair_activations,\n        # Crop away template rows such that they are not used in MaskedMsaHead.\n        'msa': msa_activations[:num_sequences, :, :],\n        'msa_first_row': msa_activations[0],\n    }\n\n    return output\n\n\nclass SingleTemplateEmbedding(hk.Module):\n  \"\"\"Embeds a single template.\n\n  Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 9+11\n  \"\"\"\n\n  def __init__(self, config, global_config, name='single_template_embedding'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, query_embedding, batch, mask_2d, is_training):\n    \"\"\"Build the single template embedding.\n\n    Arguments:\n      query_embedding: Query pair representation, shape [N_res, N_res, c_z].\n      batch: A batch of template features (note the template dimension has been\n        stripped out as this module only runs over a single template).\n      mask_2d: Padding mask (Note: this doesn't care if a template exists,\n        unlike the template_pseudo_beta_mask).\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      A template embedding [N_res, N_res, c_z].\n    \"\"\"\n    assert mask_2d.dtype == query_embedding.dtype\n    dtype = query_embedding.dtype\n    num_res = batch['template_aatype'].shape[0]\n    num_channels = (self.config.template_pair_stack\n                    .triangle_attention_ending_node.value_dim)\n    template_mask = batch['template_pseudo_beta_mask']\n    template_mask_2d = template_mask[:, None] * template_mask[None, :]\n    template_mask_2d = template_mask_2d.astype(dtype)\n\n    template_dgram = dgram_from_positions(batch['template_pseudo_beta'],\n                                          **self.config.dgram_features)\n    template_dgram = template_dgram.astype(dtype)\n\n    to_concat = [template_dgram, template_mask_2d[:, :, None]]\n\n    aatype = jax.nn.one_hot(batch['template_aatype'], 22, axis=-1, dtype=dtype)\n\n    to_concat.append(jnp.tile(aatype[None, :, :], [num_res, 1, 1]))\n    to_concat.append(jnp.tile(aatype[:, None, :], [1, num_res, 1]))\n\n    n, ca, c = [residue_constants.atom_order[a] for a in ('N', 'CA', 'C')]\n    rot, trans = quat_affine.make_transform_from_reference(\n        n_xyz=batch['template_all_atom_positions'][:, n],\n        ca_xyz=batch['template_all_atom_positions'][:, ca],\n        c_xyz=batch['template_all_atom_positions'][:, c])\n    affines = quat_affine.QuatAffine(\n        quaternion=quat_affine.rot_to_quat(rot, unstack_inputs=True),\n        translation=trans,\n        rotation=rot,\n        unstack_inputs=True)\n    points = [jnp.expand_dims(x, axis=-2) for x in affines.translation]\n    affine_vec = affines.invert_point(points, extra_dims=1)\n    inv_distance_scalar = jax.lax.rsqrt(\n        1e-6 + sum([jnp.square(x) for x in affine_vec]))\n\n    # Backbone affine mask: whether the residue has C, CA, N\n    # (the template mask defined above only considers pseudo CB).\n    template_mask = (\n        batch['template_all_atom_masks'][..., n] *\n        batch['template_all_atom_masks'][..., ca] *\n        batch['template_all_atom_masks'][..., c])\n    template_mask_2d = template_mask[:, None] * template_mask[None, :]\n\n    inv_distance_scalar *= template_mask_2d.astype(inv_distance_scalar.dtype)\n\n    unit_vector = [(x * inv_distance_scalar)[..., None] for x in affine_vec]\n\n    unit_vector = [x.astype(dtype) for x in unit_vector]\n    template_mask_2d = template_mask_2d.astype(dtype)\n    if not self.config.use_template_unit_vector:\n      unit_vector = [jnp.zeros_like(x) for x in unit_vector]\n    to_concat.extend(unit_vector)\n\n    to_concat.append(template_mask_2d[..., None])\n\n    act = jnp.concatenate(to_concat, axis=-1)\n\n    # Mask out non-template regions so we don't get arbitrary values in the\n    # distogram for these regions.\n    act *= template_mask_2d[..., None]\n\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" line 9\n    act = common_modules.Linear(\n        num_channels,\n        initializer='relu',\n        name='embedding2d')(\n            act)\n\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" line 11\n    act = TemplatePairStack(\n        self.config.template_pair_stack, self.global_config)(\n            act, mask_2d, is_training)\n\n    act = common_modules.LayerNorm([-1], True, True, name='output_layer_norm')(act)\n    return act\n\n\nclass TemplateEmbedding(hk.Module):\n  \"\"\"Embeds a set of templates.\n\n  Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 9-12\n  Jumper et al. (2021) Suppl. Alg. 17 \"TemplatePointwiseAttention\"\n  \"\"\"\n\n  def __init__(self, config, global_config, name='template_embedding'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, query_embedding, template_batch, mask_2d, is_training):\n    \"\"\"Build TemplateEmbedding module.\n\n    Arguments:\n      query_embedding: Query pair representation, shape [N_res, N_res, c_z].\n      template_batch: A batch of template features.\n      mask_2d: Padding mask (Note: this doesn't care if a template exists,\n        unlike the template_pseudo_beta_mask).\n      is_training: Whether the module is in training mode.\n\n    Returns:\n      A template embedding [N_res, N_res, c_z].\n    \"\"\"\n\n    num_templates = template_batch['template_mask'].shape[0]\n    num_channels = (self.config.template_pair_stack\n                    .triangle_attention_ending_node.value_dim)\n    num_res = query_embedding.shape[0]\n\n    dtype = query_embedding.dtype\n    template_mask = template_batch['template_mask']\n    template_mask = template_mask.astype(dtype)\n\n    query_num_channels = query_embedding.shape[-1]\n\n    # Make sure the weights are shared across templates by constructing the\n    # embedder here.\n    # Jumper et al. (2021) Suppl. Alg. 2 \"Inference\" lines 9-12\n    template_embedder = SingleTemplateEmbedding(self.config, self.global_config)\n\n    def map_fn(batch):\n      return template_embedder(query_embedding, batch, mask_2d, is_training)\n\n    template_pair_representation = mapping.sharded_map(map_fn, in_axes=0)(\n        template_batch)\n\n    # Cross attend from the query to the templates along the residue\n    # dimension by flattening everything else into the batch dimension.\n    # Jumper et al. (2021) Suppl. Alg. 17 \"TemplatePointwiseAttention\"\n    flat_query = jnp.reshape(query_embedding,\n                             [num_res * num_res, 1, query_num_channels])\n\n    flat_templates = jnp.reshape(\n        jnp.transpose(template_pair_representation, [1, 2, 0, 3]),\n        [num_res * num_res, num_templates, num_channels])\n\n    bias = (1e9 * (template_mask[None, None, None, :] - 1.))\n\n    template_pointwise_attention_module = Attention(\n        self.config.attention, self.global_config, query_num_channels)\n    nonbatched_args = [bias]\n    batched_args = [flat_query, flat_templates]\n\n    embedding = mapping.inference_subbatch(\n        template_pointwise_attention_module,\n        self.config.subbatch_size,\n        batched_args=batched_args,\n        nonbatched_args=nonbatched_args,\n        low_memory=not is_training)\n    embedding = jnp.reshape(embedding,\n                            [num_res, num_res, query_num_channels])\n\n    # No gradients if no templates.\n    embedding *= (jnp.sum(template_mask) > 0.).astype(embedding.dtype)\n\n    return embedding\n"
  },
  {
    "path": "alphafold/model/modules_multimer.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Core modules, which have been refactored in AlphaFold-Multimer.\n\nThe main difference is that MSA sampling pipeline is moved inside the JAX model\nfor easier implementation of recycling and ensembling.\n\nLower-level modules up to EvoformerIteration are reused from modules.py.\n\"\"\"\n\nimport functools\nfrom typing import Sequence\n\nfrom alphafold.common import residue_constants\nfrom alphafold.model import all_atom_multimer\nfrom alphafold.model import common_modules\nfrom alphafold.model import folding_multimer\nfrom alphafold.model import geometry\nfrom alphafold.model import layer_stack\nfrom alphafold.model import modules\nfrom alphafold.model import prng\nfrom alphafold.model import utils\n\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\n\ndef reduce_fn(x, mode):\n  if mode == 'none' or mode is None:\n    return jnp.asarray(x)\n  elif mode == 'sum':\n    return jnp.asarray(x).sum()\n  elif mode == 'mean':\n    return jnp.mean(jnp.asarray(x))\n  else:\n    raise ValueError('Unsupported reduction option.')\n\n\ndef gumbel_noise(key: jnp.ndarray, shape: Sequence[int]) -> jnp.ndarray:\n  \"\"\"Generate Gumbel Noise of given Shape.\n\n  This generates samples from Gumbel(0, 1).\n\n  Args:\n    key: Jax random number key.\n    shape: Shape of noise to return.\n\n  Returns:\n    Gumbel noise of given shape.\n  \"\"\"\n  epsilon = 1e-6\n  uniform = utils.padding_consistent_rng(jax.random.uniform)\n  uniform_noise = uniform(\n      key, shape=shape, dtype=jnp.float32, minval=0., maxval=1.)\n  gumbel = -jnp.log(-jnp.log(uniform_noise + epsilon) + epsilon)\n  return gumbel\n\n\ndef gumbel_max_sample(key: jnp.ndarray, logits: jnp.ndarray) -> jnp.ndarray:\n  \"\"\"Samples from a probability distribution given by 'logits'.\n\n  This uses Gumbel-max trick to implement the sampling in an efficient manner.\n\n  Args:\n    key: prng key.\n    logits: Logarithm of probabilities to sample from, probabilities can be\n      unnormalized.\n\n  Returns:\n    Sample from logprobs in one-hot form.\n  \"\"\"\n  z = gumbel_noise(key, logits.shape)\n  return jax.nn.one_hot(\n      jnp.argmax(logits + z, axis=-1),\n      logits.shape[-1],\n      dtype=logits.dtype)\n\n\ndef gumbel_argsort_sample_idx(key: jnp.ndarray,\n                              logits: jnp.ndarray) -> jnp.ndarray:\n  \"\"\"Samples with replacement from a distribution given by 'logits'.\n\n  This uses Gumbel trick to implement the sampling an efficient manner. For a\n  distribution over k items this samples k times without replacement, so this\n  is effectively sampling a random permutation with probabilities over the\n  permutations derived from the logprobs.\n\n  Args:\n    key: prng key.\n    logits: Logarithm of probabilities to sample from, probabilities can be\n      unnormalized.\n\n  Returns:\n    Sample from logprobs in one-hot form.\n  \"\"\"\n  z = gumbel_noise(key, logits.shape)\n  # This construction is equivalent to jnp.argsort, but using a non stable sort,\n  # since stable sort's aren't supported by jax2tf.\n  axis = len(logits.shape) - 1\n  iota = jax.lax.broadcasted_iota(jnp.int64, logits.shape, axis)\n  _, perm = jax.lax.sort_key_val(\n      logits + z, iota, dimension=-1, is_stable=False)\n  return perm[::-1]\n\n\ndef make_masked_msa(batch, key, config, epsilon=1e-6):\n  \"\"\"Create data for BERT on raw MSA.\"\"\"\n  # Add a random amino acid uniformly.\n  random_aa = jnp.array([0.05] * 20 + [0., 0.], dtype=jnp.float32)\n\n  categorical_probs = (\n      config.uniform_prob * random_aa +\n      config.profile_prob * batch['msa_profile'] +\n      config.same_prob * jax.nn.one_hot(batch['msa'], 22))\n\n  # Put all remaining probability on [MASK] which is a new column.\n  pad_shapes = [[0, 0] for _ in range(len(categorical_probs.shape))]\n  pad_shapes[-1][1] = 1\n  mask_prob = 1. - config.profile_prob - config.same_prob - config.uniform_prob\n  assert mask_prob >= 0.\n  categorical_probs = jnp.pad(\n      categorical_probs, pad_shapes, constant_values=mask_prob)\n  sh = batch['msa'].shape\n  key, mask_subkey, gumbel_subkey = key.split(3)\n  uniform = utils.padding_consistent_rng(jax.random.uniform)\n  mask_position = uniform(mask_subkey.get(), sh) < config.replace_fraction\n  mask_position *= batch['msa_mask']\n\n  logits = jnp.log(categorical_probs + epsilon)\n  bert_msa = gumbel_max_sample(gumbel_subkey.get(), logits)\n  bert_msa = jnp.where(mask_position,\n                       jnp.argmax(bert_msa, axis=-1), batch['msa'])\n  bert_msa *= batch['msa_mask']\n\n  # Mix real and masked MSA.\n  if 'bert_mask' in batch:\n    batch['bert_mask'] *= mask_position.astype(jnp.float32)\n  else:\n    batch['bert_mask'] = mask_position.astype(jnp.float32)\n  batch['true_msa'] = batch['msa']\n  batch['msa'] = bert_msa\n\n  return batch\n\n\ndef nearest_neighbor_clusters(batch, gap_agreement_weight=0.):\n  \"\"\"Assign each extra MSA sequence to its nearest neighbor in sampled MSA.\"\"\"\n\n  # Determine how much weight we assign to each agreement.  In theory, we could\n  # use a full blosum matrix here, but right now let's just down-weight gap\n  # agreement because it could be spurious.\n  # Never put weight on agreeing on BERT mask.\n\n  weights = jnp.array(\n      [1.] * 21 + [gap_agreement_weight] + [0.], dtype=jnp.float32)\n\n  msa_mask = batch['msa_mask']\n  msa_one_hot = jax.nn.one_hot(batch['msa'], 23)\n\n  extra_mask = batch['extra_msa_mask']\n  extra_one_hot = jax.nn.one_hot(batch['extra_msa'], 23)\n\n  msa_one_hot_masked = msa_mask[:, :, None] * msa_one_hot\n  extra_one_hot_masked = extra_mask[:, :, None] * extra_one_hot\n\n  agreement = jnp.einsum('mrc, nrc->nm', extra_one_hot_masked,\n                         weights * msa_one_hot_masked)\n\n  cluster_assignment = jax.nn.softmax(1e3 * agreement, axis=0)\n  cluster_assignment *= jnp.einsum('mr, nr->mn', msa_mask, extra_mask)\n\n  cluster_count = jnp.sum(cluster_assignment, axis=-1)\n  cluster_count += 1.  # We always include the sequence itself.\n\n  msa_sum = jnp.einsum('nm, mrc->nrc', cluster_assignment, extra_one_hot_masked)\n  msa_sum += msa_one_hot_masked\n\n  cluster_profile = msa_sum / cluster_count[:, None, None]\n\n  extra_deletion_matrix = batch['extra_deletion_matrix']\n  deletion_matrix = batch['deletion_matrix']\n\n  del_sum = jnp.einsum('nm, mc->nc', cluster_assignment,\n                       extra_mask * extra_deletion_matrix)\n  del_sum += deletion_matrix  # Original sequence.\n  cluster_deletion_mean = del_sum / cluster_count[:, None]\n\n  return cluster_profile, cluster_deletion_mean\n\n\ndef create_msa_feat(batch):\n  \"\"\"Create and concatenate MSA features.\"\"\"\n  msa_1hot = jax.nn.one_hot(batch['msa'], 23)\n  deletion_matrix = batch['deletion_matrix']\n  has_deletion = jnp.clip(deletion_matrix, 0., 1.)[..., None]\n  deletion_value = (jnp.arctan(deletion_matrix / 3.) * (2. / jnp.pi))[..., None]\n\n  deletion_mean_value = (jnp.arctan(batch['cluster_deletion_mean'] / 3.) *\n                         (2. / jnp.pi))[..., None]\n\n  msa_feat = [\n      msa_1hot,\n      has_deletion,\n      deletion_value,\n      batch['cluster_profile'],\n      deletion_mean_value\n  ]\n\n  return jnp.concatenate(msa_feat, axis=-1)\n\n\ndef create_extra_msa_feature(batch, num_extra_msa):\n  \"\"\"Expand extra_msa into 1hot and concat with other extra msa features.\n\n  We do this as late as possible as the one_hot extra msa can be very large.\n\n  Args:\n    batch: a dictionary with the following keys:\n     * 'extra_msa': [num_seq, num_res] MSA that wasn't selected as a cluster\n       centre. Note - This isn't one-hotted.\n     * 'extra_deletion_matrix': [num_seq, num_res] Number of deletions at given\n        position.\n    num_extra_msa: Number of extra msa to use.\n\n  Returns:\n    Concatenated tensor of extra MSA features.\n  \"\"\"\n  # 23 = 20 amino acids + 'X' for unknown + gap + bert mask\n  extra_msa = batch['extra_msa'][:num_extra_msa]\n  deletion_matrix = batch['extra_deletion_matrix'][:num_extra_msa]\n  msa_1hot = jax.nn.one_hot(extra_msa, 23)\n  has_deletion = jnp.clip(deletion_matrix, 0., 1.)[..., None]\n  deletion_value = (jnp.arctan(deletion_matrix / 3.) * (2. / jnp.pi))[..., None]\n  extra_msa_mask = batch['extra_msa_mask'][:num_extra_msa]\n  return jnp.concatenate([msa_1hot, has_deletion, deletion_value],\n                         axis=-1), extra_msa_mask\n\n\ndef sample_msa(key, batch, max_seq):\n  \"\"\"Sample MSA randomly, remaining sequences are stored as `extra_*`.\n\n  Args:\n    key: safe key for random number generation.\n    batch: batch to sample msa from.\n    max_seq: number of sequences to sample.\n  Returns:\n    Protein with sampled msa.\n  \"\"\"\n  # Sample uniformly among sequences with at least one non-masked position.\n  logits = (jnp.clip(jnp.sum(batch['msa_mask'], axis=-1), 0., 1.) - 1.) * 1e6\n  # The cluster_bias_mask can be used to preserve the first row (target\n  # sequence) for each chain, for example.\n  if 'cluster_bias_mask' not in batch:\n    cluster_bias_mask = jnp.pad(\n        jnp.zeros(batch['msa'].shape[0] - 1), (1, 0), constant_values=1.)\n  else:\n    cluster_bias_mask = batch['cluster_bias_mask']\n\n  logits += cluster_bias_mask * 1e6\n  index_order = gumbel_argsort_sample_idx(key.get(), logits)\n  sel_idx = index_order[:max_seq]\n  extra_idx = index_order[max_seq:]\n\n  for k in ['msa', 'deletion_matrix', 'msa_mask', 'bert_mask']:\n    if k in batch:\n      batch['extra_' + k] = batch[k][extra_idx]\n      batch[k] = batch[k][sel_idx]\n\n  return batch\n\n\ndef make_msa_profile(batch):\n  \"\"\"Compute the MSA profile.\"\"\"\n\n  # Compute the profile for every residue (over all MSA sequences).\n  return utils.mask_mean(\n      batch['msa_mask'][:, :, None], jax.nn.one_hot(batch['msa'], 22), axis=0)\n\n\nclass AlphaFoldIteration(hk.Module):\n  \"\"\"A single recycling iteration of AlphaFold architecture.\n\n  Computes ensembled (averaged) representations from the provided features.\n  These representations are then passed to the various heads\n  that have been requested by the configuration file.\n  \"\"\"\n\n  def __init__(self, config, global_config, name='alphafold_iteration'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self,\n               batch,\n               is_training,\n               return_representations=False,\n               safe_key=None):\n\n    if is_training:\n      num_ensemble = np.asarray(self.config.num_ensemble_train)\n    else:\n      num_ensemble = np.asarray(self.config.num_ensemble_eval)\n\n    # Compute representations for each MSA sample and average.\n    embedding_module = EmbeddingsAndEvoformer(\n        self.config.embeddings_and_evoformer, self.global_config)\n    repr_shape = hk.eval_shape(\n        lambda: embedding_module(batch, is_training))\n    representations = {\n        k: jnp.zeros(v.shape, v.dtype) for (k, v) in repr_shape.items()\n    }\n\n    def ensemble_body(x, unused_y):\n      \"\"\"Add into representations ensemble.\"\"\"\n      del unused_y\n      representations, safe_key = x\n      safe_key, safe_subkey = safe_key.split()\n      representations_update = embedding_module(\n          batch, is_training, safe_key=safe_subkey)\n\n      for k in representations:\n        if k not in {'msa', 'true_msa', 'bert_mask'}:\n          representations[k] += representations_update[k] * (\n              1. / num_ensemble).astype(representations[k].dtype)\n        else:\n          representations[k] = representations_update[k]\n\n      return (representations, safe_key), None\n\n    (representations, _), _ = hk.scan(\n        ensemble_body, (representations, safe_key), None, length=num_ensemble)\n\n    self.representations = representations\n    self.batch = batch\n    self.heads = {}\n    for head_name, head_config in sorted(self.config.heads.items()):\n      if not head_config.weight:\n        continue  # Do not instantiate zero-weight heads.\n\n      head_factory = {\n          'masked_msa':\n              modules.MaskedMsaHead,\n          'distogram':\n              modules.DistogramHead,\n          'structure_module':\n              folding_multimer.StructureModule,\n          'predicted_aligned_error':\n              modules.PredictedAlignedErrorHead,\n          'predicted_lddt':\n              modules.PredictedLDDTHead,\n          'experimentally_resolved':\n              modules.ExperimentallyResolvedHead,\n      }[head_name]\n      self.heads[head_name] = (head_config,\n                               head_factory(head_config, self.global_config))\n\n    structure_module_output = None\n    if 'entity_id' in batch and 'all_atom_positions' in batch:\n      _, fold_module = self.heads['structure_module']\n      structure_module_output = fold_module(representations, batch, is_training)\n\n    ret = {}\n    ret['representations'] = representations\n\n    for name, (head_config, module) in self.heads.items():\n      if name == 'structure_module' and structure_module_output is not None:\n        ret[name] = structure_module_output\n        representations['structure_module'] = structure_module_output.pop('act')\n      # Skip confidence heads until StructureModule is executed.\n      elif name in {'predicted_lddt', 'predicted_aligned_error',\n                    'experimentally_resolved'}:\n        continue\n      else:\n        ret[name] = module(representations, batch, is_training)\n\n    # Add confidence heads after StructureModule is executed.\n    if self.config.heads.get('predicted_lddt.weight', 0.0):\n      name = 'predicted_lddt'\n      head_config, module = self.heads[name]\n      ret[name] = module(representations, batch, is_training)\n\n    if self.config.heads.experimentally_resolved.weight:\n      name = 'experimentally_resolved'\n      head_config, module = self.heads[name]\n      ret[name] = module(representations, batch, is_training)\n\n    if self.config.heads.get('predicted_aligned_error.weight', 0.0):\n      name = 'predicted_aligned_error'\n      head_config, module = self.heads[name]\n      ret[name] = module(representations, batch, is_training)\n      # Will be used for ipTM computation.\n      ret[name]['asym_id'] = batch['asym_id']\n\n    return ret\n\n\nclass AlphaFold(hk.Module):\n  \"\"\"AlphaFold-Multimer model with recycling.\n  \"\"\"\n\n  def __init__(self, config, name='alphafold'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = config.global_config\n\n  def __call__(\n      self,\n      batch,\n      is_training,\n      return_representations=False,\n      safe_key=None):\n\n    c = self.config\n    impl = AlphaFoldIteration(c, self.global_config)\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n    elif isinstance(safe_key, jnp.ndarray):\n      safe_key = prng.SafeKey(safe_key)\n\n    assert isinstance(batch, dict)\n    num_res = batch['aatype'].shape[0]\n\n    def get_prev(ret):\n      new_prev = {\n          'prev_pos':\n              ret['structure_module']['final_atom_positions'],\n          'prev_msa_first_row': ret['representations']['msa_first_row'],\n          'prev_pair': ret['representations']['pair'],\n      }\n      return jax.tree_map(jax.lax.stop_gradient, new_prev)\n\n    def apply_network(prev, safe_key):\n      recycled_batch = {**batch, **prev}\n      return impl(\n          batch=recycled_batch,\n          is_training=is_training,\n          safe_key=safe_key)\n\n    prev = {}\n    emb_config = self.config.embeddings_and_evoformer\n    if emb_config.recycle_pos:\n      prev['prev_pos'] = jnp.zeros(\n          [num_res, residue_constants.atom_type_num, 3])\n    if emb_config.recycle_features:\n      prev['prev_msa_first_row'] = jnp.zeros(\n          [num_res, emb_config.msa_channel])\n      prev['prev_pair'] = jnp.zeros(\n          [num_res, num_res, emb_config.pair_channel])\n\n    if self.config.num_recycle:\n      if 'num_iter_recycling' in batch:\n        # Training time: num_iter_recycling is in batch.\n        # Value for each ensemble batch is the same, so arbitrarily taking 0-th.\n        num_iter = batch['num_iter_recycling'][0]\n\n        # Add insurance that even when ensembling, we will not run more\n        # recyclings than the model is configured to run.\n        num_iter = jnp.minimum(num_iter, c.num_recycle)\n      else:\n        # Eval mode or tests: use the maximum number of iterations.\n        num_iter = c.num_recycle\n\n      def distances(points):\n        \"\"\"Compute all pairwise distances for a set of points.\"\"\"\n        return jnp.sqrt(jnp.sum((points[:, None] - points[None, :])**2,\n                                axis=-1))\n\n      def recycle_body(x):\n        i, _, prev, safe_key = x\n        safe_key1, safe_key2 = safe_key.split() if c.resample_msa_in_recycling else safe_key.duplicate()  # pylint: disable=line-too-long\n        ret = apply_network(prev=prev, safe_key=safe_key2)\n        return i+1, prev, get_prev(ret), safe_key1\n\n      def recycle_cond(x):\n        i, prev, next_in, _ = x\n        ca_idx = residue_constants.atom_order['CA']\n        sq_diff = jnp.square(distances(prev['prev_pos'][:, ca_idx, :]) -\n                             distances(next_in['prev_pos'][:, ca_idx, :]))\n        mask = batch['seq_mask'][:, None] * batch['seq_mask'][None, :]\n        sq_diff = utils.mask_mean(mask, sq_diff)\n        # Early stopping criteria based on criteria used in\n        # AF2Complex: https://www.nature.com/articles/s41467-022-29394-2\n        diff = jnp.sqrt(sq_diff + 1e-8)  # avoid bad numerics giving negatives\n        less_than_max_recycles = (i < num_iter)\n        has_exceeded_tolerance = (\n            (i == 0) | (diff > c.recycle_early_stop_tolerance))\n        return less_than_max_recycles & has_exceeded_tolerance\n\n      if hk.running_init():\n        num_recycles, _, prev, safe_key = recycle_body(\n            (0, prev, prev, safe_key))\n      else:\n        num_recycles, _, prev, safe_key = hk.while_loop(\n            recycle_cond,\n            recycle_body,\n            (0, prev, prev, safe_key))\n    else:\n      # No recycling.\n      num_recycles = 0\n\n    # Run extra iteration.\n    ret = apply_network(prev=prev, safe_key=safe_key)\n\n    if not return_representations:\n      del ret['representations']\n    ret['num_recycles'] = num_recycles\n\n    return ret\n\n\nclass EmbeddingsAndEvoformer(hk.Module):\n  \"\"\"Embeds the input data and runs Evoformer.\n\n  Produces the MSA, single and pair representations.\n  \"\"\"\n\n  def __init__(self, config, global_config, name='evoformer'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def _relative_encoding(self, batch):\n    \"\"\"Add relative position encodings.\n\n    For position (i, j), the value is (i-j) clipped to [-k, k] and one-hotted.\n\n    When not using 'use_chain_relative' the residue indices are used as is, e.g.\n    for heteromers relative positions will be computed using the positions in\n    the corresponding chains.\n\n    When using 'use_chain_relative' we add an extra bin that denotes\n    'different chain'. Furthermore we also provide the relative chain index\n    (i.e. sym_id) clipped and one-hotted to the network. And an extra feature\n    which denotes whether they belong to the same chain type, i.e. it's 0 if\n    they are in different heteromer chains and 1 otherwise.\n\n    Args:\n      batch: batch.\n    Returns:\n      Feature embedding using the features as described before.\n    \"\"\"\n    c = self.config\n    gc = self.global_config\n    rel_feats = []\n    pos = batch['residue_index']\n    asym_id = batch['asym_id']\n    asym_id_same = jnp.equal(asym_id[:, None], asym_id[None, :])\n    offset = pos[:, None] - pos[None, :]\n    dtype = jnp.bfloat16 if gc.bfloat16 else jnp.float32\n\n    clipped_offset = jnp.clip(\n        offset + c.max_relative_idx, a_min=0, a_max=2 * c.max_relative_idx)\n\n    if c.use_chain_relative:\n\n      final_offset = jnp.where(asym_id_same, clipped_offset,\n                               (2 * c.max_relative_idx + 1) *\n                               jnp.ones_like(clipped_offset))\n\n      rel_pos = jax.nn.one_hot(final_offset, 2 * c.max_relative_idx + 2)\n\n      rel_feats.append(rel_pos)\n\n      entity_id = batch['entity_id']\n      entity_id_same = jnp.equal(entity_id[:, None], entity_id[None, :])\n      rel_feats.append(entity_id_same.astype(rel_pos.dtype)[..., None])\n\n      sym_id = batch['sym_id']\n      rel_sym_id = sym_id[:, None] - sym_id[None, :]\n\n      max_rel_chain = c.max_relative_chain\n\n      clipped_rel_chain = jnp.clip(\n          rel_sym_id + max_rel_chain, a_min=0, a_max=2 * max_rel_chain)\n\n      final_rel_chain = jnp.where(entity_id_same, clipped_rel_chain,\n                                  (2 * max_rel_chain + 1) *\n                                  jnp.ones_like(clipped_rel_chain))\n      rel_chain = jax.nn.one_hot(final_rel_chain, 2 * c.max_relative_chain + 2)\n\n      rel_feats.append(rel_chain)\n\n    else:\n      rel_pos = jax.nn.one_hot(clipped_offset, 2 * c.max_relative_idx + 1)\n      rel_feats.append(rel_pos)\n\n    rel_feat = jnp.concatenate(rel_feats, axis=-1)\n\n    rel_feat = rel_feat.astype(dtype)\n    return common_modules.Linear(\n        c.pair_channel,\n        name='position_activations')(\n            rel_feat)\n\n  def __call__(self, batch, is_training, safe_key=None):\n\n    c = self.config\n    gc = self.global_config\n\n    batch = dict(batch)\n    dtype = jnp.bfloat16 if gc.bfloat16 else jnp.float32\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    output = {}\n\n    batch['msa_profile'] = make_msa_profile(batch)\n\n    with utils.bfloat16_context():\n      target_feat = jax.nn.one_hot(batch['aatype'], 21).astype(dtype)\n\n      preprocess_1d = common_modules.Linear(\n          c.msa_channel, name='preprocess_1d')(\n              target_feat)\n\n      safe_key, sample_key, mask_key = safe_key.split(3)\n      batch = sample_msa(sample_key, batch, c.num_msa)\n      batch = make_masked_msa(batch, mask_key, c.masked_msa)\n\n      (batch['cluster_profile'],\n       batch['cluster_deletion_mean']) = nearest_neighbor_clusters(batch)\n\n      msa_feat = create_msa_feat(batch).astype(dtype)\n\n      preprocess_msa = common_modules.Linear(\n          c.msa_channel, name='preprocess_msa')(\n              msa_feat)\n      msa_activations = jnp.expand_dims(preprocess_1d, axis=0) + preprocess_msa\n\n      left_single = common_modules.Linear(\n          c.pair_channel, name='left_single')(\n              target_feat)\n      right_single = common_modules.Linear(\n          c.pair_channel, name='right_single')(\n              target_feat)\n      pair_activations = left_single[:, None] + right_single[None]\n      mask_2d = batch['seq_mask'][:, None] * batch['seq_mask'][None, :]\n      mask_2d = mask_2d.astype(dtype)\n\n      if c.recycle_pos:\n        prev_pseudo_beta = modules.pseudo_beta_fn(\n            batch['aatype'], batch['prev_pos'], None)\n\n        dgram = modules.dgram_from_positions(\n            prev_pseudo_beta, **self.config.prev_pos)\n        dgram = dgram.astype(dtype)\n        pair_activations += common_modules.Linear(\n            c.pair_channel, name='prev_pos_linear')(\n                dgram)\n      if c.recycle_features:\n        prev_msa_first_row = common_modules.LayerNorm(\n            axis=[-1],\n            create_scale=True,\n            create_offset=True,\n            name='prev_msa_first_row_norm')(\n                batch['prev_msa_first_row']).astype(dtype)\n        msa_activations = msa_activations.at[0].add(prev_msa_first_row)\n\n        pair_activations += common_modules.LayerNorm(\n            axis=[-1],\n            create_scale=True,\n            create_offset=True,\n            name='prev_pair_norm')(\n                batch['prev_pair']).astype(dtype)\n\n      if c.max_relative_idx:\n        pair_activations += self._relative_encoding(batch)\n\n      if c.template.enabled:\n        template_module = TemplateEmbedding(c.template, gc)\n        template_batch = {\n            'template_aatype': batch['template_aatype'],\n            'template_all_atom_positions': batch['template_all_atom_positions'],\n            'template_all_atom_mask': batch['template_all_atom_mask']\n        }\n        # Construct a mask such that only intra-chain template features are\n        # computed, since all templates are for each chain individually.\n        multichain_mask = batch['asym_id'][:, None] == batch['asym_id'][None, :]\n        safe_key, safe_subkey = safe_key.split()\n        template_act = template_module(\n            query_embedding=pair_activations,\n            template_batch=template_batch,\n            padding_mask_2d=mask_2d,\n            multichain_mask_2d=multichain_mask,\n            is_training=is_training,\n            safe_key=safe_subkey)\n        pair_activations += template_act\n\n      # Extra MSA stack.\n      (extra_msa_feat,\n       extra_msa_mask) = create_extra_msa_feature(batch, c.num_extra_msa)\n      extra_msa_activations = common_modules.Linear(\n          c.extra_msa_channel,\n          name='extra_msa_activations')(\n              extra_msa_feat).astype(dtype)\n      extra_msa_mask = extra_msa_mask.astype(dtype)\n\n      extra_evoformer_input = {\n          'msa': extra_msa_activations,\n          'pair': pair_activations,\n      }\n      extra_masks = {'msa': extra_msa_mask, 'pair': mask_2d}\n\n      extra_evoformer_iteration = modules.EvoformerIteration(\n          c.evoformer, gc, is_extra_msa=True, name='extra_msa_stack')\n\n      def extra_evoformer_fn(x):\n        act, safe_key = x\n        safe_key, safe_subkey = safe_key.split()\n        extra_evoformer_output = extra_evoformer_iteration(\n            activations=act,\n            masks=extra_masks,\n            is_training=is_training,\n            safe_key=safe_subkey)\n        return (extra_evoformer_output, safe_key)\n\n      if gc.use_remat:\n        extra_evoformer_fn = hk.remat(extra_evoformer_fn)\n\n      safe_key, safe_subkey = safe_key.split()\n      extra_evoformer_stack = layer_stack.layer_stack(\n          c.extra_msa_stack_num_block)(\n              extra_evoformer_fn)\n      extra_evoformer_output, safe_key = extra_evoformer_stack(\n          (extra_evoformer_input, safe_subkey))\n\n      pair_activations = extra_evoformer_output['pair']\n\n      # Get the size of the MSA before potentially adding templates, so we\n      # can crop out the templates later.\n      num_msa_sequences = msa_activations.shape[0]\n      evoformer_input = {\n          'msa': msa_activations,\n          'pair': pair_activations,\n      }\n      evoformer_masks = {\n          'msa': batch['msa_mask'].astype(dtype),\n          'pair': mask_2d\n      }\n      if c.template.enabled:\n        template_features, template_masks = (\n            template_embedding_1d(\n                batch=batch, num_channel=c.msa_channel, global_config=gc))\n\n        evoformer_input['msa'] = jnp.concatenate(\n            [evoformer_input['msa'], template_features], axis=0)\n        evoformer_masks['msa'] = jnp.concatenate(\n            [evoformer_masks['msa'], template_masks], axis=0)\n      evoformer_iteration = modules.EvoformerIteration(\n          c.evoformer, gc, is_extra_msa=False, name='evoformer_iteration')\n\n      def evoformer_fn(x):\n        act, safe_key = x\n        safe_key, safe_subkey = safe_key.split()\n        evoformer_output = evoformer_iteration(\n            activations=act,\n            masks=evoformer_masks,\n            is_training=is_training,\n            safe_key=safe_subkey)\n        return (evoformer_output, safe_key)\n\n      if gc.use_remat:\n        evoformer_fn = hk.remat(evoformer_fn)\n\n      safe_key, safe_subkey = safe_key.split()\n      evoformer_stack = layer_stack.layer_stack(c.evoformer_num_block)(\n          evoformer_fn)\n\n      def run_evoformer(evoformer_input):\n        evoformer_output, _ = evoformer_stack((evoformer_input, safe_subkey))\n        return evoformer_output\n\n      evoformer_output = run_evoformer(evoformer_input)\n\n      msa_activations = evoformer_output['msa']\n      pair_activations = evoformer_output['pair']\n\n      single_activations = common_modules.Linear(\n          c.seq_channel, name='single_activations')(\n              msa_activations[0])\n\n    output.update({\n        'single':\n            single_activations,\n        'pair':\n            pair_activations,\n        # Crop away template rows such that they are not used in MaskedMsaHead.\n        'msa':\n            msa_activations[:num_msa_sequences, :, :],\n        'msa_first_row':\n            msa_activations[0],\n    })\n\n    # Convert back to float32 if we're not saving memory.\n    if not gc.bfloat16_output:\n      for k, v in output.items():\n        if v.dtype == jnp.bfloat16:\n          output[k] = v.astype(jnp.float32)\n\n    return output\n\n\nclass TemplateEmbedding(hk.Module):\n  \"\"\"Embed a set of templates.\"\"\"\n\n  def __init__(self, config, global_config, name='template_embedding'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, query_embedding, template_batch, padding_mask_2d,\n               multichain_mask_2d, is_training,\n               safe_key=None):\n    \"\"\"Generate an embedding for a set of templates.\n\n    Args:\n      query_embedding: [num_res, num_res, num_channel] a query tensor that will\n        be used to attend over the templates to remove the num_templates\n        dimension.\n      template_batch: A dictionary containing:\n        `template_aatype`: [num_templates, num_res] aatype for each template.\n        `template_all_atom_positions`: [num_templates, num_res, 37, 3] atom\n          positions for all templates.\n        `template_all_atom_mask`: [num_templates, num_res, 37] mask for each\n          template.\n      padding_mask_2d: [num_res, num_res] Pair mask for attention operations.\n      multichain_mask_2d: [num_res, num_res] Mask indicating which residue pairs\n        are intra-chain, used to mask out residue distance based features\n        between chains.\n      is_training: bool indicating where we are running in training mode.\n      safe_key: random key generator.\n\n    Returns:\n      An embedding of size [num_res, num_res, num_channels]\n    \"\"\"\n    c = self.config\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    num_templates = template_batch['template_aatype'].shape[0]\n    num_res, _, query_num_channels = query_embedding.shape\n\n    # Embed each template separately.\n    template_embedder = SingleTemplateEmbedding(self.config, self.global_config)\n    def partial_template_embedder(template_aatype,\n                                  template_all_atom_positions,\n                                  template_all_atom_mask,\n                                  unsafe_key):\n      safe_key = prng.SafeKey(unsafe_key)\n      return template_embedder(query_embedding,\n                               template_aatype,\n                               template_all_atom_positions,\n                               template_all_atom_mask,\n                               padding_mask_2d,\n                               multichain_mask_2d,\n                               is_training,\n                               safe_key)\n\n    safe_key, unsafe_key = safe_key.split()\n    unsafe_keys = jax.random.split(unsafe_key._key, num_templates)\n\n    def scan_fn(carry, x):\n      return carry + partial_template_embedder(*x), None\n\n    scan_init = jnp.zeros((num_res, num_res, c.num_channels),\n                          dtype=query_embedding.dtype)\n    summed_template_embeddings, _ = hk.scan(\n        scan_fn, scan_init,\n        (template_batch['template_aatype'],\n         template_batch['template_all_atom_positions'],\n         template_batch['template_all_atom_mask'], unsafe_keys))\n\n    embedding = summed_template_embeddings / num_templates\n    embedding = jax.nn.relu(embedding)\n    embedding = common_modules.Linear(\n        query_num_channels,\n        initializer='relu',\n        name='output_linear')(embedding)\n\n    return embedding\n\n\nclass SingleTemplateEmbedding(hk.Module):\n  \"\"\"Embed a single template.\"\"\"\n\n  def __init__(self, config, global_config, name='single_template_embedding'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, query_embedding, template_aatype,\n               template_all_atom_positions, template_all_atom_mask,\n               padding_mask_2d, multichain_mask_2d, is_training,\n               safe_key):\n    \"\"\"Build the single template embedding graph.\n\n    Args:\n      query_embedding: (num_res, num_res, num_channels) - embedding of the\n        query sequence/msa.\n      template_aatype: [num_res] aatype for each template.\n      template_all_atom_positions: [num_res, 37, 3] atom positions for all\n        templates.\n      template_all_atom_mask: [num_res, 37] mask for each template.\n      padding_mask_2d: Padding mask (Note: this doesn't care if a template\n        exists, unlike the template_pseudo_beta_mask).\n      multichain_mask_2d: A mask indicating intra-chain residue pairs, used\n        to mask out between chain distances/features when templates are for\n        single chains.\n      is_training: Are we in training mode.\n      safe_key: Random key generator.\n\n    Returns:\n      A template embedding (num_res, num_res, num_channels).\n    \"\"\"\n    gc = self.global_config\n    c = self.config\n    assert padding_mask_2d.dtype == query_embedding.dtype\n    dtype = query_embedding.dtype\n    num_channels = self.config.num_channels\n\n    def construct_input(query_embedding, template_aatype,\n                        template_all_atom_positions, template_all_atom_mask,\n                        multichain_mask_2d):\n\n      # Compute distogram feature for the template.\n      template_positions, pseudo_beta_mask = modules.pseudo_beta_fn(\n          template_aatype, template_all_atom_positions, template_all_atom_mask)\n      pseudo_beta_mask_2d = (pseudo_beta_mask[:, None] *\n                             pseudo_beta_mask[None, :])\n      pseudo_beta_mask_2d *= multichain_mask_2d\n      template_dgram = modules.dgram_from_positions(\n          template_positions, **self.config.dgram_features)\n      template_dgram *= pseudo_beta_mask_2d[..., None]\n      template_dgram = template_dgram.astype(dtype)\n      pseudo_beta_mask_2d = pseudo_beta_mask_2d.astype(dtype)\n      to_concat = [(template_dgram, 1), (pseudo_beta_mask_2d, 0)]\n\n      aatype = jax.nn.one_hot(template_aatype, 22, axis=-1, dtype=dtype)\n      to_concat.append((aatype[None, :, :], 1))\n      to_concat.append((aatype[:, None, :], 1))\n\n      # Compute a feature representing the normalized vector between each\n      # backbone affine - i.e. in each residues local frame, what direction are\n      # each of the other residues.\n      raw_atom_pos = template_all_atom_positions\n      if gc.bfloat16:\n        # Vec3Arrays are required to be float32\n        raw_atom_pos = raw_atom_pos.astype(jnp.float32)\n\n      atom_pos = geometry.Vec3Array.from_array(raw_atom_pos)\n      rigid, backbone_mask = folding_multimer.make_backbone_affine(\n          atom_pos,\n          template_all_atom_mask,\n          template_aatype)\n      points = rigid.translation\n      rigid_vec = rigid[:, None].inverse().apply_to_point(points)\n      unit_vector = rigid_vec.normalized()\n      unit_vector = [unit_vector.x, unit_vector.y, unit_vector.z]\n\n      if gc.bfloat16:\n        unit_vector = [x.astype(jnp.bfloat16) for x in unit_vector]\n        backbone_mask = backbone_mask.astype(jnp.bfloat16)\n\n      backbone_mask_2d = backbone_mask[:, None] * backbone_mask[None, :]\n      backbone_mask_2d *= multichain_mask_2d\n      unit_vector = [x*backbone_mask_2d for x in unit_vector]\n\n      # Note that the backbone_mask takes into account C, CA and N (unlike\n      # pseudo beta mask which just needs CB) so we add both masks as features.\n      to_concat.extend([(x, 0) for x in unit_vector])\n      to_concat.append((backbone_mask_2d, 0))\n\n      query_embedding = common_modules.LayerNorm(\n          axis=[-1],\n          create_scale=True,\n          create_offset=True,\n          name='query_embedding_norm')(\n              query_embedding)\n      # Allow the template embedder to see the query embedding.  Note this\n      # contains the position relative feature, so this is how the network knows\n      # which residues are next to each other.\n      to_concat.append((query_embedding, 1))\n\n      act = 0\n\n      for i, (x, n_input_dims) in enumerate(to_concat):\n\n        act += common_modules.Linear(\n            num_channels,\n            num_input_dims=n_input_dims,\n            initializer='relu',\n            name=f'template_pair_embedding_{i}')(x)\n      return act\n\n    act = construct_input(query_embedding, template_aatype,\n                          template_all_atom_positions, template_all_atom_mask,\n                          multichain_mask_2d)\n\n    template_iteration = TemplateEmbeddingIteration(\n        c.template_pair_stack, gc, name='template_embedding_iteration')\n\n    def template_iteration_fn(x):\n      act, safe_key = x\n\n      safe_key, safe_subkey = safe_key.split()\n      act = template_iteration(\n          act=act,\n          pair_mask=padding_mask_2d,\n          is_training=is_training,\n          safe_key=safe_subkey)\n      return (act, safe_key)\n\n    if gc.use_remat:\n      template_iteration_fn = hk.remat(template_iteration_fn)\n\n    safe_key, safe_subkey = safe_key.split()\n    template_stack = layer_stack.layer_stack(\n        c.template_pair_stack.num_block)(\n            template_iteration_fn)\n    act, safe_key = template_stack((act, safe_subkey))\n\n    act = common_modules.LayerNorm(\n        axis=[-1],\n        create_scale=True,\n        create_offset=True,\n        name='output_layer_norm')(\n            act)\n\n    return act\n\n\nclass TemplateEmbeddingIteration(hk.Module):\n  \"\"\"Single Iteration of Template Embedding.\"\"\"\n\n  def __init__(self, config, global_config,\n               name='template_embedding_iteration'):\n    super().__init__(name=name)\n    self.config = config\n    self.global_config = global_config\n\n  def __call__(self, act, pair_mask, is_training=True,\n               safe_key=None):\n    \"\"\"Build a single iteration of the template embedder.\n\n    Args:\n      act: [num_res, num_res, num_channel] Input pairwise activations.\n      pair_mask: [num_res, num_res] padding mask.\n      is_training: Whether to run in training mode.\n      safe_key: Safe pseudo-random generator key.\n\n    Returns:\n      [num_res, num_res, num_channel] tensor of activations.\n    \"\"\"\n    c = self.config\n    gc = self.global_config\n\n    if safe_key is None:\n      safe_key = prng.SafeKey(hk.next_rng_key())\n\n    dropout_wrapper_fn = functools.partial(\n        modules.dropout_wrapper,\n        is_training=is_training,\n        global_config=gc)\n\n    safe_key, *sub_keys = safe_key.split(20)\n    sub_keys = iter(sub_keys)\n\n    act = dropout_wrapper_fn(\n        modules.TriangleMultiplication(c.triangle_multiplication_outgoing, gc,\n                                       name='triangle_multiplication_outgoing'),\n        act,\n        pair_mask,\n        safe_key=next(sub_keys))\n\n    act = dropout_wrapper_fn(\n        modules.TriangleMultiplication(c.triangle_multiplication_incoming, gc,\n                                       name='triangle_multiplication_incoming'),\n        act,\n        pair_mask,\n        safe_key=next(sub_keys))\n    act = dropout_wrapper_fn(\n        modules.TriangleAttention(c.triangle_attention_starting_node, gc,\n                                  name='triangle_attention_starting_node'),\n        act,\n        pair_mask,\n        safe_key=next(sub_keys))\n    act = dropout_wrapper_fn(\n        modules.TriangleAttention(c.triangle_attention_ending_node, gc,\n                                  name='triangle_attention_ending_node'),\n        act,\n        pair_mask,\n        safe_key=next(sub_keys))\n    act = dropout_wrapper_fn(\n        modules.Transition(c.pair_transition, gc,\n                           name='pair_transition'),\n        act,\n        pair_mask,\n        safe_key=next(sub_keys))\n\n    return act\n\n\ndef template_embedding_1d(batch, num_channel, global_config):\n  \"\"\"Embed templates into an (num_res, num_templates, num_channels) embedding.\n\n  Args:\n    batch: A batch containing:\n      template_aatype, (num_templates, num_res) aatype for the templates.\n      template_all_atom_positions, (num_templates, num_residues, 37, 3) atom\n        positions for the templates.\n      template_all_atom_mask, (num_templates, num_residues, 37) atom mask for\n        each template.\n    num_channel: The number of channels in the output.\n    global_config: The global_config.\n\n  Returns:\n    An embedding of shape (num_templates, num_res, num_channels) and a mask of\n    shape (num_templates, num_res).\n  \"\"\"\n\n  # Embed the templates aatypes.\n  aatype_one_hot = jax.nn.one_hot(batch['template_aatype'], 22, axis=-1)\n\n  num_templates = batch['template_aatype'].shape[0]\n  all_chi_angles = []\n  all_chi_masks = []\n  for i in range(num_templates):\n    atom_pos = geometry.Vec3Array.from_array(\n        batch['template_all_atom_positions'][i, :, :, :])\n    template_chi_angles, template_chi_mask = all_atom_multimer.compute_chi_angles(\n        atom_pos,\n        batch['template_all_atom_mask'][i, :, :],\n        batch['template_aatype'][i, :])\n    all_chi_angles.append(template_chi_angles)\n    all_chi_masks.append(template_chi_mask)\n  chi_angles = jnp.stack(all_chi_angles, axis=0)\n  chi_mask = jnp.stack(all_chi_masks, axis=0)\n\n  template_features = jnp.concatenate([\n      aatype_one_hot,\n      jnp.sin(chi_angles) * chi_mask,\n      jnp.cos(chi_angles) * chi_mask,\n      chi_mask], axis=-1)\n\n  template_mask = chi_mask[:, :, 0]\n\n  if global_config.bfloat16:\n    template_features = template_features.astype(jnp.bfloat16)\n    template_mask = template_mask.astype(jnp.bfloat16)\n\n  template_activations = common_modules.Linear(\n      num_channel,\n      initializer='relu',\n      name='template_single_embedding')(\n          template_features)\n  template_activations = jax.nn.relu(template_activations)\n  template_activations = common_modules.Linear(\n      num_channel,\n      initializer='relu',\n      name='template_projection')(\n          template_activations)\n  return template_activations, template_mask\n"
  },
  {
    "path": "alphafold/model/prng.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"A collection of utilities surrounding PRNG usage in protein folding.\"\"\"\n\nimport haiku as hk\nimport jax\n\n\ndef safe_dropout(*, tensor, safe_key, rate, is_deterministic, is_training):\n  if is_training and rate != 0.0 and not is_deterministic:\n    return hk.dropout(safe_key.get(), rate, tensor)\n  else:\n    return tensor\n\n\nclass SafeKey:\n  \"\"\"Safety wrapper for PRNG keys.\"\"\"\n\n  def __init__(self, key):\n    self._key = key\n    self._used = False\n\n  def _assert_not_used(self):\n    if self._used:\n      raise RuntimeError('Random key has been used previously.')\n\n  def get(self):\n    self._assert_not_used()\n    self._used = True\n    return self._key\n\n  def split(self, num_keys=2):\n    self._assert_not_used()\n    self._used = True\n    new_keys = jax.random.split(self._key, num_keys)\n    return jax.tree_map(SafeKey, tuple(new_keys))\n\n  def duplicate(self, num_keys=2):\n    self._assert_not_used()\n    self._used = True\n    return tuple(SafeKey(self._key) for _ in range(num_keys))\n\n\ndef _safe_key_flatten(safe_key):\n  # Flatten transfers \"ownership\" to the tree\n  return (safe_key._key,), safe_key._used  # pylint: disable=protected-access\n\n\ndef _safe_key_unflatten(aux_data, children):\n  ret = SafeKey(children[0])\n  ret._used = aux_data  # pylint: disable=protected-access\n  return ret\n\n\njax.tree_util.register_pytree_node(\n    SafeKey, _safe_key_flatten, _safe_key_unflatten)\n\n"
  },
  {
    "path": "alphafold/model/prng_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for prng.\"\"\"\n\nfrom absl.testing import absltest\nfrom alphafold.model import prng\nimport jax\n\n\nclass PrngTest(absltest.TestCase):\n\n  def test_key_reuse(self):\n\n    init_key = jax.random.PRNGKey(42)\n    safe_key = prng.SafeKey(init_key)\n    _, safe_key = safe_key.split()\n\n    raw_key = safe_key.get()\n\n    self.assertNotEqual(raw_key[0], init_key[0])\n    self.assertNotEqual(raw_key[1], init_key[1])\n\n    with self.assertRaises(RuntimeError):\n      safe_key.get()\n\n    with self.assertRaises(RuntimeError):\n      safe_key.split()\n\n    with self.assertRaises(RuntimeError):\n      safe_key.duplicate()\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/model/quat_affine.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Quaternion geometry modules.\n\nThis introduces a representation of coordinate frames that is based around a\n‘QuatAffine’ object. This object describes an array of coordinate frames.\nIt consists of vectors corresponding to the\norigin of the frames as well as orientations which are stored in two\nways, as unit quaternions as well as a rotation matrices.\nThe rotation matrices are derived from the unit quaternions and the two are kept\nin sync.\nFor an explanation of the relation between unit quaternions and rotations see\nhttps://en.wikipedia.org/wiki/Quaternions_and_spatial_rotation\n\nThis representation is used in the model for the backbone frames.\n\nOne important thing to note here, is that while we update both representations\nthe jit compiler is going to ensure that only the parts that are\nactually used are executed.\n\"\"\"\n\n\nimport functools\nfrom typing import Tuple\n\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\n# pylint: disable=bad-whitespace\nQUAT_TO_ROT = np.zeros((4, 4, 3, 3), dtype=np.float32)\n\nQUAT_TO_ROT[0, 0] = [[ 1, 0, 0], [ 0, 1, 0], [ 0, 0, 1]]  # rr\nQUAT_TO_ROT[1, 1] = [[ 1, 0, 0], [ 0,-1, 0], [ 0, 0,-1]]  # ii\nQUAT_TO_ROT[2, 2] = [[-1, 0, 0], [ 0, 1, 0], [ 0, 0,-1]]  # jj\nQUAT_TO_ROT[3, 3] = [[-1, 0, 0], [ 0,-1, 0], [ 0, 0, 1]]  # kk\n\nQUAT_TO_ROT[1, 2] = [[ 0, 2, 0], [ 2, 0, 0], [ 0, 0, 0]]  # ij\nQUAT_TO_ROT[1, 3] = [[ 0, 0, 2], [ 0, 0, 0], [ 2, 0, 0]]  # ik\nQUAT_TO_ROT[2, 3] = [[ 0, 0, 0], [ 0, 0, 2], [ 0, 2, 0]]  # jk\n\nQUAT_TO_ROT[0, 1] = [[ 0, 0, 0], [ 0, 0,-2], [ 0, 2, 0]]  # ir\nQUAT_TO_ROT[0, 2] = [[ 0, 0, 2], [ 0, 0, 0], [-2, 0, 0]]  # jr\nQUAT_TO_ROT[0, 3] = [[ 0,-2, 0], [ 2, 0, 0], [ 0, 0, 0]]  # kr\n\nQUAT_MULTIPLY = np.zeros((4, 4, 4), dtype=np.float32)\nQUAT_MULTIPLY[:, :, 0] = [[ 1, 0, 0, 0],\n                          [ 0,-1, 0, 0],\n                          [ 0, 0,-1, 0],\n                          [ 0, 0, 0,-1]]\n\nQUAT_MULTIPLY[:, :, 1] = [[ 0, 1, 0, 0],\n                          [ 1, 0, 0, 0],\n                          [ 0, 0, 0, 1],\n                          [ 0, 0,-1, 0]]\n\nQUAT_MULTIPLY[:, :, 2] = [[ 0, 0, 1, 0],\n                          [ 0, 0, 0,-1],\n                          [ 1, 0, 0, 0],\n                          [ 0, 1, 0, 0]]\n\nQUAT_MULTIPLY[:, :, 3] = [[ 0, 0, 0, 1],\n                          [ 0, 0, 1, 0],\n                          [ 0,-1, 0, 0],\n                          [ 1, 0, 0, 0]]\n\nQUAT_MULTIPLY_BY_VEC = QUAT_MULTIPLY[:, 1:, :]\n# pylint: enable=bad-whitespace\n\n\ndef rot_to_quat(rot, unstack_inputs=False):\n  \"\"\"Convert rotation matrix to quaternion.\n\n  Note that this function calls self_adjoint_eig which is extremely expensive on\n  the GPU. If at all possible, this function should run on the CPU.\n\n  Args:\n     rot: rotation matrix (see below for format).\n     unstack_inputs:  If true, rotation matrix should be shape (..., 3, 3)\n       otherwise the rotation matrix should be a list of lists of tensors.\n\n  Returns:\n    Quaternion as (..., 4) tensor.\n  \"\"\"\n  if unstack_inputs:\n    rot = [jnp.moveaxis(x, -1, 0) for x in jnp.moveaxis(rot, -2, 0)]\n\n  [[xx, xy, xz], [yx, yy, yz], [zx, zy, zz]] = rot\n\n  # pylint: disable=bad-whitespace\n  k = [[ xx + yy + zz,      zy - yz,      xz - zx,      yx - xy,],\n       [      zy - yz, xx - yy - zz,      xy + yx,      xz + zx,],\n       [      xz - zx,      xy + yx, yy - xx - zz,      yz + zy,],\n       [      yx - xy,      xz + zx,      yz + zy, zz - xx - yy,]]\n  # pylint: enable=bad-whitespace\n\n  k = (1./3.) * jnp.stack([jnp.stack(x, axis=-1) for x in k],\n                          axis=-2)\n\n  # Get eigenvalues in non-decreasing order and associated.\n  _, qs = jnp.linalg.eigh(k)\n  return qs[..., -1]\n\n\ndef rot_list_to_tensor(rot_list):\n  \"\"\"Convert list of lists to rotation tensor.\"\"\"\n  return jnp.stack(\n      [jnp.stack(rot_list[0], axis=-1),\n       jnp.stack(rot_list[1], axis=-1),\n       jnp.stack(rot_list[2], axis=-1)],\n      axis=-2)\n\n\ndef vec_list_to_tensor(vec_list):\n  \"\"\"Convert list to vector tensor.\"\"\"\n  return jnp.stack(vec_list, axis=-1)\n\n\ndef quat_to_rot(normalized_quat):\n  \"\"\"Convert a normalized quaternion to a rotation matrix.\"\"\"\n  rot_tensor = jnp.sum(\n      np.reshape(QUAT_TO_ROT, (4, 4, 9)) *\n      normalized_quat[..., :, None, None] *\n      normalized_quat[..., None, :, None],\n      axis=(-3, -2))\n  rot = jnp.moveaxis(rot_tensor, -1, 0)  # Unstack.\n  return [[rot[0], rot[1], rot[2]],\n          [rot[3], rot[4], rot[5]],\n          [rot[6], rot[7], rot[8]]]\n\n\ndef quat_multiply_by_vec(quat, vec):\n  \"\"\"Multiply a quaternion by a pure-vector quaternion.\"\"\"\n  return jnp.sum(\n      QUAT_MULTIPLY_BY_VEC *\n      quat[..., :, None, None] *\n      vec[..., None, :, None],\n      axis=(-3, -2))\n\n\ndef quat_multiply(quat1, quat2):\n  \"\"\"Multiply a quaternion by another quaternion.\"\"\"\n  return jnp.sum(\n      QUAT_MULTIPLY *\n      quat1[..., :, None, None] *\n      quat2[..., None, :, None],\n      axis=(-3, -2))\n\n\ndef apply_rot_to_vec(rot, vec, unstack=False):\n  \"\"\"Multiply rotation matrix by a vector.\"\"\"\n  if unstack:\n    x, y, z = [vec[:, i] for i in range(3)]\n  else:\n    x, y, z = vec\n  return [rot[0][0] * x + rot[0][1] * y + rot[0][2] * z,\n          rot[1][0] * x + rot[1][1] * y + rot[1][2] * z,\n          rot[2][0] * x + rot[2][1] * y + rot[2][2] * z]\n\n\ndef apply_inverse_rot_to_vec(rot, vec):\n  \"\"\"Multiply the inverse of a rotation matrix by a vector.\"\"\"\n  # Inverse rotation is just transpose\n  return [rot[0][0] * vec[0] + rot[1][0] * vec[1] + rot[2][0] * vec[2],\n          rot[0][1] * vec[0] + rot[1][1] * vec[1] + rot[2][1] * vec[2],\n          rot[0][2] * vec[0] + rot[1][2] * vec[1] + rot[2][2] * vec[2]]\n\n\nclass QuatAffine(object):\n  \"\"\"Affine transformation represented by quaternion and vector.\"\"\"\n\n  def __init__(self, quaternion, translation, rotation=None, normalize=True,\n               unstack_inputs=False):\n    \"\"\"Initialize from quaternion and translation.\n\n    Args:\n      quaternion: Rotation represented by a quaternion, to be applied\n        before translation.  Must be a unit quaternion unless normalize==True.\n      translation: Translation represented as a vector.\n      rotation: Same rotation as the quaternion, represented as a (..., 3, 3)\n        tensor.  If None, rotation will be calculated from the quaternion.\n      normalize: If True, l2 normalize the quaternion on input.\n      unstack_inputs: If True, translation is a vector with last component 3\n    \"\"\"\n\n    if quaternion is not None:\n      assert quaternion.shape[-1] == 4\n\n    if unstack_inputs:\n      if rotation is not None:\n        rotation = [jnp.moveaxis(x, -1, 0)   # Unstack.\n                    for x in jnp.moveaxis(rotation, -2, 0)]  # Unstack.\n      translation = jnp.moveaxis(translation, -1, 0)  # Unstack.\n\n    if normalize and quaternion is not None:\n      quaternion = quaternion / jnp.linalg.norm(quaternion, axis=-1,\n                                                keepdims=True)\n\n    if rotation is None:\n      rotation = quat_to_rot(quaternion)\n\n    self.quaternion = quaternion\n    self.rotation = [list(row) for row in rotation]\n    self.translation = list(translation)\n\n    assert all(len(row) == 3 for row in self.rotation)\n    assert len(self.translation) == 3\n\n  def to_tensor(self):\n    return jnp.concatenate(\n        [self.quaternion] +\n        [jnp.expand_dims(x, axis=-1) for x in self.translation],\n        axis=-1)\n\n  def apply_tensor_fn(self, tensor_fn):\n    \"\"\"Return a new QuatAffine with tensor_fn applied (e.g. stop_gradient).\"\"\"\n    return QuatAffine(\n        tensor_fn(self.quaternion),\n        [tensor_fn(x) for x in self.translation],\n        rotation=[[tensor_fn(x) for x in row] for row in self.rotation],\n        normalize=False)\n\n  def apply_rotation_tensor_fn(self, tensor_fn):\n    \"\"\"Return a new QuatAffine with tensor_fn applied to the rotation part.\"\"\"\n    return QuatAffine(\n        tensor_fn(self.quaternion),\n        [x for x in self.translation],\n        rotation=[[tensor_fn(x) for x in row] for row in self.rotation],\n        normalize=False)\n\n  def scale_translation(self, position_scale):\n    \"\"\"Return a new quat affine with a different scale for translation.\"\"\"\n\n    return QuatAffine(\n        self.quaternion,\n        [x * position_scale for x in self.translation],\n        rotation=[[x for x in row] for row in self.rotation],\n        normalize=False)\n\n  @classmethod\n  def from_tensor(cls, tensor, normalize=False):\n    quaternion, tx, ty, tz = jnp.split(tensor, [4, 5, 6], axis=-1)\n    return cls(quaternion,\n               [tx[..., 0], ty[..., 0], tz[..., 0]],\n               normalize=normalize)\n\n  def pre_compose(self, update):\n    \"\"\"Return a new QuatAffine which applies the transformation update first.\n\n    Args:\n      update: Length-6 vector. 3-vector of x, y, and z such that the quaternion\n        update is (1, x, y, z) and zero for the 3-vector is the identity\n        quaternion. 3-vector for translation concatenated.\n\n    Returns:\n      New QuatAffine object.\n    \"\"\"\n    vector_quaternion_update, x, y, z = jnp.split(update, [3, 4, 5], axis=-1)\n    trans_update = [jnp.squeeze(x, axis=-1),\n                    jnp.squeeze(y, axis=-1),\n                    jnp.squeeze(z, axis=-1)]\n\n    new_quaternion = (self.quaternion +\n                      quat_multiply_by_vec(self.quaternion,\n                                           vector_quaternion_update))\n\n    trans_update = apply_rot_to_vec(self.rotation, trans_update)\n    new_translation = [\n        self.translation[0] + trans_update[0],\n        self.translation[1] + trans_update[1],\n        self.translation[2] + trans_update[2]]\n\n    return QuatAffine(new_quaternion, new_translation)\n\n  def apply_to_point(self, point, extra_dims=0):\n    \"\"\"Apply affine to a point.\n\n    Args:\n      point: List of 3 tensors to apply affine.\n      extra_dims:  Number of dimensions at the end of the transformed_point\n        shape that are not present in the rotation and translation.  The most\n        common use is rotation N points at once with extra_dims=1 for use in a\n        network.\n\n    Returns:\n      Transformed point after applying affine.\n    \"\"\"\n    rotation = self.rotation\n    translation = self.translation\n    for _ in range(extra_dims):\n      expand_fn = functools.partial(jnp.expand_dims, axis=-1)\n      rotation = jax.tree_map(expand_fn, rotation)\n      translation = jax.tree_map(expand_fn, translation)\n\n    rot_point = apply_rot_to_vec(rotation, point)\n    return [\n        rot_point[0] + translation[0],\n        rot_point[1] + translation[1],\n        rot_point[2] + translation[2]]\n\n  def invert_point(self, transformed_point, extra_dims=0):\n    \"\"\"Apply inverse of transformation to a point.\n\n    Args:\n      transformed_point: List of 3 tensors to apply affine\n      extra_dims:  Number of dimensions at the end of the transformed_point\n        shape that are not present in the rotation and translation.  The most\n        common use is rotation N points at once with extra_dims=1 for use in a\n        network.\n\n    Returns:\n      Transformed point after applying affine.\n    \"\"\"\n    rotation = self.rotation\n    translation = self.translation\n    for _ in range(extra_dims):\n      expand_fn = functools.partial(jnp.expand_dims, axis=-1)\n      rotation = jax.tree_map(expand_fn, rotation)\n      translation = jax.tree_map(expand_fn, translation)\n\n    rot_point = [\n        transformed_point[0] - translation[0],\n        transformed_point[1] - translation[1],\n        transformed_point[2] - translation[2]]\n\n    return apply_inverse_rot_to_vec(rotation, rot_point)\n\n  def __repr__(self):\n    return 'QuatAffine(%r, %r)' % (self.quaternion, self.translation)\n\n\ndef _multiply(a, b):\n  return jnp.stack([\n      jnp.array([a[0][0]*b[0][0] + a[0][1]*b[1][0] + a[0][2]*b[2][0],\n                 a[0][0]*b[0][1] + a[0][1]*b[1][1] + a[0][2]*b[2][1],\n                 a[0][0]*b[0][2] + a[0][1]*b[1][2] + a[0][2]*b[2][2]]),\n\n      jnp.array([a[1][0]*b[0][0] + a[1][1]*b[1][0] + a[1][2]*b[2][0],\n                 a[1][0]*b[0][1] + a[1][1]*b[1][1] + a[1][2]*b[2][1],\n                 a[1][0]*b[0][2] + a[1][1]*b[1][2] + a[1][2]*b[2][2]]),\n\n      jnp.array([a[2][0]*b[0][0] + a[2][1]*b[1][0] + a[2][2]*b[2][0],\n                 a[2][0]*b[0][1] + a[2][1]*b[1][1] + a[2][2]*b[2][1],\n                 a[2][0]*b[0][2] + a[2][1]*b[1][2] + a[2][2]*b[2][2]])])\n\n\ndef make_canonical_transform(\n    n_xyz: jnp.ndarray,\n    ca_xyz: jnp.ndarray,\n    c_xyz: jnp.ndarray) -> Tuple[jnp.ndarray, jnp.ndarray]:\n  \"\"\"Returns translation and rotation matrices to canonicalize residue atoms.\n\n  Note that this method does not take care of symmetries. If you provide the\n  atom positions in the non-standard way, the N atom will end up not at\n  [-0.527250, 1.359329, 0.0] but instead at [-0.527250, -1.359329, 0.0]. You\n  need to take care of such cases in your code.\n\n  Args:\n    n_xyz: An array of shape [batch, 3] of nitrogen xyz coordinates.\n    ca_xyz: An array of shape [batch, 3] of carbon alpha xyz coordinates.\n    c_xyz: An array of shape [batch, 3] of carbon xyz coordinates.\n\n  Returns:\n    A tuple (translation, rotation) where:\n      translation is an array of shape [batch, 3] defining the translation.\n      rotation is an array of shape [batch, 3, 3] defining the rotation.\n    After applying the translation and rotation to all atoms in a residue:\n      * All atoms will be shifted so that CA is at the origin,\n      * All atoms will be rotated so that C is at the x-axis,\n      * All atoms will be shifted so that N is in the xy plane.\n  \"\"\"\n  assert len(n_xyz.shape) == 2, n_xyz.shape\n  assert n_xyz.shape[-1] == 3, n_xyz.shape\n  assert n_xyz.shape == ca_xyz.shape == c_xyz.shape, (\n      n_xyz.shape, ca_xyz.shape, c_xyz.shape)\n\n  # Place CA at the origin.\n  translation = -ca_xyz\n  n_xyz = n_xyz + translation\n  c_xyz = c_xyz + translation\n\n  # Place C on the x-axis.\n  c_x, c_y, c_z = [c_xyz[:, i] for i in range(3)]\n  # Rotate by angle c1 in the x-y plane (around the z-axis).\n  sin_c1 = -c_y / jnp.sqrt(1e-20 + c_x**2 + c_y**2)\n  cos_c1 = c_x / jnp.sqrt(1e-20 + c_x**2 + c_y**2)\n  zeros = jnp.zeros_like(sin_c1)\n  ones = jnp.ones_like(sin_c1)\n  # pylint: disable=bad-whitespace\n  c1_rot_matrix = jnp.stack([jnp.array([cos_c1, -sin_c1, zeros]),\n                             jnp.array([sin_c1,  cos_c1, zeros]),\n                             jnp.array([zeros,    zeros,  ones])])\n\n  # Rotate by angle c2 in the x-z plane (around the y-axis).\n  sin_c2 = c_z / jnp.sqrt(1e-20 + c_x**2 + c_y**2 + c_z**2)\n  cos_c2 = jnp.sqrt(c_x**2 + c_y**2) / jnp.sqrt(\n      1e-20 + c_x**2 + c_y**2 + c_z**2)\n  c2_rot_matrix = jnp.stack([jnp.array([cos_c2,  zeros, sin_c2]),\n                             jnp.array([zeros,    ones,  zeros]),\n                             jnp.array([-sin_c2, zeros, cos_c2])])\n\n  c_rot_matrix = _multiply(c2_rot_matrix, c1_rot_matrix)\n  n_xyz = jnp.stack(apply_rot_to_vec(c_rot_matrix, n_xyz, unstack=True)).T\n\n  # Place N in the x-y plane.\n  _, n_y, n_z = [n_xyz[:, i] for i in range(3)]\n  # Rotate by angle alpha in the y-z plane (around the x-axis).\n  sin_n = -n_z / jnp.sqrt(1e-20 + n_y**2 + n_z**2)\n  cos_n = n_y / jnp.sqrt(1e-20 + n_y**2 + n_z**2)\n  n_rot_matrix = jnp.stack([jnp.array([ones,  zeros,  zeros]),\n                            jnp.array([zeros, cos_n, -sin_n]),\n                            jnp.array([zeros, sin_n,  cos_n])])\n  # pylint: enable=bad-whitespace\n\n  return (translation,\n          jnp.transpose(_multiply(n_rot_matrix, c_rot_matrix), [2, 0, 1]))\n\n\ndef make_transform_from_reference(\n    n_xyz: jnp.ndarray,\n    ca_xyz: jnp.ndarray,\n    c_xyz: jnp.ndarray) -> Tuple[jnp.ndarray, jnp.ndarray]:\n  \"\"\"Returns rotation and translation matrices to convert from reference.\n\n  Note that this method does not take care of symmetries. If you provide the\n  atom positions in the non-standard way, the N atom will end up not at\n  [-0.527250, 1.359329, 0.0] but instead at [-0.527250, -1.359329, 0.0]. You\n  need to take care of such cases in your code.\n\n  Args:\n    n_xyz: An array of shape [batch, 3] of nitrogen xyz coordinates.\n    ca_xyz: An array of shape [batch, 3] of carbon alpha xyz coordinates.\n    c_xyz: An array of shape [batch, 3] of carbon xyz coordinates.\n\n  Returns:\n    A tuple (rotation, translation) where:\n      rotation is an array of shape [batch, 3, 3] defining the rotation.\n      translation is an array of shape [batch, 3] defining the translation.\n    After applying the translation and rotation to the reference backbone,\n    the coordinates will approximately equal to the input coordinates.\n\n    The order of translation and rotation differs from make_canonical_transform\n    because the rotation from this function should be applied before the\n    translation, unlike make_canonical_transform.\n  \"\"\"\n  translation, rotation = make_canonical_transform(n_xyz, ca_xyz, c_xyz)\n  return np.transpose(rotation, (0, 2, 1)), -translation\n"
  },
  {
    "path": "alphafold/model/quat_affine_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for quat_affine.\"\"\"\n\nfrom absl import logging\nfrom absl.testing import absltest\nfrom alphafold.model import quat_affine\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\nVERBOSE = False\nnp.set_printoptions(precision=3, suppress=True)\n\nr2t = quat_affine.rot_list_to_tensor\nv2t = quat_affine.vec_list_to_tensor\n\nq2r = lambda q: r2t(quat_affine.quat_to_rot(q))\n\n\nclass QuatAffineTest(absltest.TestCase):\n\n  def _assert_check(self, to_check, tol=1e-5):\n    for k, (correct, generated) in to_check.items():\n      if VERBOSE:\n        logging.info(k)\n        logging.info('Correct %s', correct)\n        logging.info('Predicted %s', generated)\n      self.assertLess(np.max(np.abs(correct - generated)), tol)\n\n  def test_conversion(self):\n    quat = jnp.array([-2., 5., -1., 4.])\n\n    rotation = jnp.array([\n        [0.26087, 0.130435, 0.956522],\n        [-0.565217, -0.782609, 0.26087],\n        [0.782609, -0.608696, -0.130435]])\n\n    translation = jnp.array([1., -3., 4.])\n    point = jnp.array([0.7, 3.2, -2.9])\n\n    a = quat_affine.QuatAffine(quat, translation, unstack_inputs=True)\n    true_new_point = jnp.matmul(rotation, point[:, None])[:, 0] + translation\n\n    self._assert_check({\n        'rot': (rotation, r2t(a.rotation)),\n        'trans': (translation, v2t(a.translation)),\n        'point': (true_new_point,\n                  v2t(a.apply_to_point(jnp.moveaxis(point, -1, 0)))),\n        # Because of the double cover, we must be careful and compare rotations\n        'quat': (q2r(a.quaternion),\n                 q2r(quat_affine.rot_to_quat(a.rotation))),\n\n    })\n\n  def test_double_cover(self):\n    \"\"\"Test that -q is the same rotation as q.\"\"\"\n    rng = jax.random.PRNGKey(42)\n    keys = jax.random.split(rng)\n    q = jax.random.normal(keys[0], (2, 4))\n    trans = jax.random.normal(keys[1], (2, 3))\n    a1 = quat_affine.QuatAffine(q, trans, unstack_inputs=True)\n    a2 = quat_affine.QuatAffine(-q, trans, unstack_inputs=True)\n\n    self._assert_check({\n        'rot': (r2t(a1.rotation),\n                r2t(a2.rotation)),\n        'trans': (v2t(a1.translation),\n                  v2t(a2.translation)),\n    })\n\n  def test_homomorphism(self):\n    rng = jax.random.PRNGKey(42)\n    keys = jax.random.split(rng, 4)\n    vec_q1 = jax.random.normal(keys[0], (2, 3))\n\n    q1 = jnp.concatenate([\n        jnp.ones_like(vec_q1)[:, :1],\n        vec_q1], axis=-1)\n\n    q2 = jax.random.normal(keys[1], (2, 4))\n    t1 = jax.random.normal(keys[2], (2, 3))\n    t2 = jax.random.normal(keys[3], (2, 3))\n\n    a1 = quat_affine.QuatAffine(q1, t1, unstack_inputs=True)\n    a2 = quat_affine.QuatAffine(q2, t2, unstack_inputs=True)\n    a21 = a2.pre_compose(jnp.concatenate([vec_q1, t1], axis=-1))\n\n    rng, key = jax.random.split(rng)\n    x = jax.random.normal(key, (2, 3))\n    new_x = a21.apply_to_point(jnp.moveaxis(x, -1, 0))\n    new_x_apply2 = a2.apply_to_point(a1.apply_to_point(jnp.moveaxis(x, -1, 0)))\n\n    self._assert_check({\n        'quat': (q2r(quat_affine.quat_multiply(a2.quaternion, a1.quaternion)),\n                 q2r(a21.quaternion)),\n        'rot': (jnp.matmul(r2t(a2.rotation), r2t(a1.rotation)),\n                r2t(a21.rotation)),\n        'point': (v2t(new_x_apply2),\n                  v2t(new_x)),\n        'inverse': (x, v2t(a21.invert_point(new_x))),\n    })\n\n  def test_batching(self):\n    \"\"\"Test that affine applies batchwise.\"\"\"\n    rng = jax.random.PRNGKey(42)\n    keys = jax.random.split(rng, 3)\n    q = jax.random.uniform(keys[0], (5, 2, 4))\n    t = jax.random.uniform(keys[1], (2, 3))\n    x = jax.random.uniform(keys[2], (5, 1, 3))\n\n    a = quat_affine.QuatAffine(q, t, unstack_inputs=True)\n    y = v2t(a.apply_to_point(jnp.moveaxis(x, -1, 0)))\n\n    y_list = []\n    for i in range(5):\n      for j in range(2):\n        a_local = quat_affine.QuatAffine(q[i, j], t[j],\n                                         unstack_inputs=True)\n        y_local = v2t(a_local.apply_to_point(jnp.moveaxis(x[i, 0], -1, 0)))\n        y_list.append(y_local)\n    y_combine = jnp.reshape(jnp.stack(y_list, axis=0), (5, 2, 3))\n\n    self._assert_check({\n        'batch': (y_combine, y),\n        'quat': (q2r(a.quaternion),\n                 q2r(quat_affine.rot_to_quat(a.rotation))),\n    })\n\n  def assertAllClose(self, a, b, rtol=1e-06, atol=1e-06):\n    self.assertTrue(np.allclose(a, b, rtol=rtol, atol=atol))\n\n  def assertAllEqual(self, a, b):\n    self.assertTrue(np.all(np.array(a) == np.array(b)))\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/model/r3.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Transformations for 3D coordinates.\n\nThis Module contains objects for representing Vectors (Vecs), Rotation Matrices\n(Rots) and proper Rigid transformation (Rigids). These are represented as\nnamed tuples with arrays for each entry, for example a set of\n[N, M] points would be represented as a Vecs object with arrays of shape [N, M]\nfor x, y and z.\n\nThis is being done to improve readability by making it very clear what objects\nare geometric objects rather than relying on comments and array shapes.\nAnother reason for this is to avoid using matrix\nmultiplication primitives like matmul or einsum, on modern accelerator hardware\nthese can end up on specialized cores such as tensor cores on GPU or the MXU on\ncloud TPUs, this often involves lower computational precision which can be\nproblematic for coordinate geometry. Also these cores are typically optimized\nfor larger matrices than 3 dimensional, this code is written to avoid any\nunintended use of these cores on both GPUs and TPUs.\n\"\"\"\n\nimport collections\nfrom typing import List\nfrom alphafold.model import quat_affine\nimport jax.numpy as jnp\nimport tree\n\n# Array of 3-component vectors, stored as individual array for\n# each component.\nVecs = collections.namedtuple('Vecs', ['x', 'y', 'z'])\n\n# Array of 3x3 rotation matrices, stored as individual array for\n# each component.\nRots = collections.namedtuple('Rots', ['xx', 'xy', 'xz',\n                                       'yx', 'yy', 'yz',\n                                       'zx', 'zy', 'zz'])\n# Array of rigid 3D transformations, stored as array of rotations and\n# array of translations.\nRigids = collections.namedtuple('Rigids', ['rot', 'trans'])\n\n\ndef squared_difference(x, y):\n  return jnp.square(x - y)\n\n\ndef invert_rigids(r: Rigids) -> Rigids:\n  \"\"\"Computes group inverse of rigid transformations 'r'.\"\"\"\n  inv_rots = invert_rots(r.rot)\n  t = rots_mul_vecs(inv_rots, r.trans)\n  inv_trans = Vecs(-t.x, -t.y, -t.z)\n  return Rigids(inv_rots, inv_trans)\n\n\ndef invert_rots(m: Rots) -> Rots:\n  \"\"\"Computes inverse of rotations 'm'.\"\"\"\n  return Rots(m.xx, m.yx, m.zx,\n              m.xy, m.yy, m.zy,\n              m.xz, m.yz, m.zz)\n\n\ndef rigids_from_3_points(\n    point_on_neg_x_axis: Vecs,  # shape (...)\n    origin: Vecs,  # shape (...)\n    point_on_xy_plane: Vecs,  # shape (...)\n) -> Rigids:  # shape (...)\n  \"\"\"Create Rigids from 3 points.\n\n  Jumper et al. (2021) Suppl. Alg. 21 \"rigidFrom3Points\"\n  This creates a set of rigid transformations from 3 points by Gram Schmidt\n  orthogonalization.\n\n  Args:\n    point_on_neg_x_axis: Vecs corresponding to points on the negative x axis\n    origin: Origin of resulting rigid transformations\n    point_on_xy_plane: Vecs corresponding to points in the xy plane\n  Returns:\n    Rigid transformations from global frame to local frames derived from\n    the input points.\n  \"\"\"\n  m = rots_from_two_vecs(\n      e0_unnormalized=vecs_sub(origin, point_on_neg_x_axis),\n      e1_unnormalized=vecs_sub(point_on_xy_plane, origin))\n\n  return Rigids(rot=m, trans=origin)\n\n\ndef rigids_from_list(l: List[jnp.ndarray]) -> Rigids:\n  \"\"\"Converts flat list of arrays to rigid transformations.\"\"\"\n  assert len(l) == 12\n  return Rigids(Rots(*(l[:9])), Vecs(*(l[9:])))\n\n\ndef rigids_from_quataffine(a: quat_affine.QuatAffine) -> Rigids:\n  \"\"\"Converts QuatAffine object to the corresponding Rigids object.\"\"\"\n  return Rigids(Rots(*tree.flatten(a.rotation)),\n                Vecs(*a.translation))\n\n\ndef rigids_from_tensor4x4(\n    m: jnp.ndarray  # shape (..., 4, 4)\n) -> Rigids:  # shape (...)\n  \"\"\"Construct Rigids object from an 4x4 array.\n\n  Here the 4x4 is representing the transformation in homogeneous coordinates.\n\n  Args:\n    m: Array representing transformations in homogeneous coordinates.\n  Returns:\n    Rigids object corresponding to transformations m\n  \"\"\"\n  assert m.shape[-1] == 4\n  assert m.shape[-2] == 4\n  return Rigids(\n      Rots(m[..., 0, 0], m[..., 0, 1], m[..., 0, 2],\n           m[..., 1, 0], m[..., 1, 1], m[..., 1, 2],\n           m[..., 2, 0], m[..., 2, 1], m[..., 2, 2]),\n      Vecs(m[..., 0, 3], m[..., 1, 3], m[..., 2, 3]))\n\n\ndef rigids_from_tensor_flat9(\n    m: jnp.ndarray  # shape (..., 9)\n) -> Rigids:  # shape (...)\n  \"\"\"Flat9 encoding: first two columns of rotation matrix + translation.\"\"\"\n  assert m.shape[-1] == 9\n  e0 = Vecs(m[..., 0], m[..., 1], m[..., 2])\n  e1 = Vecs(m[..., 3], m[..., 4], m[..., 5])\n  trans = Vecs(m[..., 6], m[..., 7], m[..., 8])\n  return Rigids(rot=rots_from_two_vecs(e0, e1),\n                trans=trans)\n\n\ndef rigids_from_tensor_flat12(\n    m: jnp.ndarray  # shape (..., 12)\n) -> Rigids:  # shape (...)\n  \"\"\"Flat12 encoding: rotation matrix (9 floats) + translation (3 floats).\"\"\"\n  assert m.shape[-1] == 12\n  x = jnp.moveaxis(m, -1, 0)  # Unstack\n  return Rigids(Rots(*x[:9]), Vecs(*x[9:]))\n\n\ndef rigids_mul_rigids(a: Rigids, b: Rigids) -> Rigids:\n  \"\"\"Group composition of Rigids 'a' and 'b'.\"\"\"\n  return Rigids(\n      rots_mul_rots(a.rot, b.rot),\n      vecs_add(a.trans, rots_mul_vecs(a.rot, b.trans)))\n\n\ndef rigids_mul_rots(r: Rigids, m: Rots) -> Rigids:\n  \"\"\"Compose rigid transformations 'r' with rotations 'm'.\"\"\"\n  return Rigids(rots_mul_rots(r.rot, m), r.trans)\n\n\ndef rigids_mul_vecs(r: Rigids, v: Vecs) -> Vecs:\n  \"\"\"Apply rigid transforms 'r' to points 'v'.\"\"\"\n  return vecs_add(rots_mul_vecs(r.rot, v), r.trans)\n\n\ndef rigids_to_list(r: Rigids) -> List[jnp.ndarray]:\n  \"\"\"Turn Rigids into flat list, inverse of 'rigids_from_list'.\"\"\"\n  return list(r.rot) + list(r.trans)\n\n\ndef rigids_to_quataffine(r: Rigids) -> quat_affine.QuatAffine:\n  \"\"\"Convert Rigids r into QuatAffine, inverse of 'rigids_from_quataffine'.\"\"\"\n  return quat_affine.QuatAffine(\n      quaternion=None,\n      rotation=[[r.rot.xx, r.rot.xy, r.rot.xz],\n                [r.rot.yx, r.rot.yy, r.rot.yz],\n                [r.rot.zx, r.rot.zy, r.rot.zz]],\n      translation=[r.trans.x, r.trans.y, r.trans.z])\n\n\ndef rigids_to_tensor_flat9(\n    r: Rigids  # shape (...)\n) -> jnp.ndarray:  # shape (..., 9)\n  \"\"\"Flat9 encoding: first two columns of rotation matrix + translation.\"\"\"\n  return jnp.stack(\n      [r.rot.xx, r.rot.yx, r.rot.zx, r.rot.xy, r.rot.yy, r.rot.zy]\n      + list(r.trans), axis=-1)\n\n\ndef rigids_to_tensor_flat12(\n    r: Rigids  # shape (...)\n) -> jnp.ndarray:  # shape (..., 12)\n  \"\"\"Flat12 encoding: rotation matrix (9 floats) + translation (3 floats).\"\"\"\n  return jnp.stack(list(r.rot) + list(r.trans), axis=-1)\n\n\ndef rots_from_tensor3x3(\n    m: jnp.ndarray,  # shape (..., 3, 3)\n) -> Rots:  # shape (...)\n  \"\"\"Convert rotations represented as (3, 3) array to Rots.\"\"\"\n  assert m.shape[-1] == 3\n  assert m.shape[-2] == 3\n  return Rots(m[..., 0, 0], m[..., 0, 1], m[..., 0, 2],\n              m[..., 1, 0], m[..., 1, 1], m[..., 1, 2],\n              m[..., 2, 0], m[..., 2, 1], m[..., 2, 2])\n\n\ndef rots_from_two_vecs(e0_unnormalized: Vecs, e1_unnormalized: Vecs) -> Rots:\n  \"\"\"Create rotation matrices from unnormalized vectors for the x and y-axes.\n\n  This creates a rotation matrix from two vectors using Gram-Schmidt\n  orthogonalization.\n\n  Args:\n    e0_unnormalized: vectors lying along x-axis of resulting rotation\n    e1_unnormalized: vectors lying in xy-plane of resulting rotation\n  Returns:\n    Rotations resulting from Gram-Schmidt procedure.\n  \"\"\"\n  # Normalize the unit vector for the x-axis, e0.\n  e0 = vecs_robust_normalize(e0_unnormalized)\n\n  # make e1 perpendicular to e0.\n  c = vecs_dot_vecs(e1_unnormalized, e0)\n  e1 = Vecs(e1_unnormalized.x - c * e0.x,\n            e1_unnormalized.y - c * e0.y,\n            e1_unnormalized.z - c * e0.z)\n  e1 = vecs_robust_normalize(e1)\n\n  # Compute e2 as cross product of e0 and e1.\n  e2 = vecs_cross_vecs(e0, e1)\n\n  return Rots(e0.x, e1.x, e2.x, e0.y, e1.y, e2.y, e0.z, e1.z, e2.z)\n\n\ndef rots_mul_rots(a: Rots, b: Rots) -> Rots:\n  \"\"\"Composition of rotations 'a' and 'b'.\"\"\"\n  c0 = rots_mul_vecs(a, Vecs(b.xx, b.yx, b.zx))\n  c1 = rots_mul_vecs(a, Vecs(b.xy, b.yy, b.zy))\n  c2 = rots_mul_vecs(a, Vecs(b.xz, b.yz, b.zz))\n  return Rots(c0.x, c1.x, c2.x, c0.y, c1.y, c2.y, c0.z, c1.z, c2.z)\n\n\ndef rots_mul_vecs(m: Rots, v: Vecs) -> Vecs:\n  \"\"\"Apply rotations 'm' to vectors 'v'.\"\"\"\n  return Vecs(m.xx * v.x + m.xy * v.y + m.xz * v.z,\n              m.yx * v.x + m.yy * v.y + m.yz * v.z,\n              m.zx * v.x + m.zy * v.y + m.zz * v.z)\n\n\ndef vecs_add(v1: Vecs, v2: Vecs) -> Vecs:\n  \"\"\"Add two vectors 'v1' and 'v2'.\"\"\"\n  return Vecs(v1.x + v2.x, v1.y + v2.y, v1.z + v2.z)\n\n\ndef vecs_dot_vecs(v1: Vecs, v2: Vecs) -> jnp.ndarray:\n  \"\"\"Dot product of vectors 'v1' and 'v2'.\"\"\"\n  return v1.x * v2.x + v1.y * v2.y + v1.z * v2.z\n\n\ndef vecs_cross_vecs(v1: Vecs, v2: Vecs) -> Vecs:\n  \"\"\"Cross product of vectors 'v1' and 'v2'.\"\"\"\n  return Vecs(v1.y * v2.z - v1.z * v2.y,\n              v1.z * v2.x - v1.x * v2.z,\n              v1.x * v2.y - v1.y * v2.x)\n\n\ndef vecs_from_tensor(x: jnp.ndarray  # shape (..., 3)\n                    ) -> Vecs:  # shape (...)\n  \"\"\"Converts from tensor of shape (3,) to Vecs.\"\"\"\n  num_components = x.shape[-1]\n  assert num_components == 3\n  return Vecs(x[..., 0], x[..., 1], x[..., 2])\n\n\ndef vecs_robust_normalize(v: Vecs, epsilon: float = 1e-8) -> Vecs:\n  \"\"\"Normalizes vectors 'v'.\n\n  Args:\n    v: vectors to be normalized.\n    epsilon: small regularizer added to squared norm before taking square root.\n  Returns:\n    normalized vectors\n  \"\"\"\n  norms = vecs_robust_norm(v, epsilon)\n  return Vecs(v.x / norms, v.y / norms, v.z / norms)\n\n\ndef vecs_robust_norm(v: Vecs, epsilon: float = 1e-8) -> jnp.ndarray:\n  \"\"\"Computes norm of vectors 'v'.\n\n  Args:\n    v: vectors to be normalized.\n    epsilon: small regularizer added to squared norm before taking square root.\n  Returns:\n    norm of 'v'\n  \"\"\"\n  return jnp.sqrt(jnp.square(v.x) + jnp.square(v.y) + jnp.square(v.z) + epsilon)\n\n\ndef vecs_sub(v1: Vecs, v2: Vecs) -> Vecs:\n  \"\"\"Computes v1 - v2.\"\"\"\n  return Vecs(v1.x - v2.x, v1.y - v2.y, v1.z - v2.z)\n\n\ndef vecs_squared_distance(v1: Vecs, v2: Vecs) -> jnp.ndarray:\n  \"\"\"Computes squared euclidean difference between 'v1' and 'v2'.\"\"\"\n  return (squared_difference(v1.x, v2.x) +\n          squared_difference(v1.y, v2.y) +\n          squared_difference(v1.z, v2.z))\n\n\ndef vecs_to_tensor(v: Vecs  # shape (...)\n                  ) -> jnp.ndarray:  # shape(..., 3)\n  \"\"\"Converts 'v' to tensor with shape 3, inverse of 'vecs_from_tensor'.\"\"\"\n  return jnp.stack([v.x, v.y, v.z], axis=-1)\n"
  },
  {
    "path": "alphafold/model/tf/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Alphafold model TensorFlow code.\"\"\"\n"
  },
  {
    "path": "alphafold/model/tf/data_transforms.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Data for AlphaFold.\"\"\"\n\nfrom alphafold.common import residue_constants\nfrom alphafold.model.tf import shape_helpers\nfrom alphafold.model.tf import shape_placeholders\nfrom alphafold.model.tf import utils\nimport numpy as np\nimport tensorflow.compat.v1 as tf\n\n# Pylint gets confused by the curry1 decorator because it changes the number\n#   of arguments to the function.\n# pylint:disable=no-value-for-parameter\n\n\nNUM_RES = shape_placeholders.NUM_RES\nNUM_MSA_SEQ = shape_placeholders.NUM_MSA_SEQ\nNUM_EXTRA_SEQ = shape_placeholders.NUM_EXTRA_SEQ\nNUM_TEMPLATES = shape_placeholders.NUM_TEMPLATES\n\n\ndef cast_64bit_ints(protein):\n\n  for k, v in protein.items():\n    if v.dtype == tf.int64:\n      protein[k] = tf.cast(v, tf.int32)\n  return protein\n\n\n_MSA_FEATURE_NAMES = [\n    'msa', 'deletion_matrix', 'msa_mask', 'msa_row_mask', 'bert_mask',\n    'true_msa'\n]\n\n\ndef make_seq_mask(protein):\n  protein['seq_mask'] = tf.ones(\n      shape_helpers.shape_list(protein['aatype']), dtype=tf.float32)\n  return protein\n\n\ndef make_template_mask(protein):\n  protein['template_mask'] = tf.ones(\n      shape_helpers.shape_list(protein['template_domain_names']),\n      dtype=tf.float32)\n  return protein\n\n\ndef curry1(f):\n  \"\"\"Supply all arguments but the first.\"\"\"\n\n  def fc(*args, **kwargs):\n    return lambda x: f(x, *args, **kwargs)\n\n  return fc\n\n\n@curry1\ndef add_distillation_flag(protein, distillation):\n  protein['is_distillation'] = tf.constant(float(distillation),\n                                           shape=[],\n                                           dtype=tf.float32)\n  return protein\n\n\ndef make_all_atom_aatype(protein):\n  protein['all_atom_aatype'] = protein['aatype']\n  return protein\n\n\ndef fix_templates_aatype(protein):\n  \"\"\"Fixes aatype encoding of templates.\"\"\"\n  # Map one-hot to indices.\n  protein['template_aatype'] = tf.argmax(\n      protein['template_aatype'], output_type=tf.int32, axis=-1)\n  # Map hhsearch-aatype to our aatype.\n  new_order_list = residue_constants.MAP_HHBLITS_AATYPE_TO_OUR_AATYPE\n  new_order = tf.constant(new_order_list, dtype=tf.int32)\n  protein['template_aatype'] = tf.gather(params=new_order,\n                                         indices=protein['template_aatype'])\n  return protein\n\n\ndef correct_msa_restypes(protein):\n  \"\"\"Correct MSA restype to have the same order as residue_constants.\"\"\"\n  new_order_list = residue_constants.MAP_HHBLITS_AATYPE_TO_OUR_AATYPE\n  new_order = tf.constant(new_order_list, dtype=protein['msa'].dtype)\n  protein['msa'] = tf.gather(new_order, protein['msa'], axis=0)\n\n  perm_matrix = np.zeros((22, 22), dtype=np.float32)\n  perm_matrix[range(len(new_order_list)), new_order_list] = 1.\n\n  for k in protein:\n    if 'profile' in k:  # Include both hhblits and psiblast profiles\n      num_dim = protein[k].shape.as_list()[-1]\n      assert num_dim in [20, 21, 22], (\n          'num_dim for %s out of expected range: %s' % (k, num_dim))\n      protein[k] = tf.tensordot(protein[k], perm_matrix[:num_dim, :num_dim], 1)\n  return protein\n\n\ndef squeeze_features(protein):\n  \"\"\"Remove singleton and repeated dimensions in protein features.\"\"\"\n  protein['aatype'] = tf.argmax(\n      protein['aatype'], axis=-1, output_type=tf.int32)\n  for k in [\n      'domain_name', 'msa', 'num_alignments', 'seq_length', 'sequence',\n      'superfamily', 'deletion_matrix', 'resolution',\n      'between_segment_residues', 'residue_index', 'template_all_atom_masks']:\n    if k in protein:\n      final_dim = shape_helpers.shape_list(protein[k])[-1]\n      if isinstance(final_dim, int) and final_dim == 1:\n        protein[k] = tf.squeeze(protein[k], axis=-1)\n\n  for k in ['seq_length', 'num_alignments']:\n    if k in protein:\n      protein[k] = protein[k][0]  # Remove fake sequence dimension\n  return protein\n\n\ndef make_random_crop_to_size_seed(protein):\n  \"\"\"Random seed for cropping residues and templates.\"\"\"\n  protein['random_crop_to_size_seed'] = utils.make_random_seed()\n  return protein\n\n\n@curry1\ndef randomly_replace_msa_with_unknown(protein, replace_proportion):\n  \"\"\"Replace a proportion of the MSA with 'X'.\"\"\"\n  msa_mask = (tf.random.uniform(shape_helpers.shape_list(protein['msa'])) <\n              replace_proportion)\n  x_idx = 20\n  gap_idx = 21\n  msa_mask = tf.logical_and(msa_mask, protein['msa'] != gap_idx)\n  protein['msa'] = tf.where(msa_mask,\n                            tf.ones_like(protein['msa']) * x_idx,\n                            protein['msa'])\n  aatype_mask = (\n      tf.random.uniform(shape_helpers.shape_list(protein['aatype'])) <\n      replace_proportion)\n\n  protein['aatype'] = tf.where(aatype_mask,\n                               tf.ones_like(protein['aatype']) * x_idx,\n                               protein['aatype'])\n  return protein\n\n\n@curry1\ndef sample_msa(protein, max_seq, keep_extra):\n  \"\"\"Sample MSA randomly, remaining sequences are stored as `extra_*`.\n\n  Args:\n    protein: batch to sample msa from.\n    max_seq: number of sequences to sample.\n    keep_extra: When True sequences not sampled are put into fields starting\n      with 'extra_*'.\n\n  Returns:\n    Protein with sampled msa.\n  \"\"\"\n  num_seq = tf.shape(protein['msa'])[0]\n  shuffled = tf.random_shuffle(tf.range(1, num_seq))\n  index_order = tf.concat([[0], shuffled], axis=0)\n  num_sel = tf.minimum(max_seq, num_seq)\n\n  sel_seq, not_sel_seq = tf.split(index_order, [num_sel, num_seq - num_sel])\n\n  for k in _MSA_FEATURE_NAMES:\n    if k in protein:\n      if keep_extra:\n        protein['extra_' + k] = tf.gather(protein[k], not_sel_seq)\n      protein[k] = tf.gather(protein[k], sel_seq)\n\n  return protein\n\n\n@curry1\ndef crop_extra_msa(protein, max_extra_msa):\n  \"\"\"MSA features are cropped so only `max_extra_msa` sequences are kept.\"\"\"\n  num_seq = tf.shape(protein['extra_msa'])[0]\n  num_sel = tf.minimum(max_extra_msa, num_seq)\n  select_indices = tf.random_shuffle(tf.range(0, num_seq))[:num_sel]\n  for k in _MSA_FEATURE_NAMES:\n    if 'extra_' + k in protein:\n      protein['extra_' + k] = tf.gather(protein['extra_' + k], select_indices)\n\n  return protein\n\n\ndef delete_extra_msa(protein):\n  for k in _MSA_FEATURE_NAMES:\n    if 'extra_' + k in protein:\n      del protein['extra_' + k]\n  return protein\n\n\n@curry1\ndef block_delete_msa(protein, config):\n  \"\"\"Sample MSA by deleting contiguous blocks.\n\n  Jumper et al. (2021) Suppl. Alg. 1 \"MSABlockDeletion\"\n\n  Arguments:\n    protein: batch dict containing the msa\n    config: ConfigDict with parameters\n\n  Returns:\n    updated protein\n  \"\"\"\n  num_seq = shape_helpers.shape_list(protein['msa'])[0]\n  block_num_seq = tf.cast(\n      tf.floor(tf.cast(num_seq, tf.float32) * config.msa_fraction_per_block),\n      tf.int32)\n\n  if config.randomize_num_blocks:\n    nb = tf.random.uniform([], 0, config.num_blocks + 1, dtype=tf.int32)\n  else:\n    nb = config.num_blocks\n\n  del_block_starts = tf.random.uniform([nb], 0, num_seq, dtype=tf.int32)\n  del_blocks = del_block_starts[:, None] + tf.range(block_num_seq)\n  del_blocks = tf.clip_by_value(del_blocks, 0, num_seq - 1)\n  del_indices = tf.unique(tf.sort(tf.reshape(del_blocks, [-1])))[0]\n\n  # Make sure we keep the original sequence\n  sparse_diff = tf.sets.difference(tf.range(1, num_seq)[None],\n                                   del_indices[None])\n  keep_indices = tf.squeeze(tf.sparse.to_dense(sparse_diff), 0)\n  keep_indices = tf.concat([[0], keep_indices], axis=0)\n\n  for k in _MSA_FEATURE_NAMES:\n    if k in protein:\n      protein[k] = tf.gather(protein[k], keep_indices)\n\n  return protein\n\n\n@curry1\ndef nearest_neighbor_clusters(protein, gap_agreement_weight=0.):\n  \"\"\"Assign each extra MSA sequence to its nearest neighbor in sampled MSA.\"\"\"\n\n  # Determine how much weight we assign to each agreement.  In theory, we could\n  # use a full blosum matrix here, but right now let's just down-weight gap\n  # agreement because it could be spurious.\n  # Never put weight on agreeing on BERT mask\n  weights = tf.concat([\n      tf.ones(21),\n      gap_agreement_weight * tf.ones(1),\n      np.zeros(1)], 0)\n\n  # Make agreement score as weighted Hamming distance\n  sample_one_hot = (protein['msa_mask'][:, :, None] *\n                    tf.one_hot(protein['msa'], 23))\n  extra_one_hot = (protein['extra_msa_mask'][:, :, None] *\n                   tf.one_hot(protein['extra_msa'], 23))\n\n  num_seq, num_res, _ = shape_helpers.shape_list(sample_one_hot)\n  extra_num_seq, _, _ = shape_helpers.shape_list(extra_one_hot)\n\n  # Compute tf.einsum('mrc,nrc,c->mn', sample_one_hot, extra_one_hot, weights)\n  # in an optimized fashion to avoid possible memory or computation blowup.\n  agreement = tf.matmul(\n      tf.reshape(extra_one_hot, [extra_num_seq, num_res * 23]),\n      tf.reshape(sample_one_hot * weights, [num_seq, num_res * 23]),\n      transpose_b=True)\n\n  # Assign each sequence in the extra sequences to the closest MSA sample\n  protein['extra_cluster_assignment'] = tf.argmax(\n      agreement, axis=1, output_type=tf.int32)\n\n  return protein\n\n\n@curry1\ndef summarize_clusters(protein):\n  \"\"\"Produce profile and deletion_matrix_mean within each cluster.\"\"\"\n  num_seq = shape_helpers.shape_list(protein['msa'])[0]\n  def csum(x):\n    return tf.math.unsorted_segment_sum(\n        x, protein['extra_cluster_assignment'], num_seq)\n\n  mask = protein['extra_msa_mask']\n  mask_counts = 1e-6 + protein['msa_mask'] + csum(mask)  # Include center\n\n  msa_sum = csum(mask[:, :, None] * tf.one_hot(protein['extra_msa'], 23))\n  msa_sum += tf.one_hot(protein['msa'], 23)  # Original sequence\n  protein['cluster_profile'] = msa_sum / mask_counts[:, :, None]\n\n  del msa_sum\n\n  del_sum = csum(mask * protein['extra_deletion_matrix'])\n  del_sum += protein['deletion_matrix']  # Original sequence\n  protein['cluster_deletion_mean'] = del_sum / mask_counts\n  del del_sum\n\n  return protein\n\n\ndef make_msa_mask(protein):\n  \"\"\"Mask features are all ones, but will later be zero-padded.\"\"\"\n  protein['msa_mask'] = tf.ones(\n      shape_helpers.shape_list(protein['msa']), dtype=tf.float32)\n  protein['msa_row_mask'] = tf.ones(\n      shape_helpers.shape_list(protein['msa'])[0], dtype=tf.float32)\n  return protein\n\n\ndef pseudo_beta_fn(aatype, all_atom_positions, all_atom_masks):\n  \"\"\"Create pseudo beta features.\"\"\"\n  is_gly = tf.equal(aatype, residue_constants.restype_order['G'])\n  ca_idx = residue_constants.atom_order['CA']\n  cb_idx = residue_constants.atom_order['CB']\n  pseudo_beta = tf.where(\n      tf.tile(is_gly[..., None], [1] * len(is_gly.shape) + [3]),\n      all_atom_positions[..., ca_idx, :],\n      all_atom_positions[..., cb_idx, :])\n\n  if all_atom_masks is not None:\n    pseudo_beta_mask = tf.where(\n        is_gly, all_atom_masks[..., ca_idx], all_atom_masks[..., cb_idx])\n    pseudo_beta_mask = tf.cast(pseudo_beta_mask, tf.float32)\n    return pseudo_beta, pseudo_beta_mask\n  else:\n    return pseudo_beta\n\n\n@curry1\ndef make_pseudo_beta(protein, prefix=''):\n  \"\"\"Create pseudo-beta (alpha for glycine) position and mask.\"\"\"\n  assert prefix in ['', 'template_']\n  protein[prefix + 'pseudo_beta'], protein[prefix + 'pseudo_beta_mask'] = (\n      pseudo_beta_fn(\n          protein['template_aatype' if prefix else 'all_atom_aatype'],\n          protein[prefix + 'all_atom_positions'],\n          protein['template_all_atom_masks' if prefix else 'all_atom_mask']))\n  return protein\n\n\n@curry1\ndef add_constant_field(protein, key, value):\n  protein[key] = tf.convert_to_tensor(value)\n  return protein\n\n\ndef shaped_categorical(probs, epsilon=1e-10):\n  ds = shape_helpers.shape_list(probs)\n  num_classes = ds[-1]\n  counts = tf.random.categorical(\n      tf.reshape(tf.log(probs + epsilon), [-1, num_classes]),\n      1,\n      dtype=tf.int32)\n  return tf.reshape(counts, ds[:-1])\n\n\ndef make_hhblits_profile(protein):\n  \"\"\"Compute the HHblits MSA profile if not already present.\"\"\"\n  if 'hhblits_profile' in protein:\n    return protein\n\n  # Compute the profile for every residue (over all MSA sequences).\n  protein['hhblits_profile'] = tf.reduce_mean(\n      tf.one_hot(protein['msa'], 22), axis=0)\n  return protein\n\n\n@curry1\ndef make_masked_msa(protein, config, replace_fraction):\n  \"\"\"Create data for BERT on raw MSA.\"\"\"\n  # Add a random amino acid uniformly\n  random_aa = tf.constant([0.05] * 20 + [0., 0.], dtype=tf.float32)\n\n  categorical_probs = (\n      config.uniform_prob * random_aa +\n      config.profile_prob * protein['hhblits_profile'] +\n      config.same_prob * tf.one_hot(protein['msa'], 22))\n\n  # Put all remaining probability on [MASK] which is a new column\n  pad_shapes = [[0, 0] for _ in range(len(categorical_probs.shape))]\n  pad_shapes[-1][1] = 1\n  mask_prob = 1. - config.profile_prob - config.same_prob - config.uniform_prob\n  assert mask_prob >= 0.\n  categorical_probs = tf.pad(\n      categorical_probs, pad_shapes, constant_values=mask_prob)\n\n  sh = shape_helpers.shape_list(protein['msa'])\n  mask_position = tf.random.uniform(sh) < replace_fraction\n\n  bert_msa = shaped_categorical(categorical_probs)\n  bert_msa = tf.where(mask_position, bert_msa, protein['msa'])\n\n  # Mix real and masked MSA\n  protein['bert_mask'] = tf.cast(mask_position, tf.float32)\n  protein['true_msa'] = protein['msa']\n  protein['msa'] = bert_msa\n\n  return protein\n\n\n@curry1\ndef make_fixed_size(protein, shape_schema, msa_cluster_size, extra_msa_size,\n                    num_res, num_templates=0):\n  \"\"\"Guess at the MSA and sequence dimensions to make fixed size.\"\"\"\n\n  pad_size_map = {\n      NUM_RES: num_res,\n      NUM_MSA_SEQ: msa_cluster_size,\n      NUM_EXTRA_SEQ: extra_msa_size,\n      NUM_TEMPLATES: num_templates,\n  }\n\n  for k, v in protein.items():\n    # Don't transfer this to the accelerator.\n    if k == 'extra_cluster_assignment':\n      continue\n    shape = v.shape.as_list()\n    schema = shape_schema[k]\n    assert len(shape) == len(schema), (\n        f'Rank mismatch between shape and shape schema for {k}: '\n        f'{shape} vs {schema}')\n    pad_size = [\n        pad_size_map.get(s2, None) or s1 for (s1, s2) in zip(shape, schema)\n    ]\n    padding = [(0, p - tf.shape(v)[i]) for i, p in enumerate(pad_size)]\n    if padding:\n      protein[k] = tf.pad(\n          v, padding, name=f'pad_to_fixed_{k}')\n      protein[k].set_shape(pad_size)\n\n  return protein\n\n\n@curry1\ndef make_msa_feat(protein):\n  \"\"\"Create and concatenate MSA features.\"\"\"\n  # Whether there is a domain break. Always zero for chains, but keeping\n  # for compatibility with domain datasets.\n  has_break = tf.clip_by_value(\n      tf.cast(protein['between_segment_residues'], tf.float32),\n      0, 1)\n  aatype_1hot = tf.one_hot(protein['aatype'], 21, axis=-1)\n\n  target_feat = [\n      tf.expand_dims(has_break, axis=-1),\n      aatype_1hot,  # Everyone gets the original sequence.\n  ]\n\n  msa_1hot = tf.one_hot(protein['msa'], 23, axis=-1)\n  has_deletion = tf.clip_by_value(protein['deletion_matrix'], 0., 1.)\n  deletion_value = tf.atan(protein['deletion_matrix'] / 3.) * (2. / np.pi)\n\n  msa_feat = [\n      msa_1hot,\n      tf.expand_dims(has_deletion, axis=-1),\n      tf.expand_dims(deletion_value, axis=-1),\n  ]\n\n  if 'cluster_profile' in protein:\n    deletion_mean_value = (\n        tf.atan(protein['cluster_deletion_mean'] / 3.) * (2. / np.pi))\n    msa_feat.extend([\n        protein['cluster_profile'],\n        tf.expand_dims(deletion_mean_value, axis=-1),\n    ])\n\n  if 'extra_deletion_matrix' in protein:\n    protein['extra_has_deletion'] = tf.clip_by_value(\n        protein['extra_deletion_matrix'], 0., 1.)\n    protein['extra_deletion_value'] = tf.atan(\n        protein['extra_deletion_matrix'] / 3.) * (2. / np.pi)\n\n  protein['msa_feat'] = tf.concat(msa_feat, axis=-1)\n  protein['target_feat'] = tf.concat(target_feat, axis=-1)\n  return protein\n\n\n@curry1\ndef select_feat(protein, feature_list):\n  return {k: v for k, v in protein.items() if k in feature_list}\n\n\n@curry1\ndef crop_templates(protein, max_templates):\n  for k, v in protein.items():\n    if k.startswith('template_'):\n      protein[k] = v[:max_templates]\n  return protein\n\n\n@curry1\ndef random_crop_to_size(protein, crop_size, max_templates, shape_schema,\n                        subsample_templates=False):\n  \"\"\"Crop randomly to `crop_size`, or keep as is if shorter than that.\"\"\"\n  seq_length = protein['seq_length']\n  if 'template_mask' in protein:\n    num_templates = tf.cast(\n        shape_helpers.shape_list(protein['template_mask'])[0], tf.int32)\n  else:\n    num_templates = tf.constant(0, dtype=tf.int32)\n  num_res_crop_size = tf.math.minimum(seq_length, crop_size)\n\n  # Ensures that the cropping of residues and templates happens in the same way\n  # across ensembling iterations.\n  # Do not use for randomness that should vary in ensembling.\n  seed_maker = utils.SeedMaker(initial_seed=protein['random_crop_to_size_seed'])\n\n  if subsample_templates:\n    templates_crop_start = tf.random.stateless_uniform(\n        shape=(), minval=0, maxval=num_templates + 1, dtype=tf.int32,\n        seed=seed_maker())\n  else:\n    templates_crop_start = 0\n\n  num_templates_crop_size = tf.math.minimum(\n      num_templates - templates_crop_start, max_templates)\n\n  num_res_crop_start = tf.random.stateless_uniform(\n      shape=(), minval=0, maxval=seq_length - num_res_crop_size + 1,\n      dtype=tf.int32, seed=seed_maker())\n\n  templates_select_indices = tf.argsort(tf.random.stateless_uniform(\n      [num_templates], seed=seed_maker()))\n\n  for k, v in protein.items():\n    if k not in shape_schema or (\n        'template' not in k and NUM_RES not in shape_schema[k]):\n      continue\n\n    # randomly permute the templates before cropping them.\n    if k.startswith('template') and subsample_templates:\n      v = tf.gather(v, templates_select_indices)\n\n    crop_sizes = []\n    crop_starts = []\n    for i, (dim_size, dim) in enumerate(zip(shape_schema[k],\n                                            shape_helpers.shape_list(v))):\n      is_num_res = (dim_size == NUM_RES)\n      if i == 0 and k.startswith('template'):\n        crop_size = num_templates_crop_size\n        crop_start = templates_crop_start\n      else:\n        crop_start = num_res_crop_start if is_num_res else 0\n        crop_size = (num_res_crop_size if is_num_res else\n                     (-1 if dim is None else dim))\n      crop_sizes.append(crop_size)\n      crop_starts.append(crop_start)\n    protein[k] = tf.slice(v, crop_starts, crop_sizes)\n\n  protein['seq_length'] = num_res_crop_size\n  return protein\n\n\ndef make_atom14_masks(protein):\n  \"\"\"Construct denser atom positions (14 dimensions instead of 37).\"\"\"\n  restype_atom14_to_atom37 = []  # mapping (restype, atom14) --> atom37\n  restype_atom37_to_atom14 = []  # mapping (restype, atom37) --> atom14\n  restype_atom14_mask = []\n\n  for rt in residue_constants.restypes:\n    atom_names = residue_constants.restype_name_to_atom14_names[\n        residue_constants.restype_1to3[rt]]\n\n    restype_atom14_to_atom37.append([\n        (residue_constants.atom_order[name] if name else 0)\n        for name in atom_names\n    ])\n\n    atom_name_to_idx14 = {name: i for i, name in enumerate(atom_names)}\n    restype_atom37_to_atom14.append([\n        (atom_name_to_idx14[name] if name in atom_name_to_idx14 else 0)\n        for name in residue_constants.atom_types\n    ])\n\n    restype_atom14_mask.append([(1. if name else 0.) for name in atom_names])\n\n  # Add dummy mapping for restype 'UNK'\n  restype_atom14_to_atom37.append([0] * 14)\n  restype_atom37_to_atom14.append([0] * 37)\n  restype_atom14_mask.append([0.] * 14)\n\n  restype_atom14_to_atom37 = np.array(restype_atom14_to_atom37, dtype=np.int32)\n  restype_atom37_to_atom14 = np.array(restype_atom37_to_atom14, dtype=np.int32)\n  restype_atom14_mask = np.array(restype_atom14_mask, dtype=np.float32)\n\n  # create the mapping for (residx, atom14) --> atom37, i.e. an array\n  # with shape (num_res, 14) containing the atom37 indices for this protein\n  residx_atom14_to_atom37 = tf.gather(restype_atom14_to_atom37,\n                                      protein['aatype'])\n  residx_atom14_mask = tf.gather(restype_atom14_mask,\n                                 protein['aatype'])\n\n  protein['atom14_atom_exists'] = residx_atom14_mask\n  protein['residx_atom14_to_atom37'] = residx_atom14_to_atom37\n\n  # create the gather indices for mapping back\n  residx_atom37_to_atom14 = tf.gather(restype_atom37_to_atom14,\n                                      protein['aatype'])\n  protein['residx_atom37_to_atom14'] = residx_atom37_to_atom14\n\n  # create the corresponding mask\n  restype_atom37_mask = np.zeros([21, 37], dtype=np.float32)\n  for restype, restype_letter in enumerate(residue_constants.restypes):\n    restype_name = residue_constants.restype_1to3[restype_letter]\n    atom_names = residue_constants.residue_atoms[restype_name]\n    for atom_name in atom_names:\n      atom_type = residue_constants.atom_order[atom_name]\n      restype_atom37_mask[restype, atom_type] = 1\n\n  residx_atom37_mask = tf.gather(restype_atom37_mask,\n                                 protein['aatype'])\n  protein['atom37_atom_exists'] = residx_atom37_mask\n\n  return protein\n"
  },
  {
    "path": "alphafold/model/tf/input_pipeline.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Feature pre-processing input pipeline for AlphaFold.\"\"\"\n\nfrom alphafold.model.tf import data_transforms\nfrom alphafold.model.tf import shape_placeholders\nimport tensorflow.compat.v1 as tf\nimport tree\n\n# Pylint gets confused by the curry1 decorator because it changes the number\n#   of arguments to the function.\n# pylint:disable=no-value-for-parameter\n\n\nNUM_RES = shape_placeholders.NUM_RES\nNUM_MSA_SEQ = shape_placeholders.NUM_MSA_SEQ\nNUM_EXTRA_SEQ = shape_placeholders.NUM_EXTRA_SEQ\nNUM_TEMPLATES = shape_placeholders.NUM_TEMPLATES\n\n\ndef nonensembled_map_fns(data_config):\n  \"\"\"Input pipeline functions which are not ensembled.\"\"\"\n  common_cfg = data_config.common\n\n  map_fns = [\n      data_transforms.correct_msa_restypes,\n      data_transforms.add_distillation_flag(False),\n      data_transforms.cast_64bit_ints,\n      data_transforms.squeeze_features,\n      # Keep to not disrupt RNG.\n      data_transforms.randomly_replace_msa_with_unknown(0.0),\n      data_transforms.make_seq_mask,\n      data_transforms.make_msa_mask,\n      # Compute the HHblits profile if it's not set. This has to be run before\n      # sampling the MSA.\n      data_transforms.make_hhblits_profile,\n      data_transforms.make_random_crop_to_size_seed,\n  ]\n  if common_cfg.use_templates:\n    map_fns.extend([\n        data_transforms.fix_templates_aatype,\n        data_transforms.make_template_mask,\n        data_transforms.make_pseudo_beta('template_')\n    ])\n  map_fns.extend([\n      data_transforms.make_atom14_masks,\n  ])\n\n  return map_fns\n\n\ndef ensembled_map_fns(data_config):\n  \"\"\"Input pipeline functions that can be ensembled and averaged.\"\"\"\n  common_cfg = data_config.common\n  eval_cfg = data_config.eval\n\n  map_fns = []\n\n  if common_cfg.reduce_msa_clusters_by_max_templates:\n    pad_msa_clusters = eval_cfg.max_msa_clusters - eval_cfg.max_templates\n  else:\n    pad_msa_clusters = eval_cfg.max_msa_clusters\n\n  max_msa_clusters = pad_msa_clusters\n  max_extra_msa = common_cfg.max_extra_msa\n\n  map_fns.append(\n      data_transforms.sample_msa(\n          max_msa_clusters,\n          keep_extra=True))\n\n  if 'masked_msa' in common_cfg:\n    # Masked MSA should come *before* MSA clustering so that\n    # the clustering and full MSA profile do not leak information about\n    # the masked locations and secret corrupted locations.\n    map_fns.append(\n        data_transforms.make_masked_msa(common_cfg.masked_msa,\n                                        eval_cfg.masked_msa_replace_fraction))\n\n  if common_cfg.msa_cluster_features:\n    map_fns.append(data_transforms.nearest_neighbor_clusters())\n    map_fns.append(data_transforms.summarize_clusters())\n\n  # Crop after creating the cluster profiles.\n  if max_extra_msa:\n    map_fns.append(data_transforms.crop_extra_msa(max_extra_msa))\n  else:\n    map_fns.append(data_transforms.delete_extra_msa)\n\n  map_fns.append(data_transforms.make_msa_feat())\n\n  crop_feats = dict(eval_cfg.feat)\n\n  if eval_cfg.fixed_size:\n    map_fns.append(data_transforms.select_feat(list(crop_feats)))\n    map_fns.append(data_transforms.random_crop_to_size(\n        eval_cfg.crop_size,\n        eval_cfg.max_templates,\n        crop_feats,\n        eval_cfg.subsample_templates))\n    map_fns.append(data_transforms.make_fixed_size(\n        crop_feats,\n        pad_msa_clusters,\n        common_cfg.max_extra_msa,\n        eval_cfg.crop_size,\n        eval_cfg.max_templates))\n  else:\n    map_fns.append(data_transforms.crop_templates(eval_cfg.max_templates))\n\n  return map_fns\n\n\ndef process_tensors_from_config(tensors, data_config):\n  \"\"\"Apply filters and maps to an existing dataset, based on the config.\"\"\"\n\n  def wrap_ensemble_fn(data, i):\n    \"\"\"Function to be mapped over the ensemble dimension.\"\"\"\n    d = data.copy()\n    fns = ensembled_map_fns(data_config)\n    fn = compose(fns)\n    d['ensemble_index'] = i\n    return fn(d)\n\n  eval_cfg = data_config.eval\n  tensors = compose(\n      nonensembled_map_fns(\n          data_config))(\n              tensors)\n\n  tensors_0 = wrap_ensemble_fn(tensors, tf.constant(0))\n  num_ensemble = eval_cfg.num_ensemble\n  if data_config.common.resample_msa_in_recycling:\n    # Separate batch per ensembling & recycling step.\n    num_ensemble *= data_config.common.num_recycle + 1\n\n  if isinstance(num_ensemble, tf.Tensor) or num_ensemble > 1:\n    fn_output_signature = tree.map_structure(\n        tf.TensorSpec.from_tensor, tensors_0)\n    tensors = tf.map_fn(\n        lambda x: wrap_ensemble_fn(tensors, x),\n        tf.range(num_ensemble),\n        parallel_iterations=1,\n        fn_output_signature=fn_output_signature)\n  else:\n    tensors = tree.map_structure(lambda x: x[None],\n                                 tensors_0)\n  return tensors\n\n\n@data_transforms.curry1\ndef compose(x, fs):\n  for f in fs:\n    x = f(x)\n  return x\n"
  },
  {
    "path": "alphafold/model/tf/protein_features.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Contains descriptions of various protein features.\"\"\"\nimport enum\nfrom typing import Dict, Optional, Sequence, Tuple, Union\nfrom alphafold.common import residue_constants\nimport tensorflow.compat.v1 as tf\n\n# Type aliases.\nFeaturesMetadata = Dict[str, Tuple[tf.dtypes.DType, Sequence[Union[str, int]]]]\n\n\nclass FeatureType(enum.Enum):\n  ZERO_DIM = 0  # Shape [x]\n  ONE_DIM = 1  # Shape [num_res, x]\n  TWO_DIM = 2  # Shape [num_res, num_res, x]\n  MSA = 3  # Shape [msa_length, num_res, x]\n\n\n# Placeholder values that will be replaced with their true value at runtime.\nNUM_RES = \"num residues placeholder\"\nNUM_SEQ = \"length msa placeholder\"\nNUM_TEMPLATES = \"num templates placeholder\"\n# Sizes of the protein features, NUM_RES and NUM_SEQ are allowed as placeholders\n# to be replaced with the number of residues and the number of sequences in the\n# multiple sequence alignment, respectively.\n\n\nFEATURES = {\n    #### Static features of a protein sequence ####\n    \"aatype\": (tf.float32, [NUM_RES, 21]),\n    \"between_segment_residues\": (tf.int64, [NUM_RES, 1]),\n    \"deletion_matrix\": (tf.float32, [NUM_SEQ, NUM_RES, 1]),\n    \"domain_name\": (tf.string, [1]),\n    \"msa\": (tf.int64, [NUM_SEQ, NUM_RES, 1]),\n    \"num_alignments\": (tf.int64, [NUM_RES, 1]),\n    \"residue_index\": (tf.int64, [NUM_RES, 1]),\n    \"seq_length\": (tf.int64, [NUM_RES, 1]),\n    \"sequence\": (tf.string, [1]),\n    \"all_atom_positions\": (tf.float32,\n                           [NUM_RES, residue_constants.atom_type_num, 3]),\n    \"all_atom_mask\": (tf.int64, [NUM_RES, residue_constants.atom_type_num]),\n    \"resolution\": (tf.float32, [1]),\n    \"template_domain_names\": (tf.string, [NUM_TEMPLATES]),\n    \"template_sum_probs\": (tf.float32, [NUM_TEMPLATES, 1]),\n    \"template_aatype\": (tf.float32, [NUM_TEMPLATES, NUM_RES, 22]),\n    \"template_all_atom_positions\": (tf.float32, [\n        NUM_TEMPLATES, NUM_RES, residue_constants.atom_type_num, 3\n    ]),\n    \"template_all_atom_masks\": (tf.float32, [\n        NUM_TEMPLATES, NUM_RES, residue_constants.atom_type_num, 1\n    ]),\n}\n\nFEATURE_TYPES = {k: v[0] for k, v in FEATURES.items()}\nFEATURE_SIZES = {k: v[1] for k, v in FEATURES.items()}\n\n\ndef register_feature(name: str,\n                     type_: tf.dtypes.DType,\n                     shape_: Tuple[Union[str, int]]):\n  \"\"\"Register extra features used in custom datasets.\"\"\"\n  FEATURES[name] = (type_, shape_)\n  FEATURE_TYPES[name] = type_\n  FEATURE_SIZES[name] = shape_\n\n\ndef shape(feature_name: str,\n          num_residues: int,\n          msa_length: int,\n          num_templates: Optional[int] = None,\n          features: Optional[FeaturesMetadata] = None):\n  \"\"\"Get the shape for the given feature name.\n\n  This is near identical to _get_tf_shape_no_placeholders() but with 2\n  differences:\n  * This method does not calculate a single placeholder from the total number of\n    elements (eg given <NUM_RES, 3> and size := 12, this won't deduce NUM_RES\n    must be 4)\n  * This method will work with tensors\n\n  Args:\n    feature_name: String identifier for the feature. If the feature name ends\n      with \"_unnormalized\", this suffix is stripped off.\n    num_residues: The number of residues in the current domain - some elements\n      of the shape can be dynamic and will be replaced by this value.\n    msa_length: The number of sequences in the multiple sequence alignment, some\n      elements of the shape can be dynamic and will be replaced by this value.\n      If the number of alignments is unknown / not read, please pass None for\n      msa_length.\n    num_templates (optional): The number of templates in this tfexample.\n    features: A feature_name to (tf_dtype, shape) lookup; defaults to FEATURES.\n\n  Returns:\n    List of ints representation the tensor size.\n\n  Raises:\n    ValueError: If a feature is requested but no concrete placeholder value is\n        given.\n  \"\"\"\n  features = features or FEATURES\n  if feature_name.endswith(\"_unnormalized\"):\n    feature_name = feature_name[:-13]\n\n  unused_dtype, raw_sizes = features[feature_name]\n  replacements = {NUM_RES: num_residues,\n                  NUM_SEQ: msa_length}\n\n  if num_templates is not None:\n    replacements[NUM_TEMPLATES] = num_templates\n\n  sizes = [replacements.get(dimension, dimension) for dimension in raw_sizes]\n  for dimension in sizes:\n    if isinstance(dimension, str):\n      raise ValueError(\"Could not parse %s (shape: %s) with values: %s\" % (\n          feature_name, raw_sizes, replacements))\n  return sizes\n"
  },
  {
    "path": "alphafold/model/tf/protein_features_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for protein_features.\"\"\"\nimport uuid\n\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.model.tf import protein_features\nimport tensorflow.compat.v1 as tf\n\n\ndef _random_bytes():\n  return str(uuid.uuid4()).encode('utf-8')\n\n\nclass FeaturesTest(parameterized.TestCase, tf.test.TestCase):\n\n  def setUp(self):\n    super().setUp()\n    tf.disable_v2_behavior()\n\n  def testFeatureNames(self):\n    self.assertEqual(len(protein_features.FEATURE_SIZES),\n                     len(protein_features.FEATURE_TYPES))\n    sorted_size_names = sorted(protein_features.FEATURE_SIZES.keys())\n    sorted_type_names = sorted(protein_features.FEATURE_TYPES.keys())\n    for i, size_name in enumerate(sorted_size_names):\n      self.assertEqual(size_name, sorted_type_names[i])\n\n  def testReplacement(self):\n    for name in protein_features.FEATURE_SIZES.keys():\n      sizes = protein_features.shape(name,\n                                     num_residues=12,\n                                     msa_length=24,\n                                     num_templates=3)\n      for x in sizes:\n        self.assertEqual(type(x), int)\n        self.assertGreater(x, 0)\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/model/tf/proteins_dataset.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Datasets consisting of proteins.\"\"\"\nfrom typing import Dict, Mapping, Optional, Sequence\nfrom alphafold.model.tf import protein_features\nimport numpy as np\nimport tensorflow.compat.v1 as tf\n\nTensorDict = Dict[str, tf.Tensor]\n\n\ndef parse_tfexample(\n    raw_data: bytes,\n    features: protein_features.FeaturesMetadata,\n    key: Optional[str] = None) -> Dict[str, tf.train.Feature]:\n  \"\"\"Read a single TF Example proto and return a subset of its features.\n\n  Args:\n    raw_data: A serialized tf.Example proto.\n    features: A dictionary of features, mapping string feature names to a tuple\n      (dtype, shape). This dictionary should be a subset of\n      protein_features.FEATURES (or the dictionary itself for all features).\n    key: Optional string with the SSTable key of that tf.Example. This will be\n      added into features as a 'key' but only if requested in features.\n\n  Returns:\n    A dictionary of features mapping feature names to features. Only the given\n    features are returned, all other ones are filtered out.\n  \"\"\"\n  feature_map = {\n      k: tf.io.FixedLenSequenceFeature(shape=(), dtype=v[0], allow_missing=True)\n      for k, v in features.items()\n  }\n  parsed_features = tf.io.parse_single_example(raw_data, feature_map)\n  reshaped_features = parse_reshape_logic(parsed_features, features, key=key)\n\n  return reshaped_features\n\n\ndef _first(tensor: tf.Tensor) -> tf.Tensor:\n  \"\"\"Returns the 1st element - the input can be a tensor or a scalar.\"\"\"\n  return tf.reshape(tensor, shape=(-1,))[0]\n\n\ndef parse_reshape_logic(\n    parsed_features: TensorDict,\n    features: protein_features.FeaturesMetadata,\n    key: Optional[str] = None) -> TensorDict:\n  \"\"\"Transforms parsed serial features to the correct shape.\"\"\"\n  # Find out what is the number of sequences and the number of alignments.\n  num_residues = tf.cast(_first(parsed_features[\"seq_length\"]), dtype=tf.int32)\n\n  if \"num_alignments\" in parsed_features:\n    num_msa = tf.cast(_first(parsed_features[\"num_alignments\"]), dtype=tf.int32)\n  else:\n    num_msa = 0\n\n  if \"template_domain_names\" in parsed_features:\n    num_templates = tf.cast(\n        tf.shape(parsed_features[\"template_domain_names\"])[0], dtype=tf.int32)\n  else:\n    num_templates = 0\n\n  if key is not None and \"key\" in features:\n    parsed_features[\"key\"] = [key]  # Expand dims from () to (1,).\n\n  # Reshape the tensors according to the sequence length and num alignments.\n  for k, v in parsed_features.items():\n    new_shape = protein_features.shape(\n        feature_name=k,\n        num_residues=num_residues,\n        msa_length=num_msa,\n        num_templates=num_templates,\n        features=features)\n    new_shape_size = tf.constant(1, dtype=tf.int32)\n    for dim in new_shape:\n      new_shape_size *= tf.cast(dim, tf.int32)\n\n    assert_equal = tf.assert_equal(\n        tf.size(v), new_shape_size,\n        name=\"assert_%s_shape_correct\" % k,\n        message=\"The size of feature %s (%s) could not be reshaped \"\n        \"into %s\" % (k, tf.size(v), new_shape))\n    if \"template\" not in k:\n      # Make sure the feature we are reshaping is not empty.\n      assert_non_empty = tf.assert_greater(\n          tf.size(v), 0, name=\"assert_%s_non_empty\" % k,\n          message=\"The feature %s is not set in the tf.Example. Either do not \"\n          \"request the feature or use a tf.Example that has the \"\n          \"feature set.\" % k)\n      with tf.control_dependencies([assert_non_empty, assert_equal]):\n        parsed_features[k] = tf.reshape(v, new_shape, name=\"reshape_%s\" % k)\n    else:\n      with tf.control_dependencies([assert_equal]):\n        parsed_features[k] = tf.reshape(v, new_shape, name=\"reshape_%s\" % k)\n\n  return parsed_features\n\n\ndef _make_features_metadata(\n    feature_names: Sequence[str]) -> protein_features.FeaturesMetadata:\n  \"\"\"Makes a feature name to type and shape mapping from a list of names.\"\"\"\n  # Make sure these features are always read.\n  required_features = [\"aatype\", \"sequence\", \"seq_length\"]\n  feature_names = list(set(feature_names) | set(required_features))\n\n  features_metadata = {name: protein_features.FEATURES[name]\n                       for name in feature_names}\n  return features_metadata\n\n\ndef create_tensor_dict(\n    raw_data: bytes,\n    features: Sequence[str],\n    key: Optional[str] = None,\n    ) -> TensorDict:\n  \"\"\"Creates a dictionary of tensor features.\n\n  Args:\n    raw_data: A serialized tf.Example proto.\n    features: A list of strings of feature names to be returned in the dataset.\n    key: Optional string with the SSTable key of that tf.Example. This will be\n      added into features as a 'key' but only if requested in features.\n\n  Returns:\n    A dictionary of features mapping feature names to features. Only the given\n    features are returned, all other ones are filtered out.\n  \"\"\"\n  features_metadata = _make_features_metadata(features)\n  return parse_tfexample(raw_data, features_metadata, key)\n\n\ndef np_to_tensor_dict(\n    np_example: Mapping[str, np.ndarray],\n    features: Sequence[str],\n    ) -> TensorDict:\n  \"\"\"Creates dict of tensors from a dict of NumPy arrays.\n\n  Args:\n    np_example: A dict of NumPy feature arrays.\n    features: A list of strings of feature names to be returned in the dataset.\n\n  Returns:\n    A dictionary of features mapping feature names to features. Only the given\n    features are returned, all other ones are filtered out.\n  \"\"\"\n  features_metadata = _make_features_metadata(features)\n  tensor_dict = {k: tf.constant(v) for k, v in np_example.items()\n                 if k in features_metadata}\n\n  # Ensures shapes are as expected. Needed for setting size of empty features\n  # e.g. when no template hits were found.\n  tensor_dict = parse_reshape_logic(tensor_dict, features_metadata)\n  return tensor_dict\n"
  },
  {
    "path": "alphafold/model/tf/shape_helpers.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Utilities for dealing with shapes of TensorFlow tensors.\"\"\"\nimport tensorflow.compat.v1 as tf\n\n\ndef shape_list(x):\n  \"\"\"Return list of dimensions of a tensor, statically where possible.\n\n  Like `x.shape.as_list()` but with tensors instead of `None`s.\n\n  Args:\n    x: A tensor.\n  Returns:\n    A list with length equal to the rank of the tensor. The n-th element of the\n    list is an integer when that dimension is statically known otherwise it is\n    the n-th element of `tf.shape(x)`.\n  \"\"\"\n  x = tf.convert_to_tensor(x)\n\n  # If unknown rank, return dynamic shape\n  if x.get_shape().dims is None:\n    return tf.shape(x)\n\n  static = x.get_shape().as_list()\n  shape = tf.shape(x)\n\n  ret = []\n  for i in range(len(static)):\n    dim = static[i]\n    if dim is None:\n      dim = shape[i]\n    ret.append(dim)\n  return ret\n\n"
  },
  {
    "path": "alphafold/model/tf/shape_helpers_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for shape_helpers.\"\"\"\n\nfrom alphafold.model.tf import shape_helpers\nimport numpy as np\nimport tensorflow.compat.v1 as tf\n\n\nclass ShapeTest(tf.test.TestCase):\n\n  def setUp(self):\n    super().setUp()\n    tf.disable_v2_behavior()\n\n  def test_shape_list(self):\n    \"\"\"Test that shape_list can allow for reshaping to dynamic shapes.\"\"\"\n    a = tf.zeros([10, 4, 4, 2])\n    p = tf.placeholder(tf.float32, shape=[None, None, 1, 4, 4])\n    shape_dyn = shape_helpers.shape_list(p)[:2] + [4, 4]\n\n    b = tf.reshape(a, shape_dyn)\n    with self.session() as sess:\n      out = sess.run(b, feed_dict={p: np.ones((20, 1, 1, 4, 4))})\n\n    self.assertAllEqual(out.shape, (20, 1, 4, 4))\n\n\nif __name__ == '__main__':\n  tf.test.main()\n"
  },
  {
    "path": "alphafold/model/tf/shape_placeholders.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Placeholder values for run-time varying dimension sizes.\"\"\"\n\nNUM_RES = 'num residues placeholder'\nNUM_MSA_SEQ = 'msa placeholder'\nNUM_EXTRA_SEQ = 'extra msa placeholder'\nNUM_TEMPLATES = 'num templates placeholder'\n"
  },
  {
    "path": "alphafold/model/tf/utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Shared utilities for various components.\"\"\"\nimport tensorflow.compat.v1 as tf\n\n\ndef tf_combine_mask(*masks):\n  \"\"\"Take the intersection of float-valued masks.\"\"\"\n  ret = 1\n  for m in masks:\n    ret *= m\n  return ret\n\n\nclass SeedMaker(object):\n  \"\"\"Return unique seeds.\"\"\"\n\n  def __init__(self, initial_seed=0):\n    self.next_seed = initial_seed\n\n  def __call__(self):\n    i = self.next_seed\n    self.next_seed += 1\n    return i\n\nseed_maker = SeedMaker()\n\n\ndef make_random_seed():\n  return tf.random.uniform([2],\n                           tf.int32.min,\n                           tf.int32.max,\n                           tf.int32,\n                           seed=seed_maker())\n\n"
  },
  {
    "path": "alphafold/model/utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"A collection of JAX utility functions for use in protein folding.\"\"\"\n\nimport collections\nimport contextlib\nimport functools\nimport numbers\nfrom typing import Mapping\n\nimport haiku as hk\nimport jax\nimport jax.numpy as jnp\nimport numpy as np\n\n\ndef bfloat16_creator(next_creator, shape, dtype, init, context):\n  \"\"\"Creates float32 variables when bfloat16 is requested.\"\"\"\n  if context.original_dtype == jnp.bfloat16:\n    dtype = jnp.float32\n  return next_creator(shape, dtype, init)\n\n\ndef bfloat16_getter(next_getter, value, context):\n  \"\"\"Casts float32 to bfloat16 when bfloat16 was originally requested.\"\"\"\n  if context.original_dtype == jnp.bfloat16:\n    assert value.dtype == jnp.float32\n    value = value.astype(jnp.bfloat16)\n  return next_getter(value)\n\n\n@contextlib.contextmanager\ndef bfloat16_context():\n  with hk.custom_creator(bfloat16_creator), hk.custom_getter(bfloat16_getter):\n    yield\n\n\ndef final_init(config):\n  if config.zero_init:\n    return 'zeros'\n  else:\n    return 'linear'\n\n\ndef batched_gather(params, indices, axis=0, batch_dims=0):\n  \"\"\"Implements a JAX equivalent of `tf.gather` with `axis` and `batch_dims`.\"\"\"\n  take_fn = lambda p, i: jnp.take(p, i, axis=axis, mode='clip')\n  for _ in range(batch_dims):\n    take_fn = jax.vmap(take_fn)\n  return take_fn(params, indices)\n\n\ndef mask_mean(mask, value, axis=None, drop_mask_channel=False, eps=1e-10):\n  \"\"\"Masked mean.\"\"\"\n  if drop_mask_channel:\n    mask = mask[..., 0]\n\n  mask_shape = mask.shape\n  value_shape = value.shape\n\n  assert len(mask_shape) == len(value_shape)\n\n  if isinstance(axis, numbers.Integral):\n    axis = [axis]\n  elif axis is None:\n    axis = list(range(len(mask_shape)))\n  assert isinstance(axis, collections.abc.Iterable), (\n      'axis needs to be either an iterable, integer or \"None\"')\n\n  broadcast_factor = 1.\n  for axis_ in axis:\n    value_size = value_shape[axis_]\n    mask_size = mask_shape[axis_]\n    if mask_size == 1:\n      broadcast_factor *= value_size\n    else:\n      assert mask_size == value_size\n\n  return (jnp.sum(mask * value, axis=axis) /\n          (jnp.sum(mask, axis=axis) * broadcast_factor + eps))\n\n\ndef flat_params_to_haiku(params: Mapping[str, np.ndarray]) -> hk.Params:\n  \"\"\"Convert a dictionary of NumPy arrays to Haiku parameters.\"\"\"\n  hk_params = {}\n  for path, array in params.items():\n    scope, name = path.split('//')\n    if scope not in hk_params:\n      hk_params[scope] = {}\n    hk_params[scope][name] = jnp.array(array)\n\n  return hk_params\n\n\ndef padding_consistent_rng(f):\n  \"\"\"Modify any element-wise random function to be consistent with padding.\n\n  Normally if you take a function like jax.random.normal and generate an array,\n  say of size (10,10), you will get a different set of random numbers to if you\n  add padding and take the first (10,10) sub-array.\n\n  This function makes a random function that is consistent regardless of the\n  amount of padding added.\n\n  Note: The padding-consistent function is likely to be slower to compile and\n  run than the function it is wrapping, but these slowdowns are likely to be\n  negligible in a large network.\n\n  Args:\n    f: Any element-wise function that takes (PRNG key, shape) as the first 2\n      arguments.\n\n  Returns:\n    An equivalent function to f, that is now consistent for different amounts of\n    padding.\n  \"\"\"\n  def grid_keys(key, shape):\n    \"\"\"Generate a grid of rng keys that is consistent with different padding.\n\n    Generate random keys such that the keys will be identical, regardless of\n    how much padding is added to any dimension.\n\n    Args:\n      key: A PRNG key.\n      shape: The shape of the output array of keys that will be generated.\n\n    Returns:\n      An array of shape `shape` consisting of random keys.\n    \"\"\"\n    if not shape:\n      return key\n    new_keys = jax.vmap(functools.partial(jax.random.fold_in, key))(\n        jnp.arange(shape[0]))\n    return jax.vmap(functools.partial(grid_keys, shape=shape[1:]))(new_keys)\n\n  def inner(key, shape, **kwargs):\n    return jnp.vectorize(\n        lambda key: f(key, shape=(), **kwargs),\n        signature='(2)->()')(\n            grid_keys(key, shape))\n  return inner\n"
  },
  {
    "path": "alphafold/notebooks/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"AlphaFold Colab notebook.\"\"\"\n"
  },
  {
    "path": "alphafold/notebooks/notebook_utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Helper methods for the AlphaFold Colab notebook.\"\"\"\nimport json\nfrom typing import Any, Mapping, Optional, Sequence, Tuple\n\nfrom alphafold.common import residue_constants\nfrom alphafold.data import parsers\nfrom matplotlib import pyplot as plt\nimport numpy as np\n\n\ndef clean_and_validate_single_sequence(\n    input_sequence: str, min_length: int, max_length: int) -> str:\n  \"\"\"Checks that the input sequence is ok and returns a clean version of it.\"\"\"\n  # Remove all whitespaces, tabs and end lines; upper-case.\n  clean_sequence = input_sequence.translate(\n      str.maketrans('', '', ' \\n\\t')).upper()\n  aatypes = set(residue_constants.restypes)  # 20 standard aatypes.\n  if not set(clean_sequence).issubset(aatypes):\n    raise ValueError(\n        f'Input sequence contains non-amino acid letters: '\n        f'{set(clean_sequence) - aatypes}. AlphaFold only supports 20 standard '\n        'amino acids as inputs.')\n  if len(clean_sequence) < min_length:\n    raise ValueError(\n        f'Input sequence is too short: {len(clean_sequence)} amino acids, '\n        f'while the minimum is {min_length}')\n  if len(clean_sequence) > max_length:\n    raise ValueError(\n        f'Input sequence is too long: {len(clean_sequence)} amino acids, while '\n        f'the maximum is {max_length}. You may be able to run it with the full '\n        f'AlphaFold system depending on your resources (system memory, '\n        f'GPU memory).')\n  return clean_sequence\n\n\ndef clean_and_validate_input_sequences(\n    input_sequences: Sequence[str],\n    min_sequence_length: int,\n    max_sequence_length: int) -> Sequence[str]:\n  \"\"\"Validates and cleans input sequences.\"\"\"\n  sequences = []\n\n  for input_sequence in input_sequences:\n    if input_sequence.strip():\n      input_sequence = clean_and_validate_single_sequence(\n          input_sequence=input_sequence,\n          min_length=min_sequence_length,\n          max_length=max_sequence_length)\n      sequences.append(input_sequence)\n\n  if sequences:\n    return sequences\n  else:\n    raise ValueError('No input amino acid sequence provided, please provide at '\n                     'least one sequence.')\n\n\ndef merge_chunked_msa(\n    results: Sequence[Mapping[str, Any]],\n    max_hits: Optional[int] = None\n    ) -> parsers.Msa:\n  \"\"\"Merges chunked database hits together into hits for the full database.\"\"\"\n  unsorted_results = []\n  for chunk_index, chunk in enumerate(results):\n    msa = parsers.parse_stockholm(chunk['sto'])\n    e_values_dict = parsers.parse_e_values_from_tblout(chunk['tbl'])\n    # Jackhmmer lists sequences as <sequence name>/<residue from>-<residue to>.\n    e_values = [e_values_dict[t.partition('/')[0]] for t in msa.descriptions]\n    chunk_results = zip(\n        msa.sequences, msa.deletion_matrix, msa.descriptions, e_values)\n    if chunk_index != 0:\n      next(chunk_results)  # Only take query (first hit) from the first chunk.\n    unsorted_results.extend(chunk_results)\n\n  sorted_by_evalue = sorted(unsorted_results, key=lambda x: x[-1])\n  merged_sequences, merged_deletion_matrix, merged_descriptions, _ = zip(\n      *sorted_by_evalue)\n  merged_msa = parsers.Msa(sequences=merged_sequences,\n                           deletion_matrix=merged_deletion_matrix,\n                           descriptions=merged_descriptions)\n  if max_hits is not None:\n    merged_msa = merged_msa.truncate(max_seqs=max_hits)\n\n  return merged_msa\n\n\ndef show_msa_info(\n    single_chain_msas: Sequence[parsers.Msa],\n    sequence_index: int):\n  \"\"\"Prints info and shows a plot of the deduplicated single chain MSA.\"\"\"\n  full_single_chain_msa = []\n  for single_chain_msa in single_chain_msas:\n    full_single_chain_msa.extend(single_chain_msa.sequences)\n\n  # Deduplicate but preserve order (hence can't use set).\n  deduped_full_single_chain_msa = list(dict.fromkeys(full_single_chain_msa))\n  total_msa_size = len(deduped_full_single_chain_msa)\n  print(f'\\n{total_msa_size} unique sequences found in total for sequence '\n        f'{sequence_index}\\n')\n\n  aa_map = {res: i for i, res in enumerate('ABCDEFGHIJKLMNOPQRSTUVWXYZ-')}\n  msa_arr = np.array(\n      [[aa_map[aa] for aa in seq] for seq in deduped_full_single_chain_msa])\n\n  plt.figure(figsize=(12, 3))\n  plt.title(f'Per-Residue Count of Non-Gap Amino Acids in the MSA for Sequence '\n            f'{sequence_index}')\n  plt.plot(np.sum(msa_arr != aa_map['-'], axis=0), color='black')\n  plt.ylabel('Non-Gap Count')\n  plt.yticks(range(0, total_msa_size + 1, max(1, int(total_msa_size / 3))))\n  plt.show()\n\n\ndef empty_placeholder_template_features(\n    num_templates: int, num_res: int) -> Mapping[str, np.ndarray]:\n  return {\n      'template_aatype': np.zeros(\n          (num_templates, num_res,\n           len(residue_constants.restypes_with_x_and_gap)), dtype=np.float32),\n      'template_all_atom_masks': np.zeros(\n          (num_templates, num_res, residue_constants.atom_type_num),\n          dtype=np.float32),\n      'template_all_atom_positions': np.zeros(\n          (num_templates, num_res, residue_constants.atom_type_num, 3),\n          dtype=np.float32),\n      'template_domain_names': np.zeros([num_templates], dtype=object),\n      'template_sequence': np.zeros([num_templates], dtype=object),\n      'template_sum_probs': np.zeros([num_templates], dtype=np.float32),\n  }\n\n\ndef get_pae_json(pae: np.ndarray, max_pae: float) -> str:\n  \"\"\"Returns the PAE in the same format as is used in the AFDB.\n\n  Note that the values are presented as floats to 1 decimal place,\n  whereas AFDB returns integer values.\n\n  Args:\n    pae: The n_res x n_res PAE array.\n    max_pae: The maximum possible PAE value.\n  Returns:\n    PAE output format as a JSON string.\n  \"\"\"\n  # Check the PAE array is the correct shape.\n  if (pae.ndim != 2 or pae.shape[0] != pae.shape[1]):\n    raise ValueError(f'PAE must be a square matrix, got {pae.shape}')\n\n  # Round the predicted aligned errors to 1 decimal place.\n  rounded_errors = np.round(pae.astype(np.float64), decimals=1)\n  formatted_output = [{\n      'predicted_aligned_error': rounded_errors.tolist(),\n      'max_predicted_aligned_error': max_pae\n  }]\n  return json.dumps(formatted_output, indent=None, separators=(',', ':'))\n"
  },
  {
    "path": "alphafold/notebooks/notebook_utils_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for notebook_utils.\"\"\"\nimport io\n\nfrom absl.testing import absltest\nfrom absl.testing import parameterized\nfrom alphafold.data import parsers\nfrom alphafold.data import templates\nfrom alphafold.notebooks import notebook_utils\n\nimport mock\nimport numpy as np\n\n\nONLY_QUERY_HIT = {\n    'sto': (\n        '# STOCKHOLM 1.0\\n'\n        '#=GF ID query-i1\\n'\n        'query   MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEH\\n'\n        '//\\n'),\n    'tbl': '',\n    'stderr': b'',\n    'n_iter': 1,\n    'e_value': 0.0001}\n\n# pylint: disable=line-too-long\nMULTI_SEQUENCE_HIT_1 = {\n    'sto': (\n        '# STOCKHOLM 1.0\\n'\n        '#=GF ID query-i1\\n'\n        '#=GS ERR1700680_4602609/41-109  DE [subseq from] ERR1700680_4602609\\n'\n        '#=GS ERR1019366_5760491/40-105  DE [subseq from] ERR1019366_5760491\\n'\n        '#=GS SRR5580704_12853319/61-125 DE [subseq from] SRR5580704_12853319\\n'\n        'query                              MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\\n'\n        'ERR1700680_4602609/41-109          --INKGAEYHKKAAEHHELAAKHHREAAKHHEAGSHEKAAHHSEIAAGHGLTAVHHTEEATK-HHPEEHTEK--\\n'\n        'ERR1019366_5760491/40-105          ---RSGAQHHDAAAQHYEEAARHHRMAAKQYQASHHEKAAHYAQLAYAHHMYAEQHAAEAAK-AHAKNHG----\\n'\n        'SRR5580704_12853319/61-125         ----PAADHHMKAAEHHEEAAKHHRAAAEHHTAGDHQKAGHHAHVANGHHVNAVHHAEEASK-HHATDHS----\\n'\n        '//\\n'),\n    'tbl': (\n        'ERR1700680_4602609   -          query                -            7.7e-09   47.7  33.8   1.1e-08   47.2  33.8   1.2   1   0   0   1   1   1   1 -\\n'\n        'ERR1019366_5760491   -          query                -            1.7e-08   46.6  33.1   2.5e-08   46.1  33.1   1.3   1   0   0   1   1   1   1 -\\n'\n        'SRR5580704_12853319  -          query                -            1.1e-07   44.0  41.6     2e-07   43.1  41.6   1.4   1   0   0   1   1   1   1 -\\n'),\n        'stderr': b'',\n        'n_iter': 1,\n        'e_value': 0.0001}\n\nMULTI_SEQUENCE_HIT_2 = {\n    'sto': (\n        '# STOCKHOLM 1.0\\n'\n        '#=GF ID query-i1\\n'\n        '#=GS ERR1700719_3476944/70-137  DE [subseq from] ERR1700719_3476944\\n'\n        '#=GS ERR1700761_4254522/72-138  DE [subseq from] ERR1700761_4254522\\n'\n        '#=GS SRR5438477_9761204/64-132  DE [subseq from] SRR5438477_9761204\\n'\n        'query                              MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\\n'\n        'ERR1700719_3476944/70-137          ---KQAAEHHHQAAEHHEHAARHHREAAKHHEAGDHESAAHHAHTAQGHLHQATHHASEAAKLHVEHHGQK--\\n'\n        'ERR1700761_4254522/72-138          ----QASEHHNLAAEHHEHAARHHRDAAKHHKAGDHEKAAHHAHVAHGHHLHATHHATEAAKHHVEAHGEK--\\n'\n        'SRR5438477_9761204/64-132          MPKHEGAEHHKKAAEHNEHAARHHKEAARHHEEGSHEKVGHHAHIAHGHHLHATHHAEEAAKTHSNQHE----\\n'\n        '//\\n'),\n    'tbl': (\n        'ERR1700719_3476944   -          query                -              2e-07   43.2  47.5   3.5e-07   42.4  47.5   1.4   1   0   0   1   1   1   1 -\\n'\n        'ERR1700761_4254522   -          query                -            6.1e-07   41.6  48.1   8.1e-07   41.3  48.1   1.2   1   0   0   1   1   1   1 -\\n'\n        'SRR5438477_9761204   -          query                -            1.8e-06   40.2  46.9   2.3e-06   39.8  46.9   1.2   1   0   0   1   1   1   1 -\\n'),\n        'stderr': b'',\n        'n_iter': 1,\n        'e_value': 0.0001}\n# pylint: enable=line-too-long\n\n\nclass NotebookUtilsTest(parameterized.TestCase):\n\n  @parameterized.parameters(\n      ('DeepMind', 'DEEPMIND'), ('A ', 'A'), ('\\tA', 'A'), (' A\\t\\n', 'A'),\n      ('ACDEFGHIKLMNPQRSTVWY', 'ACDEFGHIKLMNPQRSTVWY'))\n  def test_clean_and_validate_sequence_ok(self, sequence, exp_clean):\n    clean = notebook_utils.clean_and_validate_single_sequence(\n        sequence, min_length=1, max_length=100)\n    self.assertEqual(clean, exp_clean)\n\n  @parameterized.named_parameters(\n      ('too_short', 'AA', 'too short'),\n      ('too_long', 'AAAAAAAAAA', 'too long'),\n      ('bad_amino_acids_B', 'BBBB', 'non-amino acid'),\n      ('bad_amino_acids_J', 'JJJJ', 'non-amino acid'),\n      ('bad_amino_acids_O', 'OOOO', 'non-amino acid'),\n      ('bad_amino_acids_U', 'UUUU', 'non-amino acid'),\n      ('bad_amino_acids_X', 'XXXX', 'non-amino acid'),\n      ('bad_amino_acids_Z', 'ZZZZ', 'non-amino acid'))\n  def test_clean_and_validate_sequence_bad(self, sequence, exp_error):\n    with self.assertRaisesRegex(ValueError, f'.*{exp_error}.*'):\n      notebook_utils.clean_and_validate_single_sequence(\n          sequence, min_length=4, max_length=8)\n\n  @parameterized.parameters(\n      (['A', '', '', ' ', '\\t', ' \\t\\n', '', ''], ['A']),\n      (['', 'A'], ['A']),\n      (['A', 'C ', ''], ['A', 'C']),\n      (['', 'A', '', 'C '], ['A', 'C']))\n  def test_validate_input_ok(self, input_sequences, exp_sequences):\n    sequences = notebook_utils.clean_and_validate_input_sequences(\n        input_sequences=input_sequences,\n        min_sequence_length=1, max_sequence_length=100)\n    self.assertSequenceEqual(sequences, exp_sequences)\n\n  @parameterized.named_parameters(\n      ('no_input_sequence', ['', '\\t', '\\n'], 'No input amino acid sequence'),\n      ('too_long_single', ['AAAAAAAAA', 'AAAA'], 'Input sequence is too long'),\n      ('too_short_single', ['AAA', 'AAAA'], 'Input sequence is too short'))\n  def test_validate_input_bad(self, input_sequences, exp_error):\n    with self.assertRaisesRegex(ValueError, f'.*{exp_error}.*'):\n      notebook_utils.clean_and_validate_input_sequences(\n          input_sequences=input_sequences, min_sequence_length=4,\n          max_sequence_length=8)\n\n  def test_merge_chunked_msa_no_hits(self):\n    results = [ONLY_QUERY_HIT, ONLY_QUERY_HIT]\n    merged_msa = notebook_utils.merge_chunked_msa(\n        results=results)\n    self.assertSequenceEqual(\n        merged_msa.sequences,\n        ('MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEH',))\n    self.assertSequenceEqual(merged_msa.deletion_matrix, ([0] * 56,))\n\n  def test_merge_chunked_msa(self):\n    results = [MULTI_SEQUENCE_HIT_1, MULTI_SEQUENCE_HIT_2]\n    merged_msa = notebook_utils.merge_chunked_msa(\n        results=results)\n    self.assertLen(merged_msa.sequences, 7)\n    # The 1st one is the query.\n    self.assertEqual(\n        merged_msa.sequences[0],\n        'MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAP'\n        'KPH')\n    # The 2nd one is the one with the lowest e-value: ERR1700680_4602609.\n    self.assertEqual(\n        merged_msa.sequences[1],\n        '--INKGAEYHKKAAEHHELAAKHHREAAKHHEAGSHEKAAHHSEIAAGHGLTAVHHTEEATK-HHPEEHT'\n        'EK-')\n    # The last one is the one with the largest e-value: SRR5438477_9761204.\n    self.assertEqual(\n        merged_msa.sequences[-1],\n        'MPKHEGAEHHKKAAEHNEHAARHHKEAARHHEEGSHEKVGHHAHIAHGHHLHATHHAEEAAKTHSNQHE-'\n        '---')\n    self.assertLen(merged_msa.deletion_matrix, 7)\n\n  @mock.patch('sys.stdout', new_callable=io.StringIO)\n  def test_show_msa_info(self, mocked_stdout):\n    single_chain_msas = [\n        parsers.Msa(sequences=['A', 'B', 'C', 'C'],\n                    deletion_matrix=[None] * 4,\n                    descriptions=[''] * 4),\n        parsers.Msa(sequences=['A', 'A', 'A', 'D'],\n                    deletion_matrix=[None] * 4,\n                    descriptions=[''] * 4)\n    ]\n    notebook_utils.show_msa_info(\n        single_chain_msas=single_chain_msas, sequence_index=1)\n    self.assertEqual(mocked_stdout.getvalue(),\n                     '\\n4 unique sequences found in total for sequence 1\\n\\n')\n\n  @parameterized.named_parameters(\n      ('some_templates', 4), ('no_templates', 0))\n  def test_empty_placeholder_template_features(self, num_templates):\n    template_features = notebook_utils.empty_placeholder_template_features(\n        num_templates=num_templates, num_res=16)\n    self.assertCountEqual(template_features.keys(),\n                          templates.TEMPLATE_FEATURES.keys())\n    self.assertSameElements(\n        [v.shape[0] for v in template_features.values()], [num_templates])\n    self.assertSequenceEqual(\n        [t.dtype for t in template_features.values()],\n        [np.array([], dtype=templates.TEMPLATE_FEATURES[feat_name]).dtype\n         for feat_name in template_features])\n\n  def test_get_pae_json(self):\n    pae = np.array([[0.01, 13.12345], [20.0987, 0.0]])\n    pae_json = notebook_utils.get_pae_json(pae=pae, max_pae=31.75)\n    self.assertEqual(\n        pae_json, '[{\"predicted_aligned_error\":[[0.0,13.1],[20.1,0.0]],'\n        '\"max_predicted_aligned_error\":31.75}]')\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/relax/__init__.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\"\"\"Amber relaxation.\"\"\"\n"
  },
  {
    "path": "alphafold/relax/amber_minimize.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Restrained Amber Minimization of a structure.\"\"\"\n\nimport io\nimport time\nfrom typing import Collection, Optional, Sequence\n\nfrom absl import logging\nfrom alphafold.common import protein\nfrom alphafold.common import residue_constants\nfrom alphafold.model import folding\nfrom alphafold.relax import cleanup\nfrom alphafold.relax import utils\nimport ml_collections\nimport numpy as np\nimport jax\nimport openmm\nfrom openmm import unit\nfrom openmm import app as openmm_app\nfrom openmm.app.internal.pdbstructure import PdbStructure\n\n\nENERGY = unit.kilocalories_per_mole\nLENGTH = unit.angstroms\n\n\ndef will_restrain(atom: openmm_app.Atom, rset: str) -> bool:\n  \"\"\"Returns True if the atom will be restrained by the given restraint set.\"\"\"\n\n  if rset == \"non_hydrogen\":\n    return atom.element.name != \"hydrogen\"\n  elif rset == \"c_alpha\":\n    return atom.name == \"CA\"\n\n\ndef _add_restraints(\n    system: openmm.System,\n    reference_pdb: openmm_app.PDBFile,\n    stiffness: unit.Unit,\n    rset: str,\n    exclude_residues: Sequence[int]):\n  \"\"\"Adds a harmonic potential that restrains the system to a structure.\"\"\"\n  assert rset in [\"non_hydrogen\", \"c_alpha\"]\n\n  force = openmm.CustomExternalForce(\n      \"0.5 * k * ((x-x0)^2 + (y-y0)^2 + (z-z0)^2)\")\n  force.addGlobalParameter(\"k\", stiffness)\n  for p in [\"x0\", \"y0\", \"z0\"]:\n    force.addPerParticleParameter(p)\n\n  for i, atom in enumerate(reference_pdb.topology.atoms()):\n    if atom.residue.index in exclude_residues:\n      continue\n    if will_restrain(atom, rset):\n      force.addParticle(i, reference_pdb.positions[i])\n  logging.info(\"Restraining %d / %d particles.\",\n               force.getNumParticles(), system.getNumParticles())\n  system.addForce(force)\n\n\ndef _openmm_minimize(\n    pdb_str: str,\n    max_iterations: int,\n    tolerance: unit.Unit,\n    stiffness: unit.Unit,\n    restraint_set: str,\n    exclude_residues: Sequence[int],\n    use_gpu: bool):\n  \"\"\"Minimize energy via openmm.\"\"\"\n\n  pdb_file = io.StringIO(pdb_str)\n  pdb = openmm_app.PDBFile(pdb_file)\n\n  force_field = openmm_app.ForceField(\"amber99sb.xml\")\n  constraints = openmm_app.HBonds\n  system = force_field.createSystem(\n      pdb.topology, constraints=constraints)\n  if stiffness > 0 * ENERGY / (LENGTH**2):\n    _add_restraints(system, pdb, stiffness, restraint_set, exclude_residues)\n\n  integrator = openmm.LangevinIntegrator(0, 0.01, 0.0)\n  platform = openmm.Platform.getPlatformByName(\"CUDA\" if use_gpu else \"CPU\")\n  simulation = openmm_app.Simulation(\n      pdb.topology, system, integrator, platform)\n  simulation.context.setPositions(pdb.positions)\n\n  ret = {}\n  state = simulation.context.getState(getEnergy=True, getPositions=True)\n  ret[\"einit\"] = state.getPotentialEnergy().value_in_unit(ENERGY)\n  ret[\"posinit\"] = state.getPositions(asNumpy=True).value_in_unit(LENGTH)\n  simulation.minimizeEnergy(maxIterations=max_iterations,\n                            tolerance=tolerance)\n  state = simulation.context.getState(getEnergy=True, getPositions=True)\n  ret[\"efinal\"] = state.getPotentialEnergy().value_in_unit(ENERGY)\n  ret[\"pos\"] = state.getPositions(asNumpy=True).value_in_unit(LENGTH)\n  ret[\"min_pdb\"] = _get_pdb_string(simulation.topology, state.getPositions())\n  return ret\n\n\ndef _get_pdb_string(topology: openmm_app.Topology, positions: unit.Quantity):\n  \"\"\"Returns a pdb string provided OpenMM topology and positions.\"\"\"\n  with io.StringIO() as f:\n    openmm_app.PDBFile.writeFile(topology, positions, f)\n    return f.getvalue()\n\n\ndef _check_cleaned_atoms(pdb_cleaned_string: str, pdb_ref_string: str):\n  \"\"\"Checks that no atom positions have been altered by cleaning.\"\"\"\n  cleaned = openmm_app.PDBFile(io.StringIO(pdb_cleaned_string))\n  reference = openmm_app.PDBFile(io.StringIO(pdb_ref_string))\n\n  cl_xyz = np.array(cleaned.getPositions().value_in_unit(LENGTH))\n  ref_xyz = np.array(reference.getPositions().value_in_unit(LENGTH))\n\n  for ref_res, cl_res in zip(reference.topology.residues(),\n                             cleaned.topology.residues()):\n    assert ref_res.name == cl_res.name\n    for rat in ref_res.atoms():\n      for cat in cl_res.atoms():\n        if cat.name == rat.name:\n          if not np.array_equal(cl_xyz[cat.index], ref_xyz[rat.index]):\n            raise ValueError(f\"Coordinates of cleaned atom {cat} do not match \"\n                             f\"coordinates of reference atom {rat}.\")\n\n\ndef _check_residues_are_well_defined(prot: protein.Protein):\n  \"\"\"Checks that all residues contain non-empty atom sets.\"\"\"\n  if (prot.atom_mask.sum(axis=-1) == 0).any():\n    raise ValueError(\"Amber minimization can only be performed on proteins with\"\n                     \" well-defined residues. This protein contains at least\"\n                     \" one residue with no atoms.\")\n\n\ndef _check_atom_mask_is_ideal(prot):\n  \"\"\"Sanity-check the atom mask is ideal, up to a possible OXT.\"\"\"\n  atom_mask = prot.atom_mask\n  ideal_atom_mask = protein.ideal_atom_mask(prot)\n  utils.assert_equal_nonterminal_atom_types(atom_mask, ideal_atom_mask)\n\n\ndef clean_protein(\n    prot: protein.Protein,\n    checks: bool = True):\n  \"\"\"Adds missing atoms to Protein instance.\n\n  Args:\n    prot: A `protein.Protein` instance.\n    checks: A `bool` specifying whether to add additional checks to the cleaning\n      process.\n\n  Returns:\n    pdb_string: A string of the cleaned protein.\n  \"\"\"\n  _check_atom_mask_is_ideal(prot)\n\n  # Clean pdb.\n  prot_pdb_string = protein.to_pdb(prot)\n  pdb_file = io.StringIO(prot_pdb_string)\n  alterations_info = {}\n  fixed_pdb = cleanup.fix_pdb(pdb_file, alterations_info)\n  fixed_pdb_file = io.StringIO(fixed_pdb)\n  pdb_structure = PdbStructure(fixed_pdb_file)\n  cleanup.clean_structure(pdb_structure, alterations_info)\n\n  logging.info(\"alterations info: %s\", alterations_info)\n\n  # Write pdb file of cleaned structure.\n  as_file = openmm_app.PDBFile(pdb_structure)\n  pdb_string = _get_pdb_string(as_file.getTopology(), as_file.getPositions())\n  if checks:\n    _check_cleaned_atoms(pdb_string, prot_pdb_string)\n  return pdb_string\n\n\ndef make_atom14_positions(prot):\n  \"\"\"Constructs denser atom positions (14 dimensions instead of 37).\"\"\"\n  restype_atom14_to_atom37 = []  # mapping (restype, atom14) --> atom37\n  restype_atom37_to_atom14 = []  # mapping (restype, atom37) --> atom14\n  restype_atom14_mask = []\n\n  for rt in residue_constants.restypes:\n    atom_names = residue_constants.restype_name_to_atom14_names[\n        residue_constants.restype_1to3[rt]]\n\n    restype_atom14_to_atom37.append([\n        (residue_constants.atom_order[name] if name else 0)\n        for name in atom_names\n    ])\n\n    atom_name_to_idx14 = {name: i for i, name in enumerate(atom_names)}\n    restype_atom37_to_atom14.append([\n        (atom_name_to_idx14[name] if name in atom_name_to_idx14 else 0)\n        for name in residue_constants.atom_types\n    ])\n\n    restype_atom14_mask.append([(1. if name else 0.) for name in atom_names])\n\n  # Add dummy mapping for restype 'UNK'.\n  restype_atom14_to_atom37.append([0] * 14)\n  restype_atom37_to_atom14.append([0] * 37)\n  restype_atom14_mask.append([0.] * 14)\n\n  restype_atom14_to_atom37 = np.array(restype_atom14_to_atom37, dtype=np.int32)\n  restype_atom37_to_atom14 = np.array(restype_atom37_to_atom14, dtype=np.int32)\n  restype_atom14_mask = np.array(restype_atom14_mask, dtype=np.float32)\n\n  # Create the mapping for (residx, atom14) --> atom37, i.e. an array\n  # with shape (num_res, 14) containing the atom37 indices for this protein.\n  residx_atom14_to_atom37 = restype_atom14_to_atom37[prot[\"aatype\"]]\n  residx_atom14_mask = restype_atom14_mask[prot[\"aatype\"]]\n\n  # Create a mask for known ground truth positions.\n  residx_atom14_gt_mask = residx_atom14_mask * np.take_along_axis(\n      prot[\"all_atom_mask\"], residx_atom14_to_atom37, axis=1).astype(np.float32)\n\n  # Gather the ground truth positions.\n  residx_atom14_gt_positions = residx_atom14_gt_mask[:, :, None] * (\n      np.take_along_axis(prot[\"all_atom_positions\"],\n                         residx_atom14_to_atom37[..., None],\n                         axis=1))\n\n  prot[\"atom14_atom_exists\"] = residx_atom14_mask\n  prot[\"atom14_gt_exists\"] = residx_atom14_gt_mask\n  prot[\"atom14_gt_positions\"] = residx_atom14_gt_positions\n\n  prot[\"residx_atom14_to_atom37\"] = residx_atom14_to_atom37\n\n  # Create the gather indices for mapping back.\n  residx_atom37_to_atom14 = restype_atom37_to_atom14[prot[\"aatype\"]]\n  prot[\"residx_atom37_to_atom14\"] = residx_atom37_to_atom14\n\n  # Create the corresponding mask.\n  restype_atom37_mask = np.zeros([21, 37], dtype=np.float32)\n  for restype, restype_letter in enumerate(residue_constants.restypes):\n    restype_name = residue_constants.restype_1to3[restype_letter]\n    atom_names = residue_constants.residue_atoms[restype_name]\n    for atom_name in atom_names:\n      atom_type = residue_constants.atom_order[atom_name]\n      restype_atom37_mask[restype, atom_type] = 1\n\n  residx_atom37_mask = restype_atom37_mask[prot[\"aatype\"]]\n  prot[\"atom37_atom_exists\"] = residx_atom37_mask\n\n  # As the atom naming is ambiguous for 7 of the 20 amino acids, provide\n  # alternative ground truth coordinates where the naming is swapped\n  restype_3 = [\n      residue_constants.restype_1to3[res] for res in residue_constants.restypes\n  ]\n  restype_3 += [\"UNK\"]\n\n  # Matrices for renaming ambiguous atoms.\n  all_matrices = {res: np.eye(14, dtype=np.float32) for res in restype_3}\n  for resname, swap in residue_constants.residue_atom_renaming_swaps.items():\n    correspondences = np.arange(14)\n    for source_atom_swap, target_atom_swap in swap.items():\n      source_index = residue_constants.restype_name_to_atom14_names[\n          resname].index(source_atom_swap)\n      target_index = residue_constants.restype_name_to_atom14_names[\n          resname].index(target_atom_swap)\n      correspondences[source_index] = target_index\n      correspondences[target_index] = source_index\n      renaming_matrix = np.zeros((14, 14), dtype=np.float32)\n      for index, correspondence in enumerate(correspondences):\n        renaming_matrix[index, correspondence] = 1.\n    all_matrices[resname] = renaming_matrix.astype(np.float32)\n  renaming_matrices = np.stack([all_matrices[restype] for restype in restype_3])\n\n  # Pick the transformation matrices for the given residue sequence\n  # shape (num_res, 14, 14).\n  renaming_transform = renaming_matrices[prot[\"aatype\"]]\n\n  # Apply it to the ground truth positions. shape (num_res, 14, 3).\n  alternative_gt_positions = np.einsum(\"rac,rab->rbc\",\n                                       residx_atom14_gt_positions,\n                                       renaming_transform)\n  prot[\"atom14_alt_gt_positions\"] = alternative_gt_positions\n\n  # Create the mask for the alternative ground truth (differs from the\n  # ground truth mask, if only one of the atoms in an ambiguous pair has a\n  # ground truth position).\n  alternative_gt_mask = np.einsum(\"ra,rab->rb\",\n                                  residx_atom14_gt_mask,\n                                  renaming_transform)\n\n  prot[\"atom14_alt_gt_exists\"] = alternative_gt_mask\n\n  # Create an ambiguous atoms mask.  shape: (21, 14).\n  restype_atom14_is_ambiguous = np.zeros((21, 14), dtype=np.float32)\n  for resname, swap in residue_constants.residue_atom_renaming_swaps.items():\n    for atom_name1, atom_name2 in swap.items():\n      restype = residue_constants.restype_order[\n          residue_constants.restype_3to1[resname]]\n      atom_idx1 = residue_constants.restype_name_to_atom14_names[resname].index(\n          atom_name1)\n      atom_idx2 = residue_constants.restype_name_to_atom14_names[resname].index(\n          atom_name2)\n      restype_atom14_is_ambiguous[restype, atom_idx1] = 1\n      restype_atom14_is_ambiguous[restype, atom_idx2] = 1\n\n  # From this create an ambiguous_mask for the given sequence.\n  prot[\"atom14_atom_is_ambiguous\"] = (\n      restype_atom14_is_ambiguous[prot[\"aatype\"]])\n\n  return prot\n\n\ndef find_violations(prot_np: protein.Protein):\n  \"\"\"Analyzes a protein and returns structural violation information.\n\n  Args:\n    prot_np: A protein.\n\n  Returns:\n    violations: A `dict` of structure components with structural violations.\n    violation_metrics: A `dict` of violation metrics.\n  \"\"\"\n  batch = {\n      \"aatype\": prot_np.aatype,\n      \"all_atom_positions\": prot_np.atom_positions.astype(np.float32),\n      \"all_atom_mask\": prot_np.atom_mask.astype(np.float32),\n      \"residue_index\": prot_np.residue_index,\n  }\n\n  batch[\"seq_mask\"] = np.ones_like(batch[\"aatype\"], np.float32)\n  batch = make_atom14_positions(batch)\n\n  violations = folding.find_structural_violations(\n      batch=batch,\n      atom14_pred_positions=batch[\"atom14_gt_positions\"],\n      config=ml_collections.ConfigDict(\n          {\"violation_tolerance_factor\": 12,  # Taken from model config.\n           \"clash_overlap_tolerance\": 1.5,  # Taken from model config.\n          }))\n  violation_metrics = folding.compute_violation_metrics(\n      batch=batch,\n      atom14_pred_positions=batch[\"atom14_gt_positions\"],\n      violations=violations,\n  )\n\n  return violations, violation_metrics\n\n\ndef get_violation_metrics(prot: protein.Protein):\n  \"\"\"Computes violation and alignment metrics.\"\"\"\n  structural_violations, struct_metrics = find_violations(prot)\n  violation_idx = np.flatnonzero(\n      structural_violations[\"total_per_residue_violations_mask\"])\n\n  struct_metrics[\"residue_violations\"] = violation_idx\n  struct_metrics[\"num_residue_violations\"] = len(violation_idx)\n  struct_metrics[\"structural_violations\"] = structural_violations\n  return struct_metrics\n\n\ndef _run_one_iteration(\n    *,\n    pdb_string: str,\n    max_iterations: int,\n    tolerance: float,\n    stiffness: float,\n    restraint_set: str,\n    max_attempts: int,\n    use_gpu: bool,\n    exclude_residues: Optional[Collection[int]] = None):\n  \"\"\"Runs the minimization pipeline.\n\n  Args:\n    pdb_string: A pdb string.\n    max_iterations: An `int` specifying the maximum number of L-BFGS iterations.\n    A value of 0 specifies no limit.\n    tolerance: kcal/mol, the energy tolerance of L-BFGS.\n    stiffness: kcal/mol A**2, spring constant of heavy atom restraining\n      potential.\n    restraint_set: The set of atoms to restrain.\n    max_attempts: The maximum number of minimization attempts.\n    use_gpu: Whether to run on GPU.\n    exclude_residues: An optional list of zero-indexed residues to exclude from\n        restraints.\n\n  Returns:\n    A `dict` of minimization info.\n  \"\"\"\n  exclude_residues = exclude_residues or []\n\n  # Assign physical dimensions.\n  tolerance = tolerance * ENERGY\n  stiffness = stiffness * ENERGY / (LENGTH**2)\n\n  start = time.time()\n  minimized = False\n  attempts = 0\n  while not minimized and attempts < max_attempts:\n    attempts += 1\n    try:\n      logging.info(\"Minimizing protein, attempt %d of %d.\",\n                   attempts, max_attempts)\n      ret = _openmm_minimize(\n          pdb_string, max_iterations=max_iterations,\n          tolerance=tolerance, stiffness=stiffness,\n          restraint_set=restraint_set,\n          exclude_residues=exclude_residues,\n          use_gpu=use_gpu)\n      minimized = True\n    except Exception as e:  # pylint: disable=broad-except\n      logging.info(e)\n  if not minimized:\n    raise ValueError(f\"Minimization failed after {max_attempts} attempts.\")\n  ret[\"opt_time\"] = time.time() - start\n  ret[\"min_attempts\"] = attempts\n  return ret\n\n\ndef run_pipeline(\n    prot: protein.Protein,\n    stiffness: float,\n    use_gpu: bool,\n    max_outer_iterations: int = 1,\n    place_hydrogens_every_iteration: bool = True,\n    max_iterations: int = 0,\n    tolerance: float = 2.39,\n    restraint_set: str = \"non_hydrogen\",\n    max_attempts: int = 100,\n    checks: bool = True,\n    exclude_residues: Optional[Sequence[int]] = None):\n  \"\"\"Run iterative amber relax.\n\n  Successive relax iterations are performed until all violations have been\n  resolved. Each iteration involves a restrained Amber minimization, with\n  restraint exclusions determined by violation-participating residues.\n\n  Args:\n    prot: A protein to be relaxed.\n    stiffness: kcal/mol A**2, the restraint stiffness.\n    use_gpu: Whether to run on GPU.\n    max_outer_iterations: The maximum number of iterative minimization.\n    place_hydrogens_every_iteration: Whether hydrogens are re-initialized\n        prior to every minimization.\n    max_iterations: An `int` specifying the maximum number of L-BFGS steps\n        per relax iteration. A value of 0 specifies no limit.\n    tolerance: kcal/mol, the energy tolerance of L-BFGS.\n        The default value is the OpenMM default.\n    restraint_set: The set of atoms to restrain.\n    max_attempts: The maximum number of minimization attempts per iteration.\n    checks: Whether to perform cleaning checks.\n    exclude_residues: An optional list of zero-indexed residues to exclude from\n        restraints.\n\n  Returns:\n    out: A dictionary of output values.\n  \"\"\"\n\n  # `protein.to_pdb` will strip any poorly-defined residues so we need to\n  # perform this check before `clean_protein`.\n  _check_residues_are_well_defined(prot)\n  pdb_string = clean_protein(prot, checks=checks)\n\n  exclude_residues = exclude_residues or []\n  exclude_residues = set(exclude_residues)\n  violations = np.inf\n  iteration = 0\n\n  while violations > 0 and iteration < max_outer_iterations:\n    ret = _run_one_iteration(\n        pdb_string=pdb_string,\n        exclude_residues=exclude_residues,\n        max_iterations=max_iterations,\n        tolerance=tolerance,\n        stiffness=stiffness,\n        restraint_set=restraint_set,\n        max_attempts=max_attempts,\n        use_gpu=use_gpu)\n    prot = protein.from_pdb_string(ret[\"min_pdb\"])\n    if place_hydrogens_every_iteration:\n      pdb_string = clean_protein(prot, checks=True)\n    else:\n      pdb_string = ret[\"min_pdb\"]\n    # Calculation of violations can cause CUDA errors for some JAX versions.\n    with jax.default_device(jax.devices(\"cpu\")[0]):\n      ret.update(get_violation_metrics(prot))\n    ret.update({\n        \"num_exclusions\": len(exclude_residues),\n        \"iteration\": iteration,\n    })\n    violations = ret[\"violations_per_residue\"]\n    exclude_residues = exclude_residues.union(ret[\"residue_violations\"])\n\n    logging.info(\"Iteration completed: Einit %.2f Efinal %.2f Time %.2f s \"\n                 \"num residue violations %d num residue exclusions %d \",\n                 ret[\"einit\"], ret[\"efinal\"], ret[\"opt_time\"],\n                 ret[\"num_residue_violations\"], ret[\"num_exclusions\"])\n    iteration += 1\n  return ret\n"
  },
  {
    "path": "alphafold/relax/amber_minimize_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for amber_minimize.\"\"\"\nimport os\n\nfrom absl.testing import absltest\nfrom alphafold.common import protein\nfrom alphafold.relax import amber_minimize\nimport numpy as np\n# Internal import (7716).\n\n_USE_GPU = False\n\n\ndef _load_test_protein(data_path):\n  pdb_path = os.path.join(absltest.get_default_test_srcdir(), data_path)\n  with open(pdb_path, 'r') as f:\n    return protein.from_pdb_string(f.read())\n\n\nclass AmberMinimizeTest(absltest.TestCase):\n\n  def test_multiple_disulfides_target(self):\n    prot = _load_test_protein(\n        'alphafold/relax/testdata/multiple_disulfides_target.pdb'\n        )\n    ret = amber_minimize.run_pipeline(prot, max_iterations=10, max_attempts=1,\n                                      stiffness=10., use_gpu=_USE_GPU)\n    self.assertIn('opt_time', ret)\n    self.assertIn('min_attempts', ret)\n\n  def test_raises_invalid_protein_assertion(self):\n    prot = _load_test_protein(\n        'alphafold/relax/testdata/multiple_disulfides_target.pdb'\n        )\n    prot.atom_mask[4, :] = 0\n    with self.assertRaisesRegex(\n        ValueError,\n        'Amber minimization can only be performed on proteins with well-defined'\n        ' residues. This protein contains at least one residue with no atoms.'):\n      amber_minimize.run_pipeline(prot, max_iterations=10,\n                                  stiffness=1.,\n                                  max_attempts=1,\n                                  use_gpu=_USE_GPU)\n\n  def test_iterative_relax(self):\n    prot = _load_test_protein(\n        'alphafold/relax/testdata/with_violations.pdb'\n        )\n    violations = amber_minimize.get_violation_metrics(prot)\n    self.assertGreater(violations['num_residue_violations'], 0)\n    out = amber_minimize.run_pipeline(\n        prot=prot, max_outer_iterations=10, stiffness=10., use_gpu=_USE_GPU)\n    self.assertLess(out['efinal'], out['einit'])\n    self.assertEqual(0, out['num_residue_violations'])\n\n  def test_find_violations(self):\n    prot = _load_test_protein(\n        'alphafold/relax/testdata/multiple_disulfides_target.pdb'\n        )\n    viols, _ = amber_minimize.find_violations(prot)\n\n    expected_between_residues_connection_mask = np.zeros((191,), np.float32)\n    for residue in (42, 43, 59, 60, 135, 136):\n      expected_between_residues_connection_mask[residue] = 1.0\n\n    expected_clash_indices = np.array([\n        [8, 4],\n        [8, 5],\n        [13, 3],\n        [14, 1],\n        [14, 4],\n        [26, 4],\n        [26, 5],\n        [31, 8],\n        [31, 10],\n        [39, 0],\n        [39, 1],\n        [39, 2],\n        [39, 3],\n        [39, 4],\n        [42, 5],\n        [42, 6],\n        [42, 7],\n        [42, 8],\n        [47, 7],\n        [47, 8],\n        [47, 9],\n        [47, 10],\n        [64, 4],\n        [85, 5],\n        [102, 4],\n        [102, 5],\n        [109, 13],\n        [111, 5],\n        [118, 6],\n        [118, 7],\n        [118, 8],\n        [124, 4],\n        [124, 5],\n        [131, 5],\n        [139, 7],\n        [147, 4],\n        [152, 7]], dtype=np.int32)\n    expected_between_residues_clash_mask = np.zeros([191, 14])\n    expected_between_residues_clash_mask[expected_clash_indices[:, 0],\n                                         expected_clash_indices[:, 1]] += 1\n    expected_per_atom_violations = np.zeros([191, 14])\n    np.testing.assert_array_equal(\n        viols['between_residues']['connections_per_residue_violation_mask'],\n        expected_between_residues_connection_mask)\n    np.testing.assert_array_equal(\n        viols['between_residues']['clashes_per_atom_clash_mask'],\n        expected_between_residues_clash_mask)\n    np.testing.assert_array_equal(\n        viols['within_residues']['per_atom_violations'],\n        expected_per_atom_violations)\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/relax/cleanup.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Cleans up a PDB file using pdbfixer in preparation for OpenMM simulations.\n\nfix_pdb uses a third-party tool. We also support fixing some additional edge\ncases like removing chains of length one (see clean_structure).\n\"\"\"\nimport io\n\nimport pdbfixer\nfrom openmm import app\nfrom openmm.app import element\n\n\ndef fix_pdb(pdbfile, alterations_info):\n  \"\"\"Apply pdbfixer to the contents of a PDB file; return a PDB string result.\n\n  1) Replaces nonstandard residues.\n  2) Removes heterogens (non protein residues) including water.\n  3) Adds missing residues and missing atoms within existing residues.\n  4) Adds hydrogens assuming pH=7.0.\n  5) KeepIds is currently true, so the fixer must keep the existing chain and\n     residue identifiers. This will fail for some files in wider PDB that have\n     invalid IDs.\n\n  Args:\n    pdbfile: Input PDB file handle.\n    alterations_info: A dict that will store details of changes made.\n\n  Returns:\n    A PDB string representing the fixed structure.\n  \"\"\"\n  fixer = pdbfixer.PDBFixer(pdbfile=pdbfile)\n  fixer.findNonstandardResidues()\n  alterations_info['nonstandard_residues'] = fixer.nonstandardResidues\n  fixer.replaceNonstandardResidues()\n  _remove_heterogens(fixer, alterations_info, keep_water=False)\n  fixer.findMissingResidues()\n  alterations_info['missing_residues'] = fixer.missingResidues\n  fixer.findMissingAtoms()\n  alterations_info['missing_heavy_atoms'] = fixer.missingAtoms\n  alterations_info['missing_terminals'] = fixer.missingTerminals\n  fixer.addMissingAtoms(seed=0)\n  fixer.addMissingHydrogens()\n  out_handle = io.StringIO()\n  app.PDBFile.writeFile(fixer.topology, fixer.positions, out_handle,\n                        keepIds=True)\n  return out_handle.getvalue()\n\n\ndef clean_structure(pdb_structure, alterations_info):\n  \"\"\"Applies additional fixes to an OpenMM structure, to handle edge cases.\n\n  Args:\n    pdb_structure: An OpenMM structure to modify and fix.\n    alterations_info: A dict that will store details of changes made.\n  \"\"\"\n  _replace_met_se(pdb_structure, alterations_info)\n  _remove_chains_of_length_one(pdb_structure, alterations_info)\n\n\ndef _remove_heterogens(fixer, alterations_info, keep_water):\n  \"\"\"Removes the residues that Pdbfixer considers to be heterogens.\n\n  Args:\n    fixer: A Pdbfixer instance.\n    alterations_info: A dict that will store details of changes made.\n    keep_water: If True, water (HOH) is not considered to be a heterogen.\n  \"\"\"\n  initial_resnames = set()\n  for chain in fixer.topology.chains():\n    for residue in chain.residues():\n      initial_resnames.add(residue.name)\n  fixer.removeHeterogens(keepWater=keep_water)\n  final_resnames = set()\n  for chain in fixer.topology.chains():\n    for residue in chain.residues():\n      final_resnames.add(residue.name)\n  alterations_info['removed_heterogens'] = (\n      initial_resnames.difference(final_resnames))\n\n\ndef _replace_met_se(pdb_structure, alterations_info):\n  \"\"\"Replace the Se in any MET residues that were not marked as modified.\"\"\"\n  modified_met_residues = []\n  for res in pdb_structure.iter_residues():\n    name = res.get_name_with_spaces().strip()\n    if name == 'MET':\n      s_atom = res.get_atom('SD')\n      if s_atom.element_symbol == 'Se':\n        s_atom.element_symbol = 'S'\n        s_atom.element = element.get_by_symbol('S')\n        modified_met_residues.append(s_atom.residue_number)\n  alterations_info['Se_in_MET'] = modified_met_residues\n\n\ndef _remove_chains_of_length_one(pdb_structure, alterations_info):\n  \"\"\"Removes chains that correspond to a single amino acid.\n\n  A single amino acid in a chain is both N and C terminus. There is no force\n  template for this case.\n\n  Args:\n    pdb_structure: An OpenMM pdb_structure to modify and fix.\n    alterations_info: A dict that will store details of changes made.\n  \"\"\"\n  removed_chains = {}\n  for model in pdb_structure.iter_models():\n    valid_chains = [c for c in model.iter_chains() if len(c) > 1]\n    invalid_chain_ids = [c.chain_id for c in model.iter_chains() if len(c) <= 1]\n    model.chains = valid_chains\n    for chain_id in invalid_chain_ids:\n      model.chains_by_id.pop(chain_id)\n    removed_chains[model.number] = invalid_chain_ids\n  alterations_info['removed_chains'] = removed_chains\n"
  },
  {
    "path": "alphafold/relax/cleanup_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for relax.cleanup.\"\"\"\nimport io\n\nfrom absl.testing import absltest\nfrom alphafold.relax import cleanup\nfrom openmm.app.internal import pdbstructure\n\n\ndef _pdb_to_structure(pdb_str):\n  handle = io.StringIO(pdb_str)\n  return pdbstructure.PdbStructure(handle)\n\n\ndef _lines_to_structure(pdb_lines):\n  return _pdb_to_structure('\\n'.join(pdb_lines))\n\n\nclass CleanupTest(absltest.TestCase):\n\n  def test_missing_residues(self):\n    pdb_lines = ['SEQRES   1 C    3  CYS GLY LEU',\n                 'ATOM      1  N   CYS C   1     -12.262  20.115  60.959  1.00 '\n                 '19.08           N',\n                 'ATOM      2  CA  CYS C   1     -11.065  20.934  60.773  1.00 '\n                 '17.23           C',\n                 'ATOM      3  C   CYS C   1     -10.002  20.742  61.844  1.00 '\n                 '15.38           C',\n                 'ATOM      4  O   CYS C   1     -10.284  20.225  62.929  1.00 '\n                 '16.04           O',\n                 'ATOM      5  N   LEU C   3      -7.688  18.700  62.045  1.00 '\n                 '14.75           N',\n                 'ATOM      6  CA  LEU C   3      -7.256  17.320  62.234  1.00 '\n                 '16.81           C',\n                 'ATOM      7  C   LEU C   3      -6.380  16.864  61.070  1.00 '\n                 '16.95           C',\n                 'ATOM      8  O   LEU C   3      -6.551  17.332  59.947  1.00 '\n                 '16.97           O']\n    input_handle = io.StringIO('\\n'.join(pdb_lines))\n    alterations = {}\n    result = cleanup.fix_pdb(input_handle, alterations)\n    structure = _pdb_to_structure(result)\n    residue_names = [r.get_name() for r in structure.iter_residues()]\n    self.assertCountEqual(residue_names, ['CYS', 'GLY', 'LEU'])\n    self.assertCountEqual(alterations['missing_residues'].values(), [['GLY']])\n\n  def test_missing_atoms(self):\n    pdb_lines = ['SEQRES   1 A    1  PRO',\n                 'ATOM      1  CA  PRO A   1       1.000   1.000   1.000  1.00 '\n                 ' 0.00           C']\n    input_handle = io.StringIO('\\n'.join(pdb_lines))\n    alterations = {}\n    result = cleanup.fix_pdb(input_handle, alterations)\n    structure = _pdb_to_structure(result)\n    atom_names = [a.get_name() for a in structure.iter_atoms()]\n    self.assertCountEqual(atom_names, ['N', 'CD', 'HD2', 'HD3', 'CG', 'HG2',\n                                       'HG3', 'CB', 'HB2', 'HB3', 'CA', 'HA',\n                                       'C', 'O', 'H2', 'H3', 'OXT'])\n    missing_atoms_by_residue = list(alterations['missing_heavy_atoms'].values())\n    self.assertLen(missing_atoms_by_residue, 1)\n    atoms_added = [a.name for a in missing_atoms_by_residue[0]]\n    self.assertCountEqual(atoms_added, ['N', 'CD', 'CG', 'CB', 'C', 'O'])\n    missing_terminals_by_residue = alterations['missing_terminals']\n    self.assertLen(missing_terminals_by_residue, 1)\n    has_missing_terminal = [r.name for r in missing_terminals_by_residue.keys()]\n    self.assertCountEqual(has_missing_terminal, ['PRO'])\n    self.assertCountEqual([t for t in missing_terminals_by_residue.values()],\n                          [['OXT']])\n\n  def test_remove_heterogens(self):\n    pdb_lines = ['SEQRES   1 A    1  GLY',\n                 'ATOM      1  CA  GLY A   1       0.000   0.000   0.000  1.00 '\n                 ' 0.00           C',\n                 'ATOM      2   O  HOH A   2       0.000   0.000   0.000  1.00 '\n                 ' 0.00           O']\n    input_handle = io.StringIO('\\n'.join(pdb_lines))\n    alterations = {}\n    result = cleanup.fix_pdb(input_handle, alterations)\n    structure = _pdb_to_structure(result)\n    self.assertCountEqual([res.get_name() for res in structure.iter_residues()],\n                          ['GLY'])\n    self.assertEqual(alterations['removed_heterogens'], set(['HOH']))\n\n  def test_fix_nonstandard_residues(self):\n    pdb_lines = ['SEQRES   1 A    1  DAL',\n                 'ATOM      1  CA  DAL A   1       0.000   0.000   0.000  1.00 '\n                 ' 0.00           C']\n    input_handle = io.StringIO('\\n'.join(pdb_lines))\n    alterations = {}\n    result = cleanup.fix_pdb(input_handle, alterations)\n    structure = _pdb_to_structure(result)\n    residue_names = [res.get_name() for res in structure.iter_residues()]\n    self.assertCountEqual(residue_names, ['ALA'])\n    self.assertLen(alterations['nonstandard_residues'], 1)\n    original_res, new_name = alterations['nonstandard_residues'][0]\n    self.assertEqual(original_res.id, '1')\n    self.assertEqual(new_name, 'ALA')\n\n  def test_replace_met_se(self):\n    pdb_lines = ['SEQRES   1 A    1  MET',\n                 'ATOM      1  SD  MET A   1       0.000   0.000   0.000  1.00 '\n                 ' 0.00          Se']\n    structure = _lines_to_structure(pdb_lines)\n    alterations = {}\n    cleanup._replace_met_se(structure, alterations)\n    sd = [a for a in structure.iter_atoms() if a.get_name() == 'SD']\n    self.assertLen(sd, 1)\n    self.assertEqual(sd[0].element_symbol, 'S')\n    self.assertCountEqual(alterations['Se_in_MET'], [sd[0].residue_number])\n\n  def test_remove_chains_of_length_one(self):\n    pdb_lines = ['SEQRES   1 A    1  GLY',\n                 'ATOM      1  CA  GLY A   1       0.000   0.000   0.000  1.00 '\n                 ' 0.00           C']\n    structure = _lines_to_structure(pdb_lines)\n    alterations = {}\n    cleanup._remove_chains_of_length_one(structure, alterations)\n    chains = list(structure.iter_chains())\n    self.assertEmpty(chains)\n    self.assertCountEqual(alterations['removed_chains'].values(), [['A']])\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/relax/relax.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Amber relaxation.\"\"\"\nfrom typing import Any, Dict, Sequence, Tuple\nfrom alphafold.common import protein\nfrom alphafold.relax import amber_minimize\nfrom alphafold.relax import utils\nimport numpy as np\n\n\nclass AmberRelaxation(object):\n  \"\"\"Amber relaxation.\"\"\"\n\n  def __init__(self,\n               *,\n               max_iterations: int,\n               tolerance: float,\n               stiffness: float,\n               exclude_residues: Sequence[int],\n               max_outer_iterations: int,\n               use_gpu: bool):\n    \"\"\"Initialize Amber Relaxer.\n\n    Args:\n      max_iterations: Maximum number of L-BFGS iterations. 0 means no max.\n      tolerance: kcal/mol, the energy tolerance of L-BFGS.\n      stiffness: kcal/mol A**2, spring constant of heavy atom restraining\n        potential.\n      exclude_residues: Residues to exclude from per-atom restraining.\n        Zero-indexed.\n      max_outer_iterations: Maximum number of violation-informed relax\n       iterations. A value of 1 will run the non-iterative procedure used in\n       CASP14. Use 20 so that >95% of the bad cases are relaxed. Relax finishes\n       as soon as there are no violations, hence in most cases this causes no\n       slowdown. In the worst case we do 20 outer iterations.\n      use_gpu: Whether to run on GPU.\n    \"\"\"\n\n    self._max_iterations = max_iterations\n    self._tolerance = tolerance\n    self._stiffness = stiffness\n    self._exclude_residues = exclude_residues\n    self._max_outer_iterations = max_outer_iterations\n    self._use_gpu = use_gpu\n\n  def process(self, *,\n              prot: protein.Protein\n              ) -> Tuple[str, Dict[str, Any], Sequence[float]]:\n    \"\"\"Runs Amber relax on a prediction, adds hydrogens, returns PDB string.\"\"\"\n    out = amber_minimize.run_pipeline(\n        prot=prot, max_iterations=self._max_iterations,\n        tolerance=self._tolerance, stiffness=self._stiffness,\n        exclude_residues=self._exclude_residues,\n        max_outer_iterations=self._max_outer_iterations,\n        use_gpu=self._use_gpu)\n    min_pos = out['pos']\n    start_pos = out['posinit']\n    rmsd = np.sqrt(np.sum((start_pos - min_pos)**2) / start_pos.shape[0])\n    debug_data = {\n        'initial_energy': out['einit'],\n        'final_energy': out['efinal'],\n        'attempts': out['min_attempts'],\n        'rmsd': rmsd\n    }\n    min_pdb = out['min_pdb']\n    min_pdb = utils.overwrite_b_factors(min_pdb, prot.b_factors)\n    utils.assert_equal_nonterminal_atom_types(\n        protein.from_pdb_string(min_pdb).atom_mask,\n        prot.atom_mask)\n    violations = out['structural_violations'][\n        'total_per_residue_violations_mask'].tolist()\n    return min_pdb, debug_data, violations\n"
  },
  {
    "path": "alphafold/relax/relax_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for relax.\"\"\"\nimport os\n\nfrom absl.testing import absltest\nfrom alphafold.common import protein\nfrom alphafold.relax import relax\nimport numpy as np\n# Internal import (7716).\n\n\nclass RunAmberRelaxTest(absltest.TestCase):\n\n  def setUp(self):\n    super().setUp()\n    self.test_dir = os.path.join(\n        absltest.get_default_test_srcdir(),\n        'alphafold/relax/testdata/')\n    self.test_config = {\n        'max_iterations': 1,\n        'tolerance': 2.39,\n        'stiffness': 10.0,\n        'exclude_residues': [],\n        'max_outer_iterations': 1,\n        'use_gpu': False}\n\n  def test_process(self):\n    amber_relax = relax.AmberRelaxation(**self.test_config)\n\n    with open(os.path.join(self.test_dir, 'model_output.pdb')) as f:\n      test_prot = protein.from_pdb_string(f.read())\n    pdb_min, debug_info, num_violations = amber_relax.process(prot=test_prot)\n\n    self.assertCountEqual(debug_info.keys(),\n                          set({'initial_energy', 'final_energy',\n                               'attempts', 'rmsd'}))\n    self.assertLess(debug_info['final_energy'], debug_info['initial_energy'])\n    self.assertGreater(debug_info['rmsd'], 0)\n\n    prot_min = protein.from_pdb_string(pdb_min)\n    # Most protein properties should be unchanged.\n    np.testing.assert_almost_equal(test_prot.aatype, prot_min.aatype)\n    np.testing.assert_almost_equal(test_prot.residue_index,\n                                   prot_min.residue_index)\n    # Atom mask and bfactors identical except for terminal OXT of last residue.\n    np.testing.assert_almost_equal(test_prot.atom_mask[:-1, :],\n                                   prot_min.atom_mask[:-1, :])\n    np.testing.assert_almost_equal(test_prot.b_factors[:-1, :],\n                                   prot_min.b_factors[:-1, :])\n    np.testing.assert_almost_equal(test_prot.atom_mask[:, :-1],\n                                   prot_min.atom_mask[:, :-1])\n    np.testing.assert_almost_equal(test_prot.b_factors[:, :-1],\n                                   prot_min.b_factors[:, :-1])\n    # There are no residues with violations.\n    np.testing.assert_equal(num_violations, np.zeros_like(num_violations))\n\n  def test_unresolved_violations(self):\n    amber_relax = relax.AmberRelaxation(**self.test_config)\n    with open(os.path.join(self.test_dir,\n                                 'with_violations_casp14.pdb')) as f:\n      test_prot = protein.from_pdb_string(f.read())\n    _, _, num_violations = amber_relax.process(prot=test_prot)\n    exp_num_violations = np.array(\n        [0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,\n         0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 1, 1, 1, 1, 1,\n         1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,\n         0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0,\n         0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,\n         0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0,\n         0, 0, 0, 0])\n    # Check no violations were added. Can't check exactly due to stochasticity.\n    self.assertTrue(np.all(np.array(num_violations) <= exp_num_violations))\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "alphafold/relax/testdata/model_output.pdb",
    "content": "ATOM      1  C   MET A   1       1.921 -46.152   7.786  1.00  4.39           C  \nATOM      2  CA  MET A   1       1.631 -46.829   9.131  1.00  4.39           C  \nATOM      3  CB  MET A   1       2.759 -47.768   9.578  1.00  4.39           C  \nATOM      4  CE  MET A   1       3.466 -49.770  13.198  1.00  4.39           C  \nATOM      5  CG  MET A   1       2.581 -48.221  11.034  1.00  4.39           C  \nATOM      6  H   MET A   1       0.234 -48.249   8.549  1.00  4.39           H  \nATOM      7  H2  MET A   1      -0.424 -46.789   8.952  1.00  4.39           H  \nATOM      8  H3  MET A   1       0.111 -47.796  10.118  1.00  4.39           H  \nATOM      9  HA  MET A   1       1.628 -46.009   9.849  1.00  4.39           H  \nATOM     10  HB2 MET A   1       3.701 -47.225   9.500  1.00  4.39           H  \nATOM     11  HB3 MET A   1       2.807 -48.640   8.926  1.00  4.39           H  \nATOM     12  HE1 MET A   1       2.747 -50.537  12.910  1.00  4.39           H  \nATOM     13  HE2 MET A   1       4.296 -50.241  13.725  1.00  4.39           H  \nATOM     14  HE3 MET A   1       2.988 -49.052  13.864  1.00  4.39           H  \nATOM     15  HG2 MET A   1       1.791 -48.971  11.083  1.00  4.39           H  \nATOM     16  HG3 MET A   1       2.295 -47.368  11.650  1.00  4.39           H  \nATOM     17  N   MET A   1       0.291 -47.464   9.182  1.00  4.39           N  \nATOM     18  O   MET A   1       2.091 -44.945   7.799  1.00  4.39           O  \nATOM     19  SD  MET A   1       4.096 -48.921  11.725  1.00  4.39           S  \nATOM     20  C   LYS A   2       1.366 -45.033   4.898  1.00  2.92           C  \nATOM     21  CA  LYS A   2       2.235 -46.242   5.308  1.00  2.92           C  \nATOM     22  CB  LYS A   2       2.206 -47.314   4.196  1.00  2.92           C  \nATOM     23  CD  LYS A   2       3.331 -49.342   3.134  1.00  2.92           C  \nATOM     24  CE  LYS A   2       4.434 -50.403   3.293  1.00  2.92           C  \nATOM     25  CG  LYS A   2       3.294 -48.395   4.349  1.00  2.92           C  \nATOM     26  H   LYS A   2       1.832 -47.853   6.656  1.00  2.92           H  \nATOM     27  HA  LYS A   2       3.248 -45.841   5.355  1.00  2.92           H  \nATOM     28  HB2 LYS A   2       1.223 -47.785   4.167  1.00  2.92           H  \nATOM     29  HB3 LYS A   2       2.363 -46.812   3.241  1.00  2.92           H  \nATOM     30  HD2 LYS A   2       3.524 -48.754   2.237  1.00  2.92           H  \nATOM     31  HD3 LYS A   2       2.364 -49.833   3.031  1.00  2.92           H  \nATOM     32  HE2 LYS A   2       5.383 -49.891   3.455  1.00  2.92           H  \nATOM     33  HE3 LYS A   2       4.225 -51.000   4.180  1.00  2.92           H  \nATOM     34  HG2 LYS A   2       3.102 -48.977   5.250  1.00  2.92           H  \nATOM     35  HG3 LYS A   2       4.264 -47.909   4.446  1.00  2.92           H  \nATOM     36  HZ1 LYS A   2       4.763 -50.747   1.274  1.00  2.92           H  \nATOM     37  HZ2 LYS A   2       3.681 -51.785   1.931  1.00  2.92           H  \nATOM     38  HZ3 LYS A   2       5.280 -51.965   2.224  1.00  2.92           H  \nATOM     39  N   LYS A   2       1.907 -46.846   6.629  1.00  2.92           N  \nATOM     40  NZ  LYS A   2       4.542 -51.286   2.100  1.00  2.92           N  \nATOM     41  O   LYS A   2       1.882 -44.093   4.312  1.00  2.92           O  \nATOM     42  C   PHE A   3      -0.511 -42.597   5.624  1.00  4.39           C  \nATOM     43  CA  PHE A   3      -0.853 -43.933   4.929  1.00  4.39           C  \nATOM     44  CB  PHE A   3      -2.271 -44.408   5.285  1.00  4.39           C  \nATOM     45  CD1 PHE A   3      -3.760 -43.542   3.432  1.00  4.39           C  \nATOM     46  CD2 PHE A   3      -4.050 -42.638   5.675  1.00  4.39           C  \nATOM     47  CE1 PHE A   3      -4.797 -42.715   2.965  1.00  4.39           C  \nATOM     48  CE2 PHE A   3      -5.091 -41.818   5.207  1.00  4.39           C  \nATOM     49  CG  PHE A   3      -3.382 -43.505   4.788  1.00  4.39           C  \nATOM     50  CZ  PHE A   3      -5.463 -41.853   3.853  1.00  4.39           C  \nATOM     51  H   PHE A   3      -0.311 -45.868   5.655  1.00  4.39           H  \nATOM     52  HA  PHE A   3      -0.817 -43.746   3.856  1.00  4.39           H  \nATOM     53  HB2 PHE A   3      -2.353 -44.512   6.367  1.00  4.39           H  \nATOM     54  HB3 PHE A   3      -2.432 -45.393   4.848  1.00  4.39           H  \nATOM     55  HD1 PHE A   3      -3.255 -44.198   2.739  1.00  4.39           H  \nATOM     56  HD2 PHE A   3      -3.768 -42.590   6.716  1.00  4.39           H  \nATOM     57  HE1 PHE A   3      -5.083 -42.735   1.923  1.00  4.39           H  \nATOM     58  HE2 PHE A   3      -5.604 -41.151   5.885  1.00  4.39           H  \nATOM     59  HZ  PHE A   3      -6.257 -41.215   3.493  1.00  4.39           H  \nATOM     60  N   PHE A   3       0.079 -45.027   5.253  1.00  4.39           N  \nATOM     61  O   PHE A   3      -0.633 -41.541   5.014  1.00  4.39           O  \nATOM     62  C   LEU A   4       1.598 -40.732   7.042  1.00  4.39           C  \nATOM     63  CA  LEU A   4       0.367 -41.437   7.633  1.00  4.39           C  \nATOM     64  CB  LEU A   4       0.628 -41.823   9.104  1.00  4.39           C  \nATOM     65  CD1 LEU A   4      -0.319 -42.778  11.228  1.00  4.39           C  \nATOM     66  CD2 LEU A   4      -1.300 -40.694  10.309  1.00  4.39           C  \nATOM     67  CG  LEU A   4      -0.650 -42.027   9.937  1.00  4.39           C  \nATOM     68  H   LEU A   4       0.163 -43.538   7.292  1.00  4.39           H  \nATOM     69  HA  LEU A   4      -0.445 -40.712   7.588  1.00  4.39           H  \nATOM     70  HB2 LEU A   4       1.213 -41.034   9.576  1.00  4.39           H  \nATOM     71  HB3 LEU A   4       1.235 -42.728   9.127  1.00  4.39           H  \nATOM     72 HD11 LEU A   4       0.380 -42.191  11.824  1.00  4.39           H  \nATOM     73 HD12 LEU A   4       0.127 -43.747  11.002  1.00  4.39           H  \nATOM     74 HD13 LEU A   4      -1.230 -42.927  11.808  1.00  4.39           H  \nATOM     75 HD21 LEU A   4      -0.606 -40.080  10.883  1.00  4.39           H  \nATOM     76 HD22 LEU A   4      -2.193 -40.869  10.909  1.00  4.39           H  \nATOM     77 HD23 LEU A   4      -1.593 -40.147   9.413  1.00  4.39           H  \nATOM     78  HG  LEU A   4      -1.359 -42.630   9.370  1.00  4.39           H  \nATOM     79  N   LEU A   4      -0.012 -42.638   6.869  1.00  4.39           N  \nATOM     80  O   LEU A   4       1.655 -39.508   7.028  1.00  4.39           O  \nATOM     81  C   VAL A   5       3.372 -40.190   4.573  1.00  4.39           C  \nATOM     82  CA  VAL A   5       3.752 -40.956   5.845  1.00  4.39           C  \nATOM     83  CB  VAL A   5       4.757 -42.083   5.528  1.00  4.39           C  \nATOM     84  CG1 VAL A   5       6.019 -41.568   4.827  1.00  4.39           C  \nATOM     85  CG2 VAL A   5       5.199 -42.807   6.810  1.00  4.39           C  \nATOM     86  H   VAL A   5       2.440 -42.503   6.548  1.00  4.39           H  \nATOM     87  HA  VAL A   5       4.234 -40.242   6.512  1.00  4.39           H  \nATOM     88  HB  VAL A   5       4.279 -42.813   4.875  1.00  4.39           H  \nATOM     89 HG11 VAL A   5       6.494 -40.795   5.431  1.00  4.39           H  \nATOM     90 HG12 VAL A   5       5.770 -41.145   3.853  1.00  4.39           H  \nATOM     91 HG13 VAL A   5       6.725 -42.383   4.670  1.00  4.39           H  \nATOM     92 HG21 VAL A   5       4.347 -43.283   7.297  1.00  4.39           H  \nATOM     93 HG22 VAL A   5       5.933 -43.575   6.568  1.00  4.39           H  \nATOM     94 HG23 VAL A   5       5.651 -42.093   7.498  1.00  4.39           H  \nATOM     95  N   VAL A   5       2.554 -41.501   6.509  1.00  4.39           N  \nATOM     96  O   VAL A   5       3.937 -39.138   4.297  1.00  4.39           O  \nTER      96      VAL A   5                                                      \nEND\n"
  },
  {
    "path": "alphafold/relax/testdata/multiple_disulfides_target.pdb",
    "content": "MODEL        0\nATOM      1  N   MET A   1      19.164 -28.457  26.130  1.00  0.00          N   \nATOM      2  CA  MET A   1      19.746 -27.299  25.456  1.00  0.00          C   \nATOM      3  C   MET A   1      19.080 -26.008  25.921  1.00  0.00          C   \nATOM      4  CB  MET A   1      19.615 -27.438  23.938  1.00  0.00          C   \nATOM      5  O   MET A   1      17.853 -25.899  25.913  1.00  0.00          O   \nATOM      6  CG  MET A   1      19.873 -28.846  23.427  1.00  0.00          C   \nATOM      7  SD  MET A   1      21.636 -29.126  23.002  1.00  0.00          S   \nATOM      8  CE  MET A   1      22.302 -27.462  23.284  1.00  0.00          C   \nATOM      9  N   ALA A   2      19.679 -25.354  27.019  1.00  0.00          N   \nATOM     10  CA  ALA A   2      19.241 -24.061  27.539  1.00  0.00          C   \nATOM     11  C   ALA A   2      18.629 -23.204  26.434  1.00  0.00          C   \nATOM     12  CB  ALA A   2      20.410 -23.326  28.192  1.00  0.00          C   \nATOM     13  O   ALA A   2      19.158 -23.145  25.322  1.00  0.00          O   \nATOM     14  N   HIS A   3      17.369 -23.382  26.161  1.00  0.00          N   \nATOM     15  CA  HIS A   3      16.748 -22.427  25.250  1.00  0.00          C   \nATOM     16  C   HIS A   3      17.419 -21.061  25.342  1.00  0.00          C   \nATOM     17  CB  HIS A   3      15.252 -22.299  25.547  1.00  0.00          C   \nATOM     18  O   HIS A   3      17.896 -20.669  26.409  1.00  0.00          O   \nATOM     19  CG  HIS A   3      14.464 -23.520  25.196  1.00  0.00          C   \nATOM     20  CD2 HIS A   3      13.848 -24.436  25.979  1.00  0.00          C   \nATOM     21  ND1 HIS A   3      14.242 -23.914  23.894  1.00  0.00          N   \nATOM     22  CE1 HIS A   3      13.520 -25.022  23.892  1.00  0.00          C   \nATOM     23  NE2 HIS A   3      13.268 -25.360  25.145  1.00  0.00          N   \nATOM     24  N   GLU A   4      18.306 -20.798  24.429  1.00  0.00          N   \nATOM     25  CA  GLU A   4      18.907 -19.505  24.115  1.00  0.00          C   \nATOM     26  C   GLU A   4      18.392 -18.415  25.050  1.00  0.00          C   \nATOM     27  CB  GLU A   4      18.631 -19.123  22.659  1.00  0.00          C   \nATOM     28  O   GLU A   4      17.240 -18.458  25.486  1.00  0.00          O   \nATOM     29  CG  GLU A   4      19.253 -20.072  21.645  1.00  0.00          C   \nATOM     30  CD  GLU A   4      20.767 -19.956  21.564  1.00  0.00          C   \nATOM     31  OE1 GLU A   4      21.330 -18.981  22.111  1.00  0.00          O   \nATOM     32  OE2 GLU A   4      21.394 -20.846  20.948  1.00  0.00          O   \nATOM     33  N   GLU A   5      19.093 -18.090  26.026  1.00  0.00          N   \nATOM     34  CA  GLU A   5      19.080 -16.885  26.849  1.00  0.00          C   \nATOM     35  C   GLU A   5      17.938 -15.956  26.449  1.00  0.00          C   \nATOM     36  CB  GLU A   5      20.418 -16.148  26.746  1.00  0.00          C   \nATOM     37  O   GLU A   5      17.774 -15.636  25.269  1.00  0.00          O   \nATOM     38  CG  GLU A   5      21.604 -16.952  27.257  1.00  0.00          C   \nATOM     39  CD  GLU A   5      21.641 -17.070  28.772  1.00  0.00          C   \nATOM     40  OE1 GLU A   5      20.899 -16.330  29.457  1.00  0.00          O   \nATOM     41  OE2 GLU A   5      22.419 -17.909  29.279  1.00  0.00          O   \nATOM     42  N   ASP A   6      16.721 -16.161  26.857  1.00  0.00          N   \nATOM     43  CA  ASP A   6      15.629 -15.196  26.948  1.00  0.00          C   \nATOM     44  C   ASP A   6      16.107 -13.791  26.591  1.00  0.00          C   \nATOM     45  CB  ASP A   6      15.022 -15.204  28.353  1.00  0.00          C   \nATOM     46  O   ASP A   6      17.144 -13.339  27.079  1.00  0.00          O   \nATOM     47  CG  ASP A   6      14.317 -16.507  28.687  1.00  0.00          C   \nATOM     48  OD1 ASP A   6      14.123 -16.805  29.885  1.00  0.00          O   \nATOM     49  OD2 ASP A   6      13.956 -17.243  27.744  1.00  0.00          O   \nATOM     50  N   GLY A   7      16.251 -13.433  25.339  1.00  0.00          N   \nATOM     51  CA  GLY A   7      16.311 -11.996  25.123  1.00  0.00          C   \nATOM     52  C   GLY A   7      15.833 -11.192  26.317  1.00  0.00          C   \nATOM     53  O   GLY A   7      15.023 -11.674  27.112  1.00  0.00          O   \nATOM     54  N   VAL A   8      16.762 -10.664  27.143  1.00  0.00          N   \nATOM     55  CA  VAL A   8      16.521  -9.756  28.260  1.00  0.00          C   \nATOM     56  C   VAL A   8      15.307  -8.880  27.960  1.00  0.00          C   \nATOM     57  CB  VAL A   8      17.755  -8.875  28.552  1.00  0.00          C   \nATOM     58  O   VAL A   8      15.173  -8.351  26.854  1.00  0.00          O   \nATOM     59  CG1 VAL A   8      17.461  -7.891  29.683  1.00  0.00          C   \nATOM     60  CG2 VAL A   8      18.962  -9.745  28.898  1.00  0.00          C   \nATOM     61  N   CYS A   9      14.157  -9.255  28.398  1.00  0.00          N   \nATOM     62  CA  CYS A   9      13.010  -8.353  28.403  1.00  0.00          C   \nATOM     63  C   CYS A   9      13.310  -7.095  29.209  1.00  0.00          C   \nATOM     64  CB  CYS A   9      11.779  -9.055  28.975  1.00  0.00          C   \nATOM     65  O   CYS A   9      14.058  -7.142  30.187  1.00  0.00          O   \nATOM     66  SG  CYS A   9      11.197 -10.439  27.970  1.00  0.00          S   \nATOM     67  N   ASN A  10      13.304  -5.993  28.589  1.00  0.00          N   \nATOM     68  CA  ASN A  10      13.371  -4.703  29.267  1.00  0.00          C   \nATOM     69  C   ASN A  10      12.018  -3.997  29.264  1.00  0.00          C   \nATOM     70  CB  ASN A  10      14.436  -3.812  28.624  1.00  0.00          C   \nATOM     71  O   ASN A  10      11.047  -4.510  28.706  1.00  0.00          O   \nATOM     72  CG  ASN A  10      14.149  -3.521  27.164  1.00  0.00          C   \nATOM     73  ND2 ASN A  10      15.189  -3.547  26.338  1.00  0.00          N   \nATOM     74  OD1 ASN A  10      13.003  -3.275  26.781  1.00  0.00          O   \nATOM     75  N   SER A  11      11.830  -2.986  30.142  1.00  0.00          N   \nATOM     76  CA  SER A  11      10.597  -2.233  30.343  1.00  0.00          C   \nATOM     77  C   SER A  11      10.027  -1.741  29.017  1.00  0.00          C   \nATOM     78  CB  SER A  11      10.840  -1.044  31.274  1.00  0.00          C   \nATOM     79  O   SER A  11       8.847  -1.392  28.933  1.00  0.00          O   \nATOM     80  OG  SER A  11      11.841  -0.190  30.748  1.00  0.00          O   \nATOM     81  N   ASN A  12      10.789  -1.874  27.933  1.00  0.00          N   \nATOM     82  CA  ASN A  12      10.334  -1.422  26.622  1.00  0.00          C   \nATOM     83  C   ASN A  12       9.775  -2.576  25.795  1.00  0.00          C   \nATOM     84  CB  ASN A  12      11.472  -0.730  25.868  1.00  0.00          C   \nATOM     85  O   ASN A  12       9.262  -2.365  24.694  1.00  0.00          O   \nATOM     86  CG  ASN A  12      11.875   0.587  26.501  1.00  0.00          C   \nATOM     87  ND2 ASN A  12      13.170   0.882  26.482  1.00  0.00          N   \nATOM     88  OD1 ASN A  12      11.031   1.333  27.004  1.00  0.00          O   \nATOM     89  N   ALA A  13      10.045  -3.775  26.303  1.00  0.00          N   \nATOM     90  CA  ALA A  13       9.523  -4.930  25.578  1.00  0.00          C   \nATOM     91  C   ALA A  13       8.001  -4.994  25.671  1.00  0.00          C   \nATOM     92  CB  ALA A  13      10.140  -6.219  26.115  1.00  0.00          C   \nATOM     93  O   ALA A  13       7.423  -4.684  26.715  1.00  0.00          O   \nATOM     94  N   PRO A  14       7.310  -5.193  24.591  1.00  0.00          N   \nATOM     95  CA  PRO A  14       5.846  -5.238  24.577  1.00  0.00          C   \nATOM     96  C   PRO A  14       5.280  -6.316  25.499  1.00  0.00          C   \nATOM     97  CB  PRO A  14       5.517  -5.544  23.113  1.00  0.00          C   \nATOM     98  O   PRO A  14       4.127  -6.222  25.929  1.00  0.00          O   \nATOM     99  CG  PRO A  14       6.757  -6.177  22.568  1.00  0.00          C   \nATOM    100  CD  PRO A  14       7.941  -5.617  23.303  1.00  0.00          C   \nATOM    101  N   CYS A  15       6.076  -7.229  25.793  1.00  0.00          N   \nATOM    102  CA  CYS A  15       5.597  -8.339  26.610  1.00  0.00          C   \nATOM    103  C   CYS A  15       6.142  -8.245  28.030  1.00  0.00          C   \nATOM    104  CB  CYS A  15       5.999  -9.676  25.987  1.00  0.00          C   \nATOM    105  O   CYS A  15       6.205  -9.249  28.743  1.00  0.00          O   \nATOM    106  SG  CYS A  15       7.766  -9.813  25.636  1.00  0.00          S   \nATOM    107  N   TYR A  16       6.510  -6.994  28.366  1.00  0.00          N   \nATOM    108  CA  TYR A  16       7.076  -6.735  29.685  1.00  0.00          C   \nATOM    109  C   TYR A  16       5.978  -6.589  30.731  1.00  0.00          C   \nATOM    110  CB  TYR A  16       7.944  -5.473  29.659  1.00  0.00          C   \nATOM    111  O   TYR A  16       5.053  -5.791  30.563  1.00  0.00          O   \nATOM    112  CG  TYR A  16       8.545  -5.122  30.998  1.00  0.00          C   \nATOM    113  CD1 TYR A  16       8.126  -3.993  31.698  1.00  0.00          C   \nATOM    114  CD2 TYR A  16       9.534  -5.918  31.566  1.00  0.00          C   \nATOM    115  CE1 TYR A  16       8.678  -3.665  32.932  1.00  0.00          C   \nATOM    116  CE2 TYR A  16      10.093  -5.600  32.799  1.00  0.00          C   \nATOM    117  OH  TYR A  16      10.210  -4.153  34.695  1.00  0.00          O   \nATOM    118  CZ  TYR A  16       9.660  -4.473  33.474  1.00  0.00          C   \nATOM    119  N   HIS A  17       5.834  -7.548  31.703  1.00  0.00          N   \nATOM    120  CA  HIS A  17       4.846  -7.504  32.775  1.00  0.00          C   \nATOM    121  C   HIS A  17       5.518  -7.493  34.143  1.00  0.00          C   \nATOM    122  CB  HIS A  17       3.888  -8.692  32.669  1.00  0.00          C   \nATOM    123  O   HIS A  17       6.482  -8.228  34.372  1.00  0.00          O   \nATOM    124  CG  HIS A  17       2.782  -8.661  33.675  1.00  0.00          C   \nATOM    125  CD2 HIS A  17       2.548  -9.432  34.764  1.00  0.00          C   \nATOM    126  ND1 HIS A  17       1.748  -7.752  33.617  1.00  0.00          N   \nATOM    127  CE1 HIS A  17       0.924  -7.965  34.630  1.00  0.00          C   \nATOM    128  NE2 HIS A  17       1.387  -8.979  35.341  1.00  0.00          N   \nATOM    129  N   CYS A  18       5.067  -6.579  34.995  1.00  0.00          N   \nATOM    130  CA  CYS A  18       5.599  -6.487  36.350  1.00  0.00          C   \nATOM    131  C   CYS A  18       4.501  -6.711  37.383  1.00  0.00          C   \nATOM    132  CB  CYS A  18       6.255  -5.126  36.577  1.00  0.00          C   \nATOM    133  O   CYS A  18       3.325  -6.465  37.109  1.00  0.00          O   \nATOM    134  SG  CYS A  18       7.757  -4.870  35.607  1.00  0.00          S   \nATOM    135  N   ASP A  19       4.791  -7.344  38.476  1.00  0.00          N   \nATOM    136  CA  ASP A  19       3.829  -7.460  39.568  1.00  0.00          C   \nATOM    137  C   ASP A  19       3.430  -6.084  40.096  1.00  0.00          C   \nATOM    138  CB  ASP A  19       4.403  -8.313  40.701  1.00  0.00          C   \nATOM    139  O   ASP A  19       3.960  -5.064  39.651  1.00  0.00          O   \nATOM    140  CG  ASP A  19       5.572  -7.650  41.408  1.00  0.00          C   \nATOM    141  OD1 ASP A  19       6.325  -8.345  42.124  1.00  0.00          O   \nATOM    142  OD2 ASP A  19       5.741  -6.422  41.250  1.00  0.00          O   \nATOM    143  N   ALA A  20       2.383  -5.908  40.933  1.00  0.00          N   \nATOM    144  CA  ALA A  20       1.776  -4.676  41.429  1.00  0.00          C   \nATOM    145  C   ALA A  20       2.806  -3.807  42.144  1.00  0.00          C   \nATOM    146  CB  ALA A  20       0.612  -4.995  42.363  1.00  0.00          C   \nATOM    147  O   ALA A  20       2.714  -2.577  42.119  1.00  0.00          O   \nATOM    148  N   ASN A  21       3.841  -4.457  42.638  1.00  0.00          N   \nATOM    149  CA  ASN A  21       4.863  -3.719  43.373  1.00  0.00          C   \nATOM    150  C   ASN A  21       6.048  -3.362  42.480  1.00  0.00          C   \nATOM    151  CB  ASN A  21       5.335  -4.521  44.588  1.00  0.00          C   \nATOM    152  O   ASN A  21       6.980  -2.686  42.919  1.00  0.00          O   \nATOM    153  CG  ASN A  21       4.246  -4.704  45.626  1.00  0.00          C   \nATOM    154  ND2 ASN A  21       4.183  -5.892  46.216  1.00  0.00          N   \nATOM    155  OD1 ASN A  21       3.467  -3.786  45.895  1.00  0.00          O   \nATOM    156  N   GLY A  22       5.989  -3.893  41.230  1.00  0.00          N   \nATOM    157  CA  GLY A  22       7.093  -3.614  40.325  1.00  0.00          C   \nATOM    158  C   GLY A  22       8.376  -4.324  40.712  1.00  0.00          C   \nATOM    159  O   GLY A  22       9.456  -3.972  40.234  1.00  0.00          O   \nATOM    160  N   GLU A  23       8.305  -5.221  41.664  1.00  0.00          N   \nATOM    161  CA  GLU A  23       9.501  -5.877  42.183  1.00  0.00          C   \nATOM    162  C   GLU A  23       9.861  -7.105  41.352  1.00  0.00          C   \nATOM    163  CB  GLU A  23       9.306  -6.272  43.649  1.00  0.00          C   \nATOM    164  O   GLU A  23      11.038  -7.361  41.089  1.00  0.00          O   \nATOM    165  CG  GLU A  23       9.200  -5.085  44.596  1.00  0.00          C   \nATOM    166  CD  GLU A  23       9.074  -5.493  46.055  1.00  0.00          C   \nATOM    167  OE1 GLU A  23       9.075  -6.710  46.348  1.00  0.00          O   \nATOM    168  OE2 GLU A  23       8.972  -4.587  46.913  1.00  0.00          O   \nATOM    169  N   ASN A  24       8.853  -7.853  40.844  1.00  0.00          N   \nATOM    170  CA  ASN A  24       9.050  -9.077  40.075  1.00  0.00          C   \nATOM    171  C   ASN A  24       8.522  -8.936  38.651  1.00  0.00          C   \nATOM    172  CB  ASN A  24       8.381 -10.263  40.774  1.00  0.00          C   \nATOM    173  O   ASN A  24       7.317  -9.045  38.417  1.00  0.00          O   \nATOM    174  CG  ASN A  24       8.973 -10.546  42.140  1.00  0.00          C   \nATOM    175  ND2 ASN A  24       8.125 -10.569  43.162  1.00  0.00          N   \nATOM    176  OD1 ASN A  24      10.184 -10.741  42.277  1.00  0.00          O   \nATOM    177  N   CYS A  25       9.371  -8.554  37.764  1.00  0.00          N   \nATOM    178  CA  CYS A  25       8.978  -8.390  36.369  1.00  0.00          C   \nATOM    179  C   CYS A  25       9.448  -9.572  35.529  1.00  0.00          C   \nATOM    180  CB  CYS A  25       9.548  -7.091  35.800  1.00  0.00          C   \nATOM    181  O   CYS A  25      10.486 -10.171  35.816  1.00  0.00          O   \nATOM    182  SG  CYS A  25       8.933  -5.605  36.623  1.00  0.00          S   \nATOM    183  N   SER A  26       8.561 -10.102  34.701  1.00  0.00          N   \nATOM    184  CA  SER A  26       8.921 -11.145  33.746  1.00  0.00          C   \nATOM    185  C   SER A  26       8.422 -10.808  32.345  1.00  0.00          C   \nATOM    186  CB  SER A  26       8.353 -12.495  34.187  1.00  0.00          C   \nATOM    187  O   SER A  26       7.563  -9.940  32.178  1.00  0.00          O   \nATOM    188  OG  SER A  26       6.936 -12.470  34.186  1.00  0.00          O   \nATOM    189  N   CYS A  27       9.208 -11.265  31.277  1.00  0.00          N   \nATOM    190  CA  CYS A  27       8.779 -11.211  29.884  1.00  0.00          C   \nATOM    191  C   CYS A  27       7.948 -12.436  29.521  1.00  0.00          C   \nATOM    192  CB  CYS A  27       9.988 -11.110  28.954  1.00  0.00          C   \nATOM    193  O   CYS A  27       8.470 -13.551  29.464  1.00  0.00          O   \nATOM    194  SG  CYS A  27      10.970  -9.614  29.197  1.00  0.00          S   \nATOM    195  N   ASN A  28       6.768 -12.360  29.728  1.00  0.00          N   \nATOM    196  CA  ASN A  28       5.905 -13.476  29.355  1.00  0.00          C   \nATOM    197  C   ASN A  28       5.123 -13.178  28.079  1.00  0.00          C   \nATOM    198  CB  ASN A  28       4.946 -13.817  30.498  1.00  0.00          C   \nATOM    199  O   ASN A  28       4.074 -12.532  28.125  1.00  0.00          O   \nATOM    200  CG  ASN A  28       4.239 -15.142  30.291  1.00  0.00          C   \nATOM    201  ND2 ASN A  28       3.472 -15.568  31.288  1.00  0.00          N   \nATOM    202  OD1 ASN A  28       4.381 -15.779  29.243  1.00  0.00          O   \nATOM    203  N   CYS A  29       5.741 -13.488  26.787  1.00  0.00          N   \nATOM    204  CA  CYS A  29       5.086 -13.282  25.500  1.00  0.00          C   \nATOM    205  C   CYS A  29       3.880 -14.201  25.348  1.00  0.00          C   \nATOM    206  CB  CYS A  29       6.070 -13.522  24.355  1.00  0.00          C   \nATOM    207  O   CYS A  29       3.011 -13.958  24.510  1.00  0.00          O   \nATOM    208  SG  CYS A  29       7.446 -12.353  24.319  1.00  0.00          S   \nATOM    209  N   GLU A  30       3.849 -15.077  26.140  1.00  0.00          N   \nATOM    210  CA  GLU A  30       2.725 -16.005  26.063  1.00  0.00          C   \nATOM    211  C   GLU A  30       1.452 -15.379  26.627  1.00  0.00          C   \nATOM    212  CB  GLU A  30       3.047 -17.303  26.808  1.00  0.00          C   \nATOM    213  O   GLU A  30       0.344 -15.770  26.255  1.00  0.00          O   \nATOM    214  CG  GLU A  30       4.161 -18.119  26.169  1.00  0.00          C   \nATOM    215  CD  GLU A  30       4.469 -19.405  26.919  1.00  0.00          C   \nATOM    216  OE1 GLU A  30       3.822 -19.672  27.957  1.00  0.00          O   \nATOM    217  OE2 GLU A  30       5.366 -20.150  26.466  1.00  0.00          O   \nATOM    218  N   LEU A  31       1.743 -14.305  27.387  1.00  0.00          N   \nATOM    219  CA  LEU A  31       0.622 -13.672  28.074  1.00  0.00          C   \nATOM    220  C   LEU A  31       0.044 -12.536  27.237  1.00  0.00          C   \nATOM    221  CB  LEU A  31       1.061 -13.142  29.441  1.00  0.00          C   \nATOM    222  O   LEU A  31      -0.996 -11.971  27.584  1.00  0.00          O   \nATOM    223  CG  LEU A  31       1.437 -14.194  30.487  1.00  0.00          C   \nATOM    224  CD1 LEU A  31       1.920 -13.520  31.766  1.00  0.00          C   \nATOM    225  CD2 LEU A  31       0.252 -15.110  30.774  1.00  0.00          C   \nATOM    226  N   PHE A  32       0.769 -12.166  26.008  1.00  0.00          N   \nATOM    227  CA  PHE A  32       0.157 -11.063  25.278  1.00  0.00          C   \nATOM    228  C   PHE A  32      -1.020 -11.553  24.443  1.00  0.00          C   \nATOM    229  CB  PHE A  32       1.188 -10.374  24.378  1.00  0.00          C   \nATOM    230  O   PHE A  32      -0.898 -12.531  23.702  1.00  0.00          O   \nATOM    231  CG  PHE A  32       2.115  -9.447  25.117  1.00  0.00          C   \nATOM    232  CD1 PHE A  32       3.383  -9.869  25.499  1.00  0.00          C   \nATOM    233  CD2 PHE A  32       1.719  -8.153  25.429  1.00  0.00          C   \nATOM    234  CE1 PHE A  32       4.243  -9.014  26.183  1.00  0.00          C   \nATOM    235  CE2 PHE A  32       2.574  -7.293  26.112  1.00  0.00          C   \nATOM    236  CZ  PHE A  32       3.835  -7.725  26.489  1.00  0.00          C   \nATOM    237  N   ASP A  33      -2.070 -11.361  25.097  1.00  0.00          N   \nATOM    238  CA  ASP A  33      -3.364 -11.602  24.466  1.00  0.00          C   \nATOM    239  C   ASP A  33      -3.423 -10.975  23.075  1.00  0.00          C   \nATOM    240  CB  ASP A  33      -4.496 -11.055  25.339  1.00  0.00          C   \nATOM    241  O   ASP A  33      -3.225  -9.767  22.924  1.00  0.00          O   \nATOM    242  CG  ASP A  33      -5.861 -11.590  24.943  1.00  0.00          C   \nATOM    243  OD1 ASP A  33      -6.769 -11.638  25.800  1.00  0.00          O   \nATOM    244  OD2 ASP A  33      -6.029 -11.969  23.764  1.00  0.00          O   \nATOM    245  N   CYS A  34      -3.021 -11.756  22.063  1.00  0.00          N   \nATOM    246  CA  CYS A  34      -3.371 -11.337  20.711  1.00  0.00          C   \nATOM    247  C   CYS A  34      -4.691 -10.576  20.700  1.00  0.00          C   \nATOM    248  CB  CYS A  34      -3.461 -12.547  19.781  1.00  0.00          C   \nATOM    249  O   CYS A  34      -4.986  -9.851  19.748  1.00  0.00          O   \nATOM    250  SG  CYS A  34      -1.909 -13.455  19.615  1.00  0.00          S   \nATOM    251  N   GLU A  35      -5.284 -10.672  21.987  1.00  0.00          N   \nATOM    252  CA  GLU A  35      -6.617 -10.086  22.085  1.00  0.00          C   \nATOM    253  C   GLU A  35      -6.556  -8.667  22.644  1.00  0.00          C   \nATOM    254  CB  GLU A  35      -7.525 -10.956  22.958  1.00  0.00          C   \nATOM    255  O   GLU A  35      -7.592  -8.032  22.853  1.00  0.00          O   \nATOM    256  CG  GLU A  35      -7.790 -12.339  22.381  1.00  0.00          C   \nATOM    257  CD  GLU A  35      -8.779 -13.152  23.202  1.00  0.00          C   \nATOM    258  OE1 GLU A  35      -9.290 -12.636  24.222  1.00  0.00          O   \nATOM    259  OE2 GLU A  35      -9.046 -14.314  22.821  1.00  0.00          O   \nATOM    260  N   ALA A  36      -5.315  -8.202  22.860  1.00  0.00          N   \nATOM    261  CA  ALA A  36      -5.282  -6.884  23.489  1.00  0.00          C   \nATOM    262  C   ALA A  36      -5.714  -5.797  22.509  1.00  0.00          C   \nATOM    263  CB  ALA A  36      -3.884  -6.586  24.027  1.00  0.00          C   \nATOM    264  O   ALA A  36      -5.299  -5.799  21.348  1.00  0.00          O   \nATOM    265  N   LYS A  37      -6.942  -5.271  22.819  1.00  0.00          N   \nATOM    266  CA  LYS A  37      -7.519  -4.143  22.094  1.00  0.00          C   \nATOM    267  C   LYS A  37      -6.974  -2.817  22.617  1.00  0.00          C   \nATOM    268  CB  LYS A  37      -9.045  -4.160  22.200  1.00  0.00          C   \nATOM    269  O   LYS A  37      -6.897  -2.606  23.829  1.00  0.00          O   \nATOM    270  CG  LYS A  37      -9.701  -5.341  21.499  1.00  0.00          C   \nATOM    271  CD  LYS A  37     -11.220  -5.239  21.536  1.00  0.00          C   \nATOM    272  CE  LYS A  37     -11.877  -6.385  20.778  1.00  0.00          C   \nATOM    273  NZ  LYS A  37     -13.353  -6.194  20.656  1.00  0.00          N   \nATOM    274  N   LYS A  38      -6.207  -2.111  21.604  1.00  0.00          N   \nATOM    275  CA  LYS A  38      -5.876  -0.745  21.998  1.00  0.00          C   \nATOM    276  C   LYS A  38      -7.131   0.118  22.100  1.00  0.00          C   \nATOM    277  CB  LYS A  38      -4.892  -0.123  21.007  1.00  0.00          C   \nATOM    278  O   LYS A  38      -8.188  -0.253  21.585  1.00  0.00          O   \nATOM    279  CG  LYS A  38      -3.518  -0.776  21.006  1.00  0.00          C   \nATOM    280  CD  LYS A  38      -2.564  -0.072  20.049  1.00  0.00          C   \nATOM    281  CE  LYS A  38      -1.196  -0.740  20.029  1.00  0.00          C   \nATOM    282  NZ  LYS A  38      -0.234  -0.007  19.153  1.00  0.00          N   \nATOM    283  N   PRO A  39      -7.175   1.097  22.994  1.00  0.00          N   \nATOM    284  CA  PRO A  39      -8.319   2.000  23.133  1.00  0.00          C   \nATOM    285  C   PRO A  39      -8.863   2.474  21.787  1.00  0.00          C   \nATOM    286  CB  PRO A  39      -7.748   3.173  23.934  1.00  0.00          C   \nATOM    287  O   PRO A  39     -10.057   2.762  21.666  1.00  0.00          O   \nATOM    288  CG  PRO A  39      -6.594   2.594  24.688  1.00  0.00          C   \nATOM    289  CD  PRO A  39      -6.004   1.478  23.874  1.00  0.00          C   \nATOM    290  N   ASP A  40      -8.068   2.468  20.731  1.00  0.00          N   \nATOM    291  CA  ASP A  40      -8.452   2.969  19.415  1.00  0.00          C   \nATOM    292  C   ASP A  40      -9.034   1.852  18.551  1.00  0.00          C   \nATOM    293  CB  ASP A  40      -7.252   3.607  18.712  1.00  0.00          C   \nATOM    294  O   ASP A  40      -9.337   2.064  17.375  1.00  0.00          O   \nATOM    295  CG  ASP A  40      -6.113   2.630  18.480  1.00  0.00          C   \nATOM    296  OD1 ASP A  40      -5.040   3.049  17.994  1.00  0.00          O   \nATOM    297  OD2 ASP A  40      -6.290   1.431  18.784  1.00  0.00          O   \nATOM    298  N   GLY A  41      -9.199   0.638  19.013  1.00  0.00          N   \nATOM    299  CA  GLY A  41      -9.761  -0.484  18.279  1.00  0.00          C   \nATOM    300  C   GLY A  41      -8.723  -1.268  17.500  1.00  0.00          C   \nATOM    301  O   GLY A  41      -9.019  -2.338  16.963  1.00  0.00          O   \nATOM    302  N   SER A  42      -7.510  -0.651  17.403  1.00  0.00          N   \nATOM    303  CA  SER A  42      -6.433  -1.355  16.714  1.00  0.00          C   \nATOM    304  C   SER A  42      -5.824  -2.436  17.601  1.00  0.00          C   \nATOM    305  CB  SER A  42      -5.346  -0.373  16.274  1.00  0.00          C   \nATOM    306  O   SER A  42      -6.031  -2.440  18.816  1.00  0.00          O   \nATOM    307  OG  SER A  42      -4.758   0.262  17.396  1.00  0.00          O   \nATOM    308  N   TYR A  43      -5.412  -3.575  16.938  1.00  0.00          N   \nATOM    309  CA  TYR A  43      -4.705  -4.628  17.660  1.00  0.00          C   \nATOM    310  C   TYR A  43      -3.244  -4.254  17.877  1.00  0.00          C   \nATOM    311  CB  TYR A  43      -4.798  -5.955  16.901  1.00  0.00          C   \nATOM    312  O   TYR A  43      -2.651  -3.542  17.063  1.00  0.00          O   \nATOM    313  CG  TYR A  43      -6.184  -6.551  16.887  1.00  0.00          C   \nATOM    314  CD1 TYR A  43      -7.022  -6.388  15.786  1.00  0.00          C   \nATOM    315  CD2 TYR A  43      -6.659  -7.277  17.974  1.00  0.00          C   \nATOM    316  CE1 TYR A  43      -8.302  -6.934  15.769  1.00  0.00          C   \nATOM    317  CE2 TYR A  43      -7.937  -7.827  17.968  1.00  0.00          C   \nATOM    318  OH  TYR A  43     -10.015  -8.194  16.852  1.00  0.00          O   \nATOM    319  CZ  TYR A  43      -8.749  -7.651  16.863  1.00  0.00          C   \nATOM    320  N   ALA A  44      -3.024  -4.415  19.155  1.00  0.00          N   \nATOM    321  CA  ALA A  44      -1.659  -4.137  19.595  1.00  0.00          C   \nATOM    322  C   ALA A  44      -0.642  -4.865  18.721  1.00  0.00          C   \nATOM    323  CB  ALA A  44      -1.480  -4.536  21.058  1.00  0.00          C   \nATOM    324  O   ALA A  44       0.477  -4.383  18.527  1.00  0.00          O   \nATOM    325  N   HIS A  45      -1.081  -5.938  17.989  1.00  0.00          N   \nATOM    326  CA  HIS A  45      -0.065  -6.665  17.236  1.00  0.00          C   \nATOM    327  C   HIS A  45      -0.455  -6.795  15.768  1.00  0.00          C   \nATOM    328  CB  HIS A  45       0.163  -8.051  17.843  1.00  0.00          C   \nATOM    329  O   HIS A  45      -1.558  -7.246  15.452  1.00  0.00          O   \nATOM    330  CG  HIS A  45       1.501  -8.634  17.520  1.00  0.00          C   \nATOM    331  CD2 HIS A  45       2.577  -8.880  18.304  1.00  0.00          C   \nATOM    332  ND1 HIS A  45       1.850  -9.037  16.249  1.00  0.00          N   \nATOM    333  CE1 HIS A  45       3.086  -9.508  16.266  1.00  0.00          C   \nATOM    334  NE2 HIS A  45       3.550  -9.423  17.502  1.00  0.00          N   \nATOM    335  N   PRO A  46       0.267  -6.191  14.776  1.00  0.00          N   \nATOM    336  CA  PRO A  46       0.007  -6.193  13.334  1.00  0.00          C   \nATOM    337  C   PRO A  46      -0.224  -7.596  12.778  1.00  0.00          C   \nATOM    338  CB  PRO A  46       1.278  -5.574  12.747  1.00  0.00          C   \nATOM    339  O   PRO A  46      -0.835  -7.750  11.717  1.00  0.00          O   \nATOM    340  CG  PRO A  46       2.320  -5.770  13.800  1.00  0.00          C   \nATOM    341  CD  PRO A  46       1.648  -5.768  15.143  1.00  0.00          C   \nATOM    342  N   CYS A  47       0.238  -8.592  13.354  1.00  0.00          N   \nATOM    343  CA  CYS A  47       0.115  -9.950  12.835  1.00  0.00          C   \nATOM    344  C   CYS A  47      -1.253 -10.537  13.163  1.00  0.00          C   \nATOM    345  CB  CYS A  47       1.214 -10.844  13.408  1.00  0.00          C   \nATOM    346  O   CYS A  47      -1.515 -11.707  12.880  1.00  0.00          O   \nATOM    347  SG  CYS A  47       1.222 -10.923  15.212  1.00  0.00          S   \nATOM    348  N   ARG A  48      -2.155  -9.724  13.452  1.00  0.00          N   \nATOM    349  CA  ARG A  48      -3.422 -10.192  14.005  1.00  0.00          C   \nATOM    350  C   ARG A  48      -4.542 -10.086  12.974  1.00  0.00          C   \nATOM    351  CB  ARG A  48      -3.788  -9.396  15.260  1.00  0.00          C   \nATOM    352  O   ARG A  48      -4.649  -9.082  12.268  1.00  0.00          O   \nATOM    353  CG  ARG A  48      -5.032  -9.905  15.970  1.00  0.00          C   \nATOM    354  CD  ARG A  48      -5.909  -8.761  16.460  1.00  0.00          C   \nATOM    355  NE  ARG A  48      -6.344  -7.906  15.359  1.00  0.00          N   \nATOM    356  NH1 ARG A  48      -6.885  -6.103  16.700  1.00  0.00          N   \nATOM    357  NH2 ARG A  48      -7.167  -5.974  14.429  1.00  0.00          N   \nATOM    358  CZ  ARG A  48      -6.798  -6.663  15.499  1.00  0.00          C   \nATOM    359  N   ARG A  49      -5.146 -11.174  12.527  1.00  0.00          N   \nATOM    360  CA  ARG A  49      -6.391 -11.158  11.765  1.00  0.00          C   \nATOM    361  C   ARG A  49      -7.546 -11.713  12.593  1.00  0.00          C   \nATOM    362  CB  ARG A  49      -6.241 -11.962  10.472  1.00  0.00          C   \nATOM    363  O   ARG A  49      -7.402 -12.739  13.261  1.00  0.00          O   \nATOM    364  CG  ARG A  49      -5.303 -11.327   9.458  1.00  0.00          C   \nATOM    365  CD  ARG A  49      -5.887 -10.048   8.873  1.00  0.00          C   \nATOM    366  NE  ARG A  49      -5.349  -9.769   7.544  1.00  0.00          N   \nATOM    367  NH1 ARG A  49      -6.902  -8.137   7.033  1.00  0.00          N   \nATOM    368  NH2 ARG A  49      -5.276  -8.694   5.516  1.00  0.00          N   \nATOM    369  CZ  ARG A  49      -5.843  -8.867   6.701  1.00  0.00          C   \nATOM    370  N   CYS A  50      -8.427 -10.800  12.832  1.00  0.00          N   \nATOM    371  CA  CYS A  50      -9.591 -11.226  13.601  1.00  0.00          C   \nATOM    372  C   CYS A  50     -10.795 -11.442  12.692  1.00  0.00          C   \nATOM    373  CB  CYS A  50      -9.931 -10.193  14.675  1.00  0.00          C   \nATOM    374  O   CYS A  50     -11.034 -10.657  11.773  1.00  0.00          O   \nATOM    375  SG  CYS A  50      -8.684 -10.057  15.975  1.00  0.00          S   \nATOM    376  N   ASP A  51     -11.409 -12.618  12.691  1.00  0.00          N   \nATOM    377  CA  ASP A  51     -12.641 -12.851  11.943  1.00  0.00          C   \nATOM    378  C   ASP A  51     -13.818 -12.115  12.580  1.00  0.00          C   \nATOM    379  CB  ASP A  51     -12.942 -14.349  11.858  1.00  0.00          C   \nATOM    380  O   ASP A  51     -13.640 -11.361  13.539  1.00  0.00          O   \nATOM    381  CG  ASP A  51     -13.232 -14.974  13.211  1.00  0.00          C   \nATOM    382  OD1 ASP A  51     -13.125 -16.212  13.347  1.00  0.00          O   \nATOM    383  OD2 ASP A  51     -13.573 -14.221  14.150  1.00  0.00          O   \nATOM    384  N   ALA A  52     -15.076 -12.051  11.991  1.00  0.00          N   \nATOM    385  CA  ALA A  52     -16.275 -11.314  12.381  1.00  0.00          C   \nATOM    386  C   ALA A  52     -16.730 -11.710  13.783  1.00  0.00          C   \nATOM    387  CB  ALA A  52     -17.397 -11.550  11.374  1.00  0.00          C   \nATOM    388  O   ALA A  52     -17.439 -10.952  14.450  1.00  0.00          O   \nATOM    389  N   ASN A  53     -16.263 -12.790  14.290  1.00  0.00          N   \nATOM    390  CA  ASN A  53     -16.638 -13.257  15.620  1.00  0.00          C   \nATOM    391  C   ASN A  53     -15.557 -12.943  16.650  1.00  0.00          C   \nATOM    392  CB  ASN A  53     -16.930 -14.759  15.599  1.00  0.00          C   \nATOM    393  O   ASN A  53     -15.602 -13.442  17.776  1.00  0.00          O   \nATOM    394  CG  ASN A  53     -18.169 -15.101  14.795  1.00  0.00          C   \nATOM    395  ND2 ASN A  53     -18.098 -16.183  14.029  1.00  0.00          N   \nATOM    396  OD1 ASN A  53     -19.181 -14.399  14.862  1.00  0.00          O   \nATOM    397  N   ASN A  54     -14.551 -12.153  16.191  1.00  0.00          N   \nATOM    398  CA  ASN A  54     -13.470 -11.666  17.041  1.00  0.00          C   \nATOM    399  C   ASN A  54     -12.543 -12.798  17.474  1.00  0.00          C   \nATOM    400  CB  ASN A  54     -14.034 -10.943  18.266  1.00  0.00          C   \nATOM    401  O   ASN A  54     -11.968 -12.753  18.563  1.00  0.00          O   \nATOM    402  CG  ASN A  54     -14.752  -9.657  17.906  1.00  0.00          C   \nATOM    403  ND2 ASN A  54     -15.894  -9.418  18.540  1.00  0.00          N   \nATOM    404  OD1 ASN A  54     -14.285  -8.885  17.065  1.00  0.00          O   \nATOM    405  N   ILE A  55     -12.428 -13.839  16.751  1.00  0.00          N   \nATOM    406  CA  ILE A  55     -11.423 -14.875  16.963  1.00  0.00          C   \nATOM    407  C   ILE A  55     -10.158 -14.536  16.179  1.00  0.00          C   \nATOM    408  CB  ILE A  55     -11.952 -16.268  16.552  1.00  0.00          C   \nATOM    409  O   ILE A  55     -10.162 -14.552  14.946  1.00  0.00          O   \nATOM    410  CG1 ILE A  55     -13.233 -16.602  17.325  1.00  0.00          C   \nATOM    411  CG2 ILE A  55     -10.881 -17.340  16.777  1.00  0.00          C   \nATOM    412  CD1 ILE A  55     -13.942 -17.857  16.834  1.00  0.00          C   \nATOM    413  N   CYS A  56      -9.197 -14.050  16.887  1.00  0.00          N   \nATOM    414  CA  CYS A  56      -7.960 -13.587  16.266  1.00  0.00          C   \nATOM    415  C   CYS A  56      -6.914 -14.694  16.244  1.00  0.00          C   \nATOM    416  CB  CYS A  56      -7.411 -12.369  17.009  1.00  0.00          C   \nATOM    417  O   CYS A  56      -6.807 -15.473  17.192  1.00  0.00          O   \nATOM    418  SG  CYS A  56      -8.495 -10.925  16.941  1.00  0.00          S   \nATOM    419  N   LYS A  57      -6.417 -14.976  15.112  1.00  0.00          N   \nATOM    420  CA  LYS A  57      -5.263 -15.861  14.977  1.00  0.00          C   \nATOM    421  C   LYS A  57      -4.007 -15.075  14.612  1.00  0.00          C   \nATOM    422  CB  LYS A  57      -5.532 -16.937  13.924  1.00  0.00          C   \nATOM    423  O   LYS A  57      -4.077 -14.092  13.873  1.00  0.00          O   \nATOM    424  CG  LYS A  57      -6.672 -17.880  14.280  1.00  0.00          C   \nATOM    425  CD  LYS A  57      -6.811 -19.000  13.257  1.00  0.00          C   \nATOM    426  CE  LYS A  57      -7.903 -19.986  13.651  1.00  0.00          C   \nATOM    427  NZ  LYS A  57      -7.947 -21.161  12.730  1.00  0.00          N   \nATOM    428  N   CYS A  58      -2.976 -15.105  15.608  1.00  0.00          N   \nATOM    429  CA  CYS A  58      -1.644 -14.583  15.328  1.00  0.00          C   \nATOM    430  C   CYS A  58      -0.938 -15.425  14.272  1.00  0.00          C   \nATOM    431  CB  CYS A  58      -0.804 -14.543  16.605  1.00  0.00          C   \nATOM    432  O   CYS A  58      -0.662 -16.605  14.495  1.00  0.00          O   \nATOM    433  SG  CYS A  58      -1.471 -13.452  17.881  1.00  0.00          S   \nATOM    434  N   SER A  59      -1.100 -15.266  13.105  1.00  0.00          N   \nATOM    435  CA  SER A  59      -0.317 -16.194  12.296  1.00  0.00          C   \nATOM    436  C   SER A  59       0.363 -15.475  11.135  1.00  0.00          C   \nATOM    437  CB  SER A  59      -1.204 -17.319  11.760  1.00  0.00          C   \nATOM    438  O   SER A  59      -0.281 -15.151  10.135  1.00  0.00          O   \nATOM    439  OG  SER A  59      -0.425 -18.302  11.100  1.00  0.00          O   \nATOM    440  N   CYS A  60       1.699 -14.861  11.329  1.00  0.00          N   \nATOM    441  CA  CYS A  60       2.405 -14.577  10.084  1.00  0.00          C   \nATOM    442  C   CYS A  60       2.585 -15.845   9.258  1.00  0.00          C   \nATOM    443  CB  CYS A  60       3.768 -13.947  10.372  1.00  0.00          C   \nATOM    444  O   CYS A  60       2.717 -15.781   8.035  1.00  0.00          O   \nATOM    445  SG  CYS A  60       4.863 -14.997  11.352  1.00  0.00          S   \nATOM    446  N   THR A  61       2.370 -16.747  10.083  1.00  0.00          N   \nATOM    447  CA  THR A  61       2.549 -18.025   9.403  1.00  0.00          C   \nATOM    448  C   THR A  61       1.237 -18.493   8.779  1.00  0.00          C   \nATOM    449  CB  THR A  61       3.075 -19.103  10.369  1.00  0.00          C   \nATOM    450  O   THR A  61       1.241 -19.301   7.848  1.00  0.00          O   \nATOM    451  CG2 THR A  61       4.474 -18.758  10.869  1.00  0.00          C   \nATOM    452  OG1 THR A  61       2.190 -19.204  11.491  1.00  0.00          O   \nATOM    453  N   ALA A  62       0.127 -17.759   9.279  1.00  0.00          N   \nATOM    454  CA  ALA A  62      -1.157 -18.259   8.792  1.00  0.00          C   \nATOM    455  C   ALA A  62      -1.490 -17.673   7.423  1.00  0.00          C   \nATOM    456  CB  ALA A  62      -2.266 -17.936   9.790  1.00  0.00          C   \nATOM    457  O   ALA A  62      -2.183 -18.305   6.623  1.00  0.00          O   \nATOM    458  N   ILE A  63      -0.953 -16.508   7.207  1.00  0.00          N   \nATOM    459  CA  ILE A  63      -1.310 -15.966   5.900  1.00  0.00          C   \nATOM    460  C   ILE A  63      -0.123 -16.091   4.948  1.00  0.00          C   \nATOM    461  CB  ILE A  63      -1.761 -14.492   6.004  1.00  0.00          C   \nATOM    462  O   ILE A  63       0.973 -15.611   5.246  1.00  0.00          O   \nATOM    463  CG1 ILE A  63      -2.978 -14.369   6.929  1.00  0.00          C   \nATOM    464  CG2 ILE A  63      -2.068 -13.922   4.616  1.00  0.00          C   \nATOM    465  CD1 ILE A  63      -3.430 -12.936   7.171  1.00  0.00          C   \nATOM    466  N   PRO A  64      -0.261 -17.160   4.081  1.00  0.00          N   \nATOM    467  CA  PRO A  64       0.812 -17.254   3.088  1.00  0.00          C   \nATOM    468  C   PRO A  64       1.182 -15.899   2.489  1.00  0.00          C   \nATOM    469  CB  PRO A  64       0.224 -18.181   2.021  1.00  0.00          C   \nATOM    470  O   PRO A  64       0.304 -15.069   2.242  1.00  0.00          O   \nATOM    471  CG  PRO A  64      -1.257 -18.050   2.175  1.00  0.00          C   \nATOM    472  CD  PRO A  64      -1.560 -17.707   3.605  1.00  0.00          C   \nATOM    473  N   CYS A  65       2.470 -15.492   2.721  1.00  0.00          N   \nATOM    474  CA  CYS A  65       2.970 -14.283   2.076  1.00  0.00          C   \nATOM    475  C   CYS A  65       2.884 -14.399   0.559  1.00  0.00          C   \nATOM    476  CB  CYS A  65       4.415 -14.011   2.494  1.00  0.00          C   \nATOM    477  O   CYS A  65       3.627 -15.170  -0.052  1.00  0.00          O   \nATOM    478  SG  CYS A  65       4.983 -12.341   2.107  1.00  0.00          S   \nATOM    479  N   ASN A  66       1.810 -14.008   0.034  1.00  0.00          N   \nATOM    480  CA  ASN A  66       1.657 -13.952  -1.416  1.00  0.00          C   \nATOM    481  C   ASN A  66       1.636 -12.512  -1.922  1.00  0.00          C   \nATOM    482  CB  ASN A  66       0.388 -14.686  -1.851  1.00  0.00          C   \nATOM    483  O   ASN A  66       1.843 -11.575  -1.149  1.00  0.00          O   \nATOM    484  CG  ASN A  66      -0.864 -14.121  -1.209  1.00  0.00          C   \nATOM    485  ND2 ASN A  66      -1.787 -14.999  -0.835  1.00  0.00          N   \nATOM    486  OD1 ASN A  66      -0.999 -12.905  -1.050  1.00  0.00          O   \nATOM    487  N   GLU A  67       1.630 -12.346  -3.214  1.00  0.00          N   \nATOM    488  CA  GLU A  67       1.700 -11.038  -3.857  1.00  0.00          C   \nATOM    489  C   GLU A  67       0.657 -10.083  -3.284  1.00  0.00          C   \nATOM    490  CB  GLU A  67       1.515 -11.172  -5.371  1.00  0.00          C   \nATOM    491  O   GLU A  67       0.820  -8.863  -3.353  1.00  0.00          O   \nATOM    492  CG  GLU A  67       0.220 -11.863  -5.773  1.00  0.00          C   \nATOM    493  CD  GLU A  67       0.104 -12.095  -7.271  1.00  0.00          C   \nATOM    494  OE1 GLU A  67      -1.026 -12.040  -7.808  1.00  0.00          O   \nATOM    495  OE2 GLU A  67       1.151 -12.333  -7.914  1.00  0.00          O   \nATOM    496  N   ASP A  68      -0.317 -10.492  -2.553  1.00  0.00          N   \nATOM    497  CA  ASP A  68      -1.388  -9.666  -2.004  1.00  0.00          C   \nATOM    498  C   ASP A  68      -1.103  -9.292  -0.551  1.00  0.00          C   \nATOM    499  CB  ASP A  68      -2.731 -10.391  -2.108  1.00  0.00          C   \nATOM    500  O   ASP A  68      -1.847  -8.517   0.053  1.00  0.00          O   \nATOM    501  CG  ASP A  68      -3.195 -10.578  -3.541  1.00  0.00          C   \nATOM    502  OD1 ASP A  68      -3.828 -11.611  -3.848  1.00  0.00          O   \nATOM    503  OD2 ASP A  68      -2.923  -9.685  -4.373  1.00  0.00          O   \nATOM    504  N   HIS A  69      -0.167  -9.956   0.090  1.00  0.00          N   \nATOM    505  CA  HIS A  69       0.211  -9.683   1.472  1.00  0.00          C   \nATOM    506  C   HIS A  69       1.044  -8.410   1.574  1.00  0.00          C   \nATOM    507  CB  HIS A  69       0.985 -10.865   2.059  1.00  0.00          C   \nATOM    508  O   HIS A  69       2.031  -8.249   0.852  1.00  0.00          O   \nATOM    509  CG  HIS A  69       1.021 -10.875   3.555  1.00  0.00          C   \nATOM    510  CD2 HIS A  69       0.448 -11.711   4.452  1.00  0.00          C   \nATOM    511  ND1 HIS A  69       1.712  -9.936   4.288  1.00  0.00          N   \nATOM    512  CE1 HIS A  69       1.562 -10.195   5.577  1.00  0.00          C   \nATOM    513  NE2 HIS A  69       0.800 -11.267   5.703  1.00  0.00          N   \nATOM    514  N   PRO A  70       0.701  -7.489   2.427  1.00  0.00          N   \nATOM    515  CA  PRO A  70       1.384  -6.197   2.516  1.00  0.00          C   \nATOM    516  C   PRO A  70       2.882  -6.337   2.776  1.00  0.00          C   \nATOM    517  CB  PRO A  70       0.687  -5.510   3.693  1.00  0.00          C   \nATOM    518  O   PRO A  70       3.663  -5.461   2.397  1.00  0.00          O   \nATOM    519  CG  PRO A  70      -0.046  -6.606   4.396  1.00  0.00          C   \nATOM    520  CD  PRO A  70      -0.242  -7.742   3.433  1.00  0.00          C   \nATOM    521  N   CYS A  71       3.295  -7.400   3.302  1.00  0.00          N   \nATOM    522  CA  CYS A  71       4.698  -7.619   3.633  1.00  0.00          C   \nATOM    523  C   CYS A  71       5.402  -8.407   2.534  1.00  0.00          C   \nATOM    524  CB  CYS A  71       4.825  -8.359   4.965  1.00  0.00          C   \nATOM    525  O   CYS A  71       6.576  -8.754   2.669  1.00  0.00          O   \nATOM    526  SG  CYS A  71       4.149  -7.448   6.371  1.00  0.00          S   \nATOM    527  N   HIS A  72       4.559  -8.757   1.576  1.00  0.00          N   \nATOM    528  CA  HIS A  72       5.119  -9.541   0.482  1.00  0.00          C   \nATOM    529  C   HIS A  72       6.010  -8.684  -0.411  1.00  0.00          C   \nATOM    530  CB  HIS A  72       4.003 -10.179  -0.347  1.00  0.00          C   \nATOM    531  O   HIS A  72       5.596  -7.614  -0.864  1.00  0.00          O   \nATOM    532  CG  HIS A  72       4.498 -10.942  -1.534  1.00  0.00          C   \nATOM    533  CD2 HIS A  72       4.508 -10.627  -2.851  1.00  0.00          C   \nATOM    534  ND1 HIS A  72       5.064 -12.194  -1.431  1.00  0.00          N   \nATOM    535  CE1 HIS A  72       5.402 -12.618  -2.638  1.00  0.00          C   \nATOM    536  NE2 HIS A  72       5.076 -11.686  -3.517  1.00  0.00          N   \nATOM    537  N   HIS A  73       7.276  -9.193  -0.608  1.00  0.00          N   \nATOM    538  CA  HIS A  73       8.219  -8.528  -1.500  1.00  0.00          C   \nATOM    539  C   HIS A  73       8.888  -9.527  -2.439  1.00  0.00          C   \nATOM    540  CB  HIS A  73       9.278  -7.774  -0.695  1.00  0.00          C   \nATOM    541  O   HIS A  73       9.246 -10.632  -2.024  1.00  0.00          O   \nATOM    542  CG  HIS A  73       8.715  -6.693   0.172  1.00  0.00          C   \nATOM    543  CD2 HIS A  73       8.550  -6.625   1.514  1.00  0.00          C   \nATOM    544  ND1 HIS A  73       8.240  -5.504  -0.336  1.00  0.00          N   \nATOM    545  CE1 HIS A  73       7.806  -4.749   0.660  1.00  0.00          C   \nATOM    546  NE2 HIS A  73       7.983  -5.406   1.793  1.00  0.00          N   \nATOM    547  N   CYS A  74       8.907  -9.137  -3.729  1.00  0.00          N   \nATOM    548  CA  CYS A  74       9.582  -9.976  -4.713  1.00  0.00          C   \nATOM    549  C   CYS A  74      10.677  -9.199  -5.433  1.00  0.00          C   \nATOM    550  CB  CYS A  74       8.580 -10.523  -5.729  1.00  0.00          C   \nATOM    551  O   CYS A  74      10.529  -8.003  -5.689  1.00  0.00          O   \nATOM    552  SG  CYS A  74       7.391 -11.686  -5.025  1.00  0.00          S   \nATOM    553  N   HIS A  75      11.715  -9.738  -5.575  1.00  0.00          N   \nATOM    554  CA  HIS A  75      12.772  -9.115  -6.364  1.00  0.00          C   \nATOM    555  C   HIS A  75      13.308 -10.074  -7.422  1.00  0.00          C   \nATOM    556  CB  HIS A  75      13.910  -8.643  -5.458  1.00  0.00          C   \nATOM    557  O   HIS A  75      13.275 -11.292  -7.235  1.00  0.00          O   \nATOM    558  CG  HIS A  75      14.605  -9.755  -4.740  1.00  0.00          C   \nATOM    559  CD2 HIS A  75      15.789 -10.366  -4.981  1.00  0.00          C   \nATOM    560  ND1 HIS A  75      14.075 -10.368  -3.625  1.00  0.00          N   \nATOM    561  CE1 HIS A  75      14.905 -11.310  -3.211  1.00  0.00          C   \nATOM    562  NE2 HIS A  75      15.954 -11.330  -4.016  1.00  0.00          N   \nATOM    563  N   GLU A  76      13.647  -9.546  -8.538  1.00  0.00          N   \nATOM    564  CA  GLU A  76      14.228 -10.322  -9.630  1.00  0.00          C   \nATOM    565  C   GLU A  76      15.753 -10.283  -9.585  1.00  0.00          C   \nATOM    566  CB  GLU A  76      13.727  -9.806 -10.981  1.00  0.00          C   \nATOM    567  O   GLU A  76      16.350  -9.205  -9.546  1.00  0.00          O   \nATOM    568  CG  GLU A  76      14.060 -10.722 -12.150  1.00  0.00          C   \nATOM    569  CD  GLU A  76      13.399 -10.297 -13.452  1.00  0.00          C   \nATOM    570  OE1 GLU A  76      12.554  -9.373 -13.430  1.00  0.00          O   \nATOM    571  OE2 GLU A  76      13.727 -10.894 -14.501  1.00  0.00          O   \nATOM    572  N   GLU A  77      16.313 -11.414  -9.551  1.00  0.00          N   \nATOM    573  CA  GLU A  77      17.769 -11.510  -9.570  1.00  0.00          C   \nATOM    574  C   GLU A  77      18.310 -11.423 -10.994  1.00  0.00          C   \nATOM    575  CB  GLU A  77      18.231 -12.812  -8.911  1.00  0.00          C   \nATOM    576  O   GLU A  77      17.548 -11.510 -11.959  1.00  0.00          O   \nATOM    577  CG  GLU A  77      17.844 -12.929  -7.444  1.00  0.00          C   \nATOM    578  CD  GLU A  77      18.639 -12.003  -6.537  1.00  0.00          C   \nATOM    579  OE1 GLU A  77      19.776 -11.626  -6.901  1.00  0.00          O   \nATOM    580  OE2 GLU A  77      18.120 -11.651  -5.454  1.00  0.00          O   \nATOM    581  N   ASP A  78      19.573 -11.066 -11.091  1.00  0.00          N   \nATOM    582  CA  ASP A  78      20.266 -10.915 -12.367  1.00  0.00          C   \nATOM    583  C   ASP A  78      20.084 -12.153 -13.241  1.00  0.00          C   \nATOM    584  CB  ASP A  78      21.755 -10.645 -12.140  1.00  0.00          C   \nATOM    585  O   ASP A  78      20.095 -12.059 -14.470  1.00  0.00          O   \nATOM    586  CG  ASP A  78      22.029  -9.254 -11.597  1.00  0.00          C   \nATOM    587  OD1 ASP A  78      23.114  -9.028 -11.018  1.00  0.00          O   \nATOM    588  OD2 ASP A  78      21.152  -8.376 -11.747  1.00  0.00          O   \nATOM    589  N   ASP A  79      19.875 -13.279 -12.572  1.00  0.00          N   \nATOM    590  CA  ASP A  79      19.730 -14.515 -13.335  1.00  0.00          C   \nATOM    591  C   ASP A  79      18.288 -14.708 -13.799  1.00  0.00          C   \nATOM    592  CB  ASP A  79      20.180 -15.716 -12.501  1.00  0.00          C   \nATOM    593  O   ASP A  79      17.946 -15.750 -14.363  1.00  0.00          O   \nATOM    594  CG  ASP A  79      19.357 -15.903 -11.238  1.00  0.00          C   \nATOM    595  OD1 ASP A  79      19.656 -16.822 -10.446  1.00  0.00          O   \nATOM    596  OD2 ASP A  79      18.399 -15.127 -11.036  1.00  0.00          O   \nATOM    597  N   GLY A  80      17.414 -13.715 -13.581  1.00  0.00          N   \nATOM    598  CA  GLY A  80      16.044 -13.776 -14.063  1.00  0.00          C   \nATOM    599  C   GLY A  80      15.095 -14.439 -13.081  1.00  0.00          C   \nATOM    600  O   GLY A  80      13.881 -14.444 -13.291  1.00  0.00          O   \nATOM    601  N   ASP A  81      15.662 -15.063 -12.040  1.00  0.00          N   \nATOM    602  CA  ASP A  81      14.823 -15.721 -11.043  1.00  0.00          C   \nATOM    603  C   ASP A  81      14.161 -14.699 -10.121  1.00  0.00          C   \nATOM    604  CB  ASP A  81      15.646 -16.715 -10.221  1.00  0.00          C   \nATOM    605  O   ASP A  81      14.715 -13.625  -9.878  1.00  0.00          O   \nATOM    606  CG  ASP A  81      16.113 -17.911 -11.031  1.00  0.00          C   \nATOM    607  OD1 ASP A  81      17.118 -18.550 -10.652  1.00  0.00          O   \nATOM    608  OD2 ASP A  81      15.472 -18.216 -12.060  1.00  0.00          O   \nATOM    609  N   THR A  82      12.968 -14.929  -9.764  1.00  0.00          N   \nATOM    610  CA  THR A  82      12.231 -14.082  -8.832  1.00  0.00          C   \nATOM    611  C   THR A  82      12.233 -14.689  -7.432  1.00  0.00          C   \nATOM    612  CB  THR A  82      10.780 -13.868  -9.299  1.00  0.00          C   \nATOM    613  O   THR A  82      11.931 -15.872  -7.262  1.00  0.00          O   \nATOM    614  CG2 THR A  82      10.028 -12.938  -8.352  1.00  0.00          C   \nATOM    615  OG1 THR A  82      10.786 -13.291 -10.611  1.00  0.00          O   \nATOM    616  N   HIS A  83      12.679 -13.936  -6.510  1.00  0.00          N   \nATOM    617  CA  HIS A  83      12.653 -14.347  -5.110  1.00  0.00          C   \nATOM    618  C   HIS A  83      11.661 -13.511  -4.309  1.00  0.00          C   \nATOM    619  CB  HIS A  83      14.049 -14.239  -4.494  1.00  0.00          C   \nATOM    620  O   HIS A  83      11.675 -12.280  -4.387  1.00  0.00          O   \nATOM    621  CG  HIS A  83      15.047 -15.170  -5.104  1.00  0.00          C   \nATOM    622  CD2 HIS A  83      15.925 -14.991  -6.119  1.00  0.00          C   \nATOM    623  ND1 HIS A  83      15.219 -16.466  -4.669  1.00  0.00          N   \nATOM    624  CE1 HIS A  83      16.163 -17.046  -5.391  1.00  0.00          C   \nATOM    625  NE2 HIS A  83      16.608 -16.172  -6.279  1.00  0.00          N   \nATOM    626  N   CYS A  84      10.791 -14.185  -3.722  1.00  0.00          N   \nATOM    627  CA  CYS A  84       9.793 -13.514  -2.896  1.00  0.00          C   \nATOM    628  C   CYS A  84      10.017 -13.813  -1.419  1.00  0.00          C   \nATOM    629  CB  CYS A  84       8.384 -13.942  -3.305  1.00  0.00          C   \nATOM    630  O   CYS A  84      10.408 -14.924  -1.059  1.00  0.00          O   \nATOM    631  SG  CYS A  84       7.968 -13.539  -5.016  1.00  0.00          S   \nATOM    632  N   HIS A  85       9.909 -12.859  -0.708  1.00  0.00          N   \nATOM    633  CA  HIS A  85       9.975 -13.070   0.733  1.00  0.00          C   \nATOM    634  C   HIS A  85       8.927 -12.236   1.461  1.00  0.00          C   \nATOM    635  CB  HIS A  85      11.372 -12.734   1.260  1.00  0.00          C   \nATOM    636  O   HIS A  85       8.377 -11.289   0.894  1.00  0.00          O   \nATOM    637  CG  HIS A  85      11.748 -11.296   1.089  1.00  0.00          C   \nATOM    638  CD2 HIS A  85      11.777 -10.273   1.975  1.00  0.00          C   \nATOM    639  ND1 HIS A  85      12.152 -10.772  -0.120  1.00  0.00          N   \nATOM    640  CE1 HIS A  85      12.415  -9.485   0.031  1.00  0.00          C   \nATOM    641  NE2 HIS A  85      12.196  -9.157   1.293  1.00  0.00          N   \nATOM    642  N   CYS A  86       8.500 -12.728   2.583  1.00  0.00          N   \nATOM    643  CA  CYS A  86       7.596 -12.021   3.484  1.00  0.00          C   \nATOM    644  C   CYS A  86       8.373 -11.290   4.572  1.00  0.00          C   \nATOM    645  CB  CYS A  86       6.603 -12.993   4.119  1.00  0.00          C   \nATOM    646  O   CYS A  86       8.939 -11.920   5.467  1.00  0.00          O   \nATOM    647  SG  CYS A  86       5.473 -13.757   2.934  1.00  0.00          S   \nATOM    648  N   SER A  87       8.541 -10.143   4.355  1.00  0.00          N   \nATOM    649  CA  SER A  87       9.296  -9.406   5.363  1.00  0.00          C   \nATOM    650  C   SER A  87       8.570  -8.129   5.774  1.00  0.00          C   \nATOM    651  CB  SER A  87      10.692  -9.064   4.843  1.00  0.00          C   \nATOM    652  O   SER A  87       8.018  -7.424   4.927  1.00  0.00          O   \nATOM    653  OG  SER A  87      11.410  -8.297   5.794  1.00  0.00          O   \nATOM    654  N   CYS A  88       8.324  -8.020   6.956  1.00  0.00          N   \nATOM    655  CA  CYS A  88       7.764  -6.786   7.497  1.00  0.00          C   \nATOM    656  C   CYS A  88       8.869  -5.829   7.928  1.00  0.00          C   \nATOM    657  CB  CYS A  88       6.847  -7.088   8.681  1.00  0.00          C   \nATOM    658  O   CYS A  88       8.600  -4.816   8.576  1.00  0.00          O   \nATOM    659  SG  CYS A  88       5.414  -8.102   8.253  1.00  0.00          S   \nATOM    660  N   GLU A  89       9.941  -6.277   7.427  1.00  0.00          N   \nATOM    661  CA  GLU A  89      11.079  -5.417   7.736  1.00  0.00          C   \nATOM    662  C   GLU A  89      11.164  -4.244   6.763  1.00  0.00          C   \nATOM    663  CB  GLU A  89      12.382  -6.219   7.709  1.00  0.00          C   \nATOM    664  O   GLU A  89      10.884  -4.397   5.572  1.00  0.00          O   \nATOM    665  CG  GLU A  89      12.497  -7.244   8.828  1.00  0.00          C   \nATOM    666  CD  GLU A  89      12.821  -6.626  10.178  1.00  0.00          C   \nATOM    667  OE1 GLU A  89      13.318  -5.477  10.216  1.00  0.00          O   \nATOM    668  OE2 GLU A  89      12.577  -7.295  11.207  1.00  0.00          O   \nATOM    669  N   HIS A  90      10.877  -2.882   7.151  1.00  0.00          N   \nATOM    670  CA  HIS A  90      11.037  -1.634   6.414  1.00  0.00          C   \nATOM    671  C   HIS A  90      12.477  -1.452   5.945  1.00  0.00          C   \nATOM    672  CB  HIS A  90      10.611  -0.444   7.276  1.00  0.00          C   \nATOM    673  O   HIS A  90      13.291  -0.847   6.647  1.00  0.00          O   \nATOM    674  CG  HIS A  90       9.172  -0.482   7.682  1.00  0.00          C   \nATOM    675  CD2 HIS A  90       8.592  -0.729   8.880  1.00  0.00          C   \nATOM    676  ND1 HIS A  90       8.143  -0.249   6.795  1.00  0.00          N   \nATOM    677  CE1 HIS A  90       6.989  -0.350   7.434  1.00  0.00          C   \nATOM    678  NE2 HIS A  90       7.234  -0.641   8.700  1.00  0.00          N   \nATOM    679  N   SER A  91      13.113  -2.415   5.257  1.00  0.00          N   \nATOM    680  CA  SER A  91      14.468  -1.999   4.909  1.00  0.00          C   \nATOM    681  C   SER A  91      14.482  -1.180   3.623  1.00  0.00          C   \nATOM    682  CB  SER A  91      15.380  -3.217   4.758  1.00  0.00          C   \nATOM    683  O   SER A  91      13.868  -1.568   2.627  1.00  0.00          O   \nATOM    684  OG  SER A  91      15.023  -3.974   3.614  1.00  0.00          O   \nATOM    685  N   HIS A  92      14.296   0.148   3.642  1.00  0.00          N   \nATOM    686  CA  HIS A  92      14.603   1.170   2.647  1.00  0.00          C   \nATOM    687  C   HIS A  92      15.930   0.882   1.953  1.00  0.00          C   \nATOM    688  CB  HIS A  92      14.638   2.555   3.295  1.00  0.00          C   \nATOM    689  O   HIS A  92      16.284   1.551   0.979  1.00  0.00          O   \nATOM    690  CG  HIS A  92      13.324   2.984   3.866  1.00  0.00          C   \nATOM    691  CD2 HIS A  92      12.943   3.213   5.145  1.00  0.00          C   \nATOM    692  ND1 HIS A  92      12.216   3.224   3.084  1.00  0.00          N   \nATOM    693  CE1 HIS A  92      11.207   3.584   3.859  1.00  0.00          C   \nATOM    694  NE2 HIS A  92      11.621   3.585   5.114  1.00  0.00          N   \nATOM    695  N   ASP A  93      16.676  -0.193   2.168  1.00  0.00          N   \nATOM    696  CA  ASP A  93      18.015  -0.132   1.589  1.00  0.00          C   \nATOM    697  C   ASP A  93      18.097  -0.954   0.305  1.00  0.00          C   \nATOM    698  CB  ASP A  93      19.058  -0.622   2.596  1.00  0.00          C   \nATOM    699  O   ASP A  93      19.179  -1.132  -0.256  1.00  0.00          O   \nATOM    700  CG  ASP A  93      19.487   0.454   3.577  1.00  0.00          C   \nATOM    701  OD1 ASP A  93      20.370   0.192   4.423  1.00  0.00          O   \nATOM    702  OD2 ASP A  93      18.935   1.573   3.507  1.00  0.00          O   \nATOM    703  N   HIS A  94      17.467  -0.634  -0.758  1.00  0.00          N   \nATOM    704  CA  HIS A  94      18.140  -1.057  -1.982  1.00  0.00          C   \nATOM    705  C   HIS A  94      17.627  -0.280  -3.189  1.00  0.00          C   \nATOM    706  CB  HIS A  94      17.951  -2.559  -2.205  1.00  0.00          C   \nATOM    707  O   HIS A  94      16.419  -0.075  -3.334  1.00  0.00          O   \nATOM    708  CG  HIS A  94      18.800  -3.409  -1.315  1.00  0.00          C   \nATOM    709  CD2 HIS A  94      18.467  -4.255  -0.312  1.00  0.00          C   \nATOM    710  ND1 HIS A  94      20.175  -3.442  -1.407  1.00  0.00          N   \nATOM    711  CE1 HIS A  94      20.651  -4.276  -0.497  1.00  0.00          C   \nATOM    712  NE2 HIS A  94      19.635  -4.782   0.181  1.00  0.00          N   \nATOM    713  N   HIS A  95      18.249   0.957  -3.481  1.00  0.00          N   \nATOM    714  CA  HIS A  95      18.496   1.578  -4.778  1.00  0.00          C   \nATOM    715  C   HIS A  95      18.041   0.672  -5.918  1.00  0.00          C   \nATOM    716  CB  HIS A  95      19.979   1.916  -4.936  1.00  0.00          C   \nATOM    717  O   HIS A  95      18.521   0.799  -7.046  1.00  0.00          O   \nATOM    718  CG  HIS A  95      20.458   2.973  -3.992  1.00  0.00          C   \nATOM    719  CD2 HIS A  95      21.388   2.932  -3.010  1.00  0.00          C   \nATOM    720  ND1 HIS A  95      19.959   4.258  -3.999  1.00  0.00          N   \nATOM    721  CE1 HIS A  95      20.565   4.963  -3.059  1.00  0.00          C   \nATOM    722  NE2 HIS A  95      21.437   4.182  -2.444  1.00  0.00          N   \nATOM    723  N   ASP A  96      16.923   0.136  -5.980  1.00  0.00          N   \nATOM    724  CA  ASP A  96      16.554  -0.218  -7.347  1.00  0.00          C   \nATOM    725  C   ASP A  96      15.459   0.705  -7.877  1.00  0.00          C   \nATOM    726  CB  ASP A  96      16.093  -1.676  -7.418  1.00  0.00          C   \nATOM    727  O   ASP A  96      14.655   1.230  -7.104  1.00  0.00          O   \nATOM    728  CG  ASP A  96      17.246  -2.663  -7.414  1.00  0.00          C   \nATOM    729  OD1 ASP A  96      17.024  -3.859  -7.125  1.00  0.00          O   \nATOM    730  OD2 ASP A  96      18.388  -2.242  -7.699  1.00  0.00          O   \nATOM    731  N   ASP A  97      15.890   1.837  -8.509  1.00  0.00          N   \nATOM    732  CA  ASP A  97      15.081   2.551  -9.491  1.00  0.00          C   \nATOM    733  C   ASP A  97      13.874   1.718  -9.918  1.00  0.00          C   \nATOM    734  CB  ASP A  97      15.923   2.923 -10.713  1.00  0.00          C   \nATOM    735  O   ASP A  97      13.369   1.874 -11.032  1.00  0.00          O   \nATOM    736  CG  ASP A  97      16.981   3.969 -10.409  1.00  0.00          C   \nATOM    737  OD1 ASP A  97      18.049   3.963 -11.058  1.00  0.00          O   \nATOM    738  OD2 ASP A  97      16.746   4.804  -9.509  1.00  0.00          O   \nATOM    739  N   ASP A  98      13.468   0.802  -9.181  1.00  0.00          N   \nATOM    740  CA  ASP A  98      12.224   0.241  -9.699  1.00  0.00          C   \nATOM    741  C   ASP A  98      11.093   1.266  -9.639  1.00  0.00          C   \nATOM    742  CB  ASP A  98      11.837  -1.017  -8.920  1.00  0.00          C   \nATOM    743  O   ASP A  98      10.974   2.010  -8.663  1.00  0.00          O   \nATOM    744  CG  ASP A  98      12.688  -2.222  -9.278  1.00  0.00          C   \nATOM    745  OD1 ASP A  98      12.775  -3.170  -8.468  1.00  0.00          O   \nATOM    746  OD2 ASP A  98      13.280  -2.223 -10.379  1.00  0.00          O   \nATOM    747  N   THR A  99      11.132   2.146 -10.695  1.00  0.00          N   \nATOM    748  CA  THR A  99       9.998   2.959 -11.120  1.00  0.00          C   \nATOM    749  C   THR A  99       8.685   2.355 -10.628  1.00  0.00          C   \nATOM    750  CB  THR A  99       9.957   3.102 -12.653  1.00  0.00          C   \nATOM    751  O   THR A  99       7.730   2.223 -11.396  1.00  0.00          O   \nATOM    752  CG2 THR A  99      11.214   3.791 -13.174  1.00  0.00          C   \nATOM    753  OG1 THR A  99       9.857   1.802 -13.246  1.00  0.00          O   \nATOM    754  N   HIS A 100       8.653   1.675  -9.540  1.00  0.00          N   \nATOM    755  CA  HIS A 100       7.234   1.548  -9.228  1.00  0.00          C   \nATOM    756  C   HIS A 100       6.625   2.899  -8.870  1.00  0.00          C   \nATOM    757  CB  HIS A 100       7.024   0.557  -8.082  1.00  0.00          C   \nATOM    758  O   HIS A 100       7.154   3.617  -8.019  1.00  0.00          O   \nATOM    759  CG  HIS A 100       7.437  -0.842  -8.414  1.00  0.00          C   \nATOM    760  CD2 HIS A 100       8.446  -1.607  -7.937  1.00  0.00          C   \nATOM    761  ND1 HIS A 100       6.777  -1.610  -9.349  1.00  0.00          N   \nATOM    762  CE1 HIS A 100       7.365  -2.793  -9.431  1.00  0.00          C   \nATOM    763  NE2 HIS A 100       8.380  -2.816  -8.585  1.00  0.00          N   \nATOM    764  N   GLY A 101       6.381   3.654  -9.900  1.00  0.00          N   \nATOM    765  CA  GLY A 101       5.487   4.753  -9.574  1.00  0.00          C   \nATOM    766  C   GLY A 101       4.744   4.550  -8.267  1.00  0.00          C   \nATOM    767  O   GLY A 101       3.522   4.386  -8.261  1.00  0.00          O   \nATOM    768  N   GLU A 102       5.430   3.707  -7.432  1.00  0.00          N   \nATOM    769  CA  GLU A 102       4.594   3.693  -6.235  1.00  0.00          C   \nATOM    770  C   GLU A 102       4.478   5.087  -5.627  1.00  0.00          C   \nATOM    771  CB  GLU A 102       5.153   2.712  -5.201  1.00  0.00          C   \nATOM    772  O   GLU A 102       5.392   5.905  -5.757  1.00  0.00          O   \nATOM    773  CG  GLU A 102       5.195   1.269  -5.681  1.00  0.00          C   \nATOM    774  CD  GLU A 102       3.815   0.668  -5.897  1.00  0.00          C   \nATOM    775  OE1 GLU A 102       2.810   1.292  -5.486  1.00  0.00          O   \nATOM    776  OE2 GLU A 102       3.738  -0.436  -6.481  1.00  0.00          O   \nATOM    777  N   CYS A 103       3.304   5.585  -5.881  1.00  0.00          N   \nATOM    778  CA  CYS A 103       2.937   6.733  -5.061  1.00  0.00          C   \nATOM    779  C   CYS A 103       3.767   6.778  -3.783  1.00  0.00          C   \nATOM    780  CB  CYS A 103       1.449   6.690  -4.712  1.00  0.00          C   \nATOM    781  O   CYS A 103       3.803   5.806  -3.027  1.00  0.00          O   \nATOM    782  SG  CYS A 103       0.362   6.999  -6.121  1.00  0.00          S   \nATOM    783  N   THR A 104       4.856   7.423  -3.910  1.00  0.00          N   \nATOM    784  CA  THR A 104       5.617   7.650  -2.686  1.00  0.00          C   \nATOM    785  C   THR A 104       5.025   8.808  -1.888  1.00  0.00          C   \nATOM    786  CB  THR A 104       7.098   7.939  -2.995  1.00  0.00          C   \nATOM    787  O   THR A 104       4.142   9.517  -2.375  1.00  0.00          O   \nATOM    788  CG2 THR A 104       7.686   6.875  -3.916  1.00  0.00          C   \nATOM    789  OG1 THR A 104       7.206   9.219  -3.631  1.00  0.00          O   \nATOM    790  N   LYS A 105       5.301   8.726  -0.683  1.00  0.00          N   \nATOM    791  CA  LYS A 105       4.870   9.830   0.169  1.00  0.00          C   \nATOM    792  C   LYS A 105       5.196  11.178  -0.469  1.00  0.00          C   \nATOM    793  CB  LYS A 105       5.523   9.731   1.548  1.00  0.00          C   \nATOM    794  O   LYS A 105       4.534  12.179  -0.190  1.00  0.00          O   \nATOM    795  CG  LYS A 105       4.955   8.625   2.425  1.00  0.00          C   \nATOM    796  CD  LYS A 105       5.514   8.690   3.840  1.00  0.00          C   \nATOM    797  CE  LYS A 105       4.894   7.627   4.736  1.00  0.00          C   \nATOM    798  NZ  LYS A 105       5.487   7.643   6.107  1.00  0.00          N   \nATOM    799  N   LYS A 106       6.132  11.170  -1.417  1.00  0.00          N   \nATOM    800  CA  LYS A 106       6.565  12.408  -2.059  1.00  0.00          C   \nATOM    801  C   LYS A 106       5.727  12.707  -3.298  1.00  0.00          C   \nATOM    802  CB  LYS A 106       8.046  12.329  -2.434  1.00  0.00          C   \nATOM    803  O   LYS A 106       5.794  13.808  -3.849  1.00  0.00          O   \nATOM    804  CG  LYS A 106       8.986  12.274  -1.239  1.00  0.00          C   \nATOM    805  CD  LYS A 106      10.445  12.262  -1.676  1.00  0.00          C   \nATOM    806  CE  LYS A 106      11.387  12.222  -0.480  1.00  0.00          C   \nATOM    807  NZ  LYS A 106      12.817  12.151  -0.903  1.00  0.00          N   \nATOM    808  N   ALA A 107       5.009  11.655  -3.672  1.00  0.00          N   \nATOM    809  CA  ALA A 107       4.208  11.854  -4.877  1.00  0.00          C   \nATOM    810  C   ALA A 107       3.004  12.748  -4.594  1.00  0.00          C   \nATOM    811  CB  ALA A 107       3.749  10.511  -5.439  1.00  0.00          C   \nATOM    812  O   ALA A 107       2.358  12.618  -3.552  1.00  0.00          O   \nATOM    813  N   PRO A 108       2.750  13.735  -5.350  1.00  0.00          N   \nATOM    814  CA  PRO A 108       1.593  14.609  -5.140  1.00  0.00          C   \nATOM    815  C   PRO A 108       0.271  13.845  -5.124  1.00  0.00          C   \nATOM    816  CB  PRO A 108       1.656  15.568  -6.331  1.00  0.00          C   \nATOM    817  O   PRO A 108      -0.730  14.348  -4.607  1.00  0.00          O   \nATOM    818  CG  PRO A 108       2.473  14.851  -7.356  1.00  0.00          C   \nATOM    819  CD  PRO A 108       3.398  13.901  -6.650  1.00  0.00          C   \nATOM    820  N   CYS A 109       0.245  12.652  -5.681  1.00  0.00          N   \nATOM    821  CA  CYS A 109      -1.009  11.911  -5.770  1.00  0.00          C   \nATOM    822  C   CYS A 109      -1.162  10.954  -4.594  1.00  0.00          C   \nATOM    823  CB  CYS A 109      -1.079  11.134  -7.084  1.00  0.00          C   \nATOM    824  O   CYS A 109      -2.174  10.261  -4.480  1.00  0.00          O   \nATOM    825  SG  CYS A 109       0.290   9.980  -7.322  1.00  0.00          S   \nATOM    826  N   TRP A 110      -0.068  10.925  -3.822  1.00  0.00          N   \nATOM    827  CA  TRP A 110      -0.125  10.100  -2.621  1.00  0.00          C   \nATOM    828  C   TRP A 110      -1.071  10.704  -1.589  1.00  0.00          C   \nATOM    829  CB  TRP A 110       1.272   9.934  -2.016  1.00  0.00          C   \nATOM    830  O   TRP A 110      -0.962  11.887  -1.255  1.00  0.00          O   \nATOM    831  CG  TRP A 110       1.322   8.997  -0.846  1.00  0.00          C   \nATOM    832  CD1 TRP A 110       1.696   7.682  -0.859  1.00  0.00          C   \nATOM    833  CD2 TRP A 110       0.980   9.304   0.509  1.00  0.00          C   \nATOM    834  CE2 TRP A 110       1.172   8.127   1.266  1.00  0.00          C   \nATOM    835  CE3 TRP A 110       0.531  10.462   1.158  1.00  0.00          C   \nATOM    836  NE1 TRP A 110       1.608   7.153   0.408  1.00  0.00          N   \nATOM    837  CH2 TRP A 110       0.491   9.222   3.250  1.00  0.00          C   \nATOM    838  CZ2 TRP A 110       0.929   8.075   2.640  1.00  0.00          C   \nATOM    839  CZ3 TRP A 110       0.290  10.409   2.526  1.00  0.00          C   \nATOM    840  N   ARG A 111      -2.102   9.880  -1.162  1.00  0.00          N   \nATOM    841  CA  ARG A 111      -3.086  10.357  -0.197  1.00  0.00          C   \nATOM    842  C   ARG A 111      -3.345   9.313   0.884  1.00  0.00          C   \nATOM    843  CB  ARG A 111      -4.397  10.720  -0.899  1.00  0.00          C   \nATOM    844  O   ARG A 111      -3.329   8.111   0.610  1.00  0.00          O   \nATOM    845  CG  ARG A 111      -5.466  11.263   0.034  1.00  0.00          C   \nATOM    846  CD  ARG A 111      -5.180  12.701   0.443  1.00  0.00          C   \nATOM    847  NE  ARG A 111      -6.289  13.277   1.200  1.00  0.00          N   \nATOM    848  NH1 ARG A 111      -5.313  15.357   1.444  1.00  0.00          N   \nATOM    849  NH2 ARG A 111      -7.384  14.946   2.335  1.00  0.00          N   \nATOM    850  CZ  ARG A 111      -6.326  14.525   1.658  1.00  0.00          C   \nATOM    851  N   CYS A 112      -3.365   9.888   2.033  1.00  0.00          N   \nATOM    852  CA  CYS A 112      -3.705   9.030   3.162  1.00  0.00          C   \nATOM    853  C   CYS A 112      -5.019   9.463   3.801  1.00  0.00          C   \nATOM    854  CB  CYS A 112      -2.589   9.051   4.206  1.00  0.00          C   \nATOM    855  O   CYS A 112      -5.318  10.657   3.866  1.00  0.00          O   \nATOM    856  SG  CYS A 112      -1.031   8.349   3.621  1.00  0.00          S   \nATOM    857  N   GLU A 113      -5.830   8.580   3.951  1.00  0.00          N   \nATOM    858  CA  GLU A 113      -7.053   8.822   4.710  1.00  0.00          C   \nATOM    859  C   GLU A 113      -7.031   8.080   6.044  1.00  0.00          C   \nATOM    860  CB  GLU A 113      -8.282   8.407   3.897  1.00  0.00          C   \nATOM    861  O   GLU A 113      -6.553   6.947   6.122  1.00  0.00          O   \nATOM    862  CG  GLU A 113      -8.500   9.241   2.643  1.00  0.00          C   \nATOM    863  CD  GLU A 113      -9.731   8.826   1.853  1.00  0.00          C   \nATOM    864  OE1 GLU A 113     -10.458   7.909   2.299  1.00  0.00          O   \nATOM    865  OE2 GLU A 113      -9.971   9.422   0.780  1.00  0.00          O   \nATOM    866  N   TYR A 114      -7.305   8.869   7.059  1.00  0.00          N   \nATOM    867  CA  TYR A 114      -7.411   8.262   8.381  1.00  0.00          C   \nATOM    868  C   TYR A 114      -8.671   7.412   8.491  1.00  0.00          C   \nATOM    869  CB  TYR A 114      -7.412   9.340   9.469  1.00  0.00          C   \nATOM    870  O   TYR A 114      -9.775   7.889   8.219  1.00  0.00          O   \nATOM    871  CG  TYR A 114      -7.392   8.785  10.872  1.00  0.00          C   \nATOM    872  CD1 TYR A 114      -8.527   8.834  11.678  1.00  0.00          C   \nATOM    873  CD2 TYR A 114      -6.238   8.213  11.396  1.00  0.00          C   \nATOM    874  CE1 TYR A 114      -8.513   8.326  12.973  1.00  0.00          C   \nATOM    875  CE2 TYR A 114      -6.212   7.702  12.690  1.00  0.00          C   \nATOM    876  OH  TYR A 114      -7.333   7.258  14.750  1.00  0.00          O   \nATOM    877  CZ  TYR A 114      -7.353   7.762  13.469  1.00  0.00          C   \nATOM    878  N   ASN A 115      -8.439   6.137   8.704  1.00  0.00          N   \nATOM    879  CA  ASN A 115      -9.527   5.202   8.972  1.00  0.00          C   \nATOM    880  C   ASN A 115      -9.770   5.039  10.469  1.00  0.00          C   \nATOM    881  CB  ASN A 115      -9.238   3.844   8.330  1.00  0.00          C   \nATOM    882  O   ASN A 115      -8.953   4.443  11.174  1.00  0.00          O   \nATOM    883  CG  ASN A 115     -10.442   2.922   8.345  1.00  0.00          C   \nATOM    884  ND2 ASN A 115     -10.511   2.021   7.373  1.00  0.00          N   \nATOM    885  OD1 ASN A 115     -11.302   3.020   9.224  1.00  0.00          O   \nATOM    886  N   ALA A 116     -10.796   5.699  10.920  1.00  0.00          N   \nATOM    887  CA  ALA A 116     -11.108   5.723  12.347  1.00  0.00          C   \nATOM    888  C   ALA A 116     -11.283   4.310  12.894  1.00  0.00          C   \nATOM    889  CB  ALA A 116     -12.366   6.549  12.603  1.00  0.00          C   \nATOM    890  O   ALA A 116     -10.898   4.025  14.031  1.00  0.00          O   \nATOM    891  N   ASP A 117     -11.725   3.414  12.007  1.00  0.00          N   \nATOM    892  CA  ASP A 117     -11.929   2.033  12.433  1.00  0.00          C   \nATOM    893  C   ASP A 117     -10.595   1.313  12.619  1.00  0.00          C   \nATOM    894  CB  ASP A 117     -12.796   1.281  11.421  1.00  0.00          C   \nATOM    895  O   ASP A 117     -10.432   0.529  13.557  1.00  0.00          O   \nATOM    896  CG  ASP A 117     -14.225   1.793  11.369  1.00  0.00          C   \nATOM    897  OD1 ASP A 117     -14.898   1.618  10.331  1.00  0.00          O   \nATOM    898  OD2 ASP A 117     -14.681   2.378  12.375  1.00  0.00          O   \nATOM    899  N   LEU A 118      -9.664   1.666  11.738  1.00  0.00          N   \nATOM    900  CA  LEU A 118      -8.349   1.035  11.785  1.00  0.00          C   \nATOM    901  C   LEU A 118      -7.364   1.891  12.575  1.00  0.00          C   \nATOM    902  CB  LEU A 118      -7.816   0.800  10.369  1.00  0.00          C   \nATOM    903  O   LEU A 118      -6.231   1.472  12.822  1.00  0.00          O   \nATOM    904  CG  LEU A 118      -8.639  -0.135   9.481  1.00  0.00          C   \nATOM    905  CD1 LEU A 118      -8.022  -0.225   8.090  1.00  0.00          C   \nATOM    906  CD2 LEU A 118      -8.746  -1.518  10.115  1.00  0.00          C   \nATOM    907  N   LYS A 119      -7.828   3.091  12.895  1.00  0.00          N   \nATOM    908  CA  LYS A 119      -6.988   4.069  13.580  1.00  0.00          C   \nATOM    909  C   LYS A 119      -5.640   4.222  12.882  1.00  0.00          C   \nATOM    910  CB  LYS A 119      -6.780   3.668  15.041  1.00  0.00          C   \nATOM    911  O   LYS A 119      -4.596   4.257  13.537  1.00  0.00          O   \nATOM    912  CG  LYS A 119      -8.064   3.604  15.855  1.00  0.00          C   \nATOM    913  CD  LYS A 119      -7.786   3.255  17.311  1.00  0.00          C   \nATOM    914  CE  LYS A 119      -9.062   3.263  18.143  1.00  0.00          C   \nATOM    915  NZ  LYS A 119      -8.786   2.979  19.583  1.00  0.00          N   \nATOM    916  N   HIS A 120      -5.544   4.099  11.731  1.00  0.00          N   \nATOM    917  CA  HIS A 120      -4.341   4.353  10.946  1.00  0.00          C   \nATOM    918  C   HIS A 120      -4.690   4.898   9.565  1.00  0.00          C   \nATOM    919  CB  HIS A 120      -3.510   3.075  10.811  1.00  0.00          C   \nATOM    920  O   HIS A 120      -5.853   4.869   9.156  1.00  0.00          O   \nATOM    921  CG  HIS A 120      -4.217   1.973  10.089  1.00  0.00          C   \nATOM    922  CD2 HIS A 120      -4.107   1.532   8.813  1.00  0.00          C   \nATOM    923  ND1 HIS A 120      -5.174   1.183  10.689  1.00  0.00          N   \nATOM    924  CE1 HIS A 120      -5.622   0.301   9.811  1.00  0.00          C   \nATOM    925  NE2 HIS A 120      -4.990   0.491   8.666  1.00  0.00          N   \nATOM    926  N   ASP A 121      -3.704   5.475   9.017  1.00  0.00          N   \nATOM    927  CA  ASP A 121      -3.873   6.009   7.669  1.00  0.00          C   \nATOM    928  C   ASP A 121      -3.838   4.892   6.628  1.00  0.00          C   \nATOM    929  CB  ASP A 121      -2.792   7.047   7.363  1.00  0.00          C   \nATOM    930  O   ASP A 121      -3.053   3.949   6.747  1.00  0.00          O   \nATOM    931  CG  ASP A 121      -2.917   8.301   8.210  1.00  0.00          C   \nATOM    932  OD1 ASP A 121      -1.936   9.069   8.312  1.00  0.00          O   \nATOM    933  OD2 ASP A 121      -4.006   8.521   8.784  1.00  0.00          O   \nATOM    934  N   VAL A 122      -4.829   4.935   5.875  1.00  0.00          N   \nATOM    935  CA  VAL A 122      -4.775   4.123   4.663  1.00  0.00          C   \nATOM    936  C   VAL A 122      -4.276   4.971   3.495  1.00  0.00          C   \nATOM    937  CB  VAL A 122      -6.154   3.511   4.328  1.00  0.00          C   \nATOM    938  O   VAL A 122      -4.857   6.013   3.184  1.00  0.00          O   \nATOM    939  CG1 VAL A 122      -6.063   2.625   3.087  1.00  0.00          C   \nATOM    940  CG2 VAL A 122      -6.688   2.717   5.518  1.00  0.00          C   \nATOM    941  N   CYS A 123      -3.142   4.531   3.102  1.00  0.00          N   \nATOM    942  CA  CYS A 123      -2.472   5.318   2.073  1.00  0.00          C   \nATOM    943  C   CYS A 123      -2.628   4.669   0.702  1.00  0.00          C   \nATOM    944  CB  CYS A 123      -0.988   5.481   2.403  1.00  0.00          C   \nATOM    945  O   CYS A 123      -2.671   3.443   0.593  1.00  0.00          O   \nATOM    946  SG  CYS A 123      -0.681   6.285   3.991  1.00  0.00          S   \nATOM    947  N   GLY A 124      -2.924   5.462  -0.260  1.00  0.00          N   \nATOM    948  CA  GLY A 124      -2.940   5.028  -1.648  1.00  0.00          C   \nATOM    949  C   GLY A 124      -2.699   6.159  -2.630  1.00  0.00          C   \nATOM    950  O   GLY A 124      -2.463   7.299  -2.225  1.00  0.00          O   \nATOM    951  N   CYS A 125      -2.378   5.820  -3.813  1.00  0.00          N   \nATOM    952  CA  CYS A 125      -2.283   6.770  -4.916  1.00  0.00          C   \nATOM    953  C   CYS A 125      -3.667   7.160  -5.421  1.00  0.00          C   \nATOM    954  CB  CYS A 125      -1.458   6.183  -6.061  1.00  0.00          C   \nATOM    955  O   CYS A 125      -4.425   6.307  -5.886  1.00  0.00          O   \nATOM    956  SG  CYS A 125       0.275   5.900  -5.639  1.00  0.00          S   \nATOM    957  N   GLU A 126      -4.004   8.323  -5.203  1.00  0.00          N   \nATOM    958  CA  GLU A 126      -5.332   8.779  -5.604  1.00  0.00          C   \nATOM    959  C   GLU A 126      -5.243   9.988  -6.530  1.00  0.00          C   \nATOM    960  CB  GLU A 126      -6.177   9.119  -4.374  1.00  0.00          C   \nATOM    961  O   GLU A 126      -5.752  11.064  -6.206  1.00  0.00          O   \nATOM    962  CG  GLU A 126      -6.467   7.924  -3.478  1.00  0.00          C   \nATOM    963  CD  GLU A 126      -7.488   6.964  -4.068  1.00  0.00          C   \nATOM    964  OE1 GLU A 126      -8.228   7.361  -4.997  1.00  0.00          O   \nATOM    965  OE2 GLU A 126      -7.550   5.807  -3.597  1.00  0.00          O   \nATOM    966  N   CYS A 127      -4.822   9.841  -7.699  1.00  0.00          N   \nATOM    967  CA  CYS A 127      -4.615  10.948  -8.626  1.00  0.00          C   \nATOM    968  C   CYS A 127      -5.940  11.598  -9.005  1.00  0.00          C   \nATOM    969  CB  CYS A 127      -3.895  10.466  -9.885  1.00  0.00          C   \nATOM    970  O   CYS A 127      -5.987  12.790  -9.312  1.00  0.00          O   \nATOM    971  SG  CYS A 127      -2.217   9.868  -9.581  1.00  0.00          S   \nATOM    972  N   SER A 128      -6.846  10.833  -8.955  1.00  0.00          N   \nATOM    973  CA  SER A 128      -8.150  11.305  -9.408  1.00  0.00          C   \nATOM    974  C   SER A 128      -8.755  12.293  -8.417  1.00  0.00          C   \nATOM    975  CB  SER A 128      -9.104  10.128  -9.616  1.00  0.00          C   \nATOM    976  O   SER A 128      -9.642  13.073  -8.772  1.00  0.00          O   \nATOM    977  OG  SER A 128      -9.249   9.381  -8.420  1.00  0.00          O   \nATOM    978  N   LYS A 129      -8.286  12.254  -7.213  1.00  0.00          N   \nATOM    979  CA  LYS A 129      -8.887  13.076  -6.166  1.00  0.00          C   \nATOM    980  C   LYS A 129      -8.020  14.294  -5.859  1.00  0.00          C   \nATOM    981  CB  LYS A 129      -9.104  12.253  -4.896  1.00  0.00          C   \nATOM    982  O   LYS A 129      -8.420  15.169  -5.089  1.00  0.00          O   \nATOM    983  CG  LYS A 129     -10.151  11.158  -5.039  1.00  0.00          C   \nATOM    984  CD  LYS A 129     -10.395  10.441  -3.717  1.00  0.00          C   \nATOM    985  CE  LYS A 129     -11.490   9.392  -3.843  1.00  0.00          C   \nATOM    986  NZ  LYS A 129     -11.820   8.774  -2.524  1.00  0.00          N   \nATOM    987  N   LEU A 130      -6.820  14.391  -6.394  1.00  0.00          N   \nATOM    988  CA  LEU A 130      -5.922  15.506  -6.110  1.00  0.00          C   \nATOM    989  C   LEU A 130      -6.255  16.708  -6.987  1.00  0.00          C   \nATOM    990  CB  LEU A 130      -4.465  15.089  -6.326  1.00  0.00          C   \nATOM    991  O   LEU A 130      -6.713  16.548  -8.120  1.00  0.00          O   \nATOM    992  CG  LEU A 130      -3.879  14.117  -5.300  1.00  0.00          C   \nATOM    993  CD1 LEU A 130      -2.476  13.689  -5.718  1.00  0.00          C   \nATOM    994  CD2 LEU A 130      -3.859  14.751  -3.913  1.00  0.00          C   \nATOM    995  N   PRO A 131      -6.218  17.878  -6.321  1.00  0.00          N   \nATOM    996  CA  PRO A 131      -6.403  19.088  -7.125  1.00  0.00          C   \nATOM    997  C   PRO A 131      -5.423  19.176  -8.293  1.00  0.00          C   \nATOM    998  CB  PRO A 131      -6.159  20.219  -6.123  1.00  0.00          C   \nATOM    999  O   PRO A 131      -4.287  18.706  -8.188  1.00  0.00          O   \nATOM   1000  CG  PRO A 131      -5.279  19.617  -5.075  1.00  0.00          C   \nATOM   1001  CD  PRO A 131      -5.586  18.150  -4.979  1.00  0.00          C   \nATOM   1002  N   CYS A 132      -5.915  19.530  -9.527  1.00  0.00          N   \nATOM   1003  CA  CYS A 132      -5.087  19.711 -10.714  1.00  0.00          C   \nATOM   1004  C   CYS A 132      -4.132  20.886 -10.540  1.00  0.00          C   \nATOM   1005  CB  CYS A 132      -5.960  19.930 -11.949  1.00  0.00          C   \nATOM   1006  O   CYS A 132      -4.531  22.042 -10.690  1.00  0.00          O   \nATOM   1007  SG  CYS A 132      -6.896  18.468 -12.448  1.00  0.00          S   \nATOM   1008  N   ASN A 133      -3.080  20.705  -9.927  1.00  0.00          N   \nATOM   1009  CA  ASN A 133      -2.027  21.708  -9.810  1.00  0.00          C   \nATOM   1010  C   ASN A 133      -0.764  21.283 -10.553  1.00  0.00          C   \nATOM   1011  CB  ASN A 133      -1.710  21.986  -8.339  1.00  0.00          C   \nATOM   1012  O   ASN A 133      -0.740  20.230 -11.194  1.00  0.00          O   \nATOM   1013  CG  ASN A 133      -1.260  20.744  -7.595  1.00  0.00          C   \nATOM   1014  ND2 ASN A 133      -1.758  20.570  -6.376  1.00  0.00          N   \nATOM   1015  OD1 ASN A 133      -0.470  19.949  -8.110  1.00  0.00          O   \nATOM   1016  N   ASP A 134       0.201  22.148 -10.651  1.00  0.00          N   \nATOM   1017  CA  ASP A 134       1.408  21.962 -11.451  1.00  0.00          C   \nATOM   1018  C   ASP A 134       2.162  20.705 -11.023  1.00  0.00          C   \nATOM   1019  CB  ASP A 134       2.320  23.185 -11.338  1.00  0.00          C   \nATOM   1020  O   ASP A 134       2.999  20.192 -11.768  1.00  0.00          O   \nATOM   1021  CG  ASP A 134       1.789  24.392 -12.091  1.00  0.00          C   \nATOM   1022  OD1 ASP A 134       2.250  25.525 -11.832  1.00  0.00          O   \nATOM   1023  OD2 ASP A 134       0.898  24.210 -12.950  1.00  0.00          O   \nATOM   1024  N   GLU A 135       1.732  20.132  -9.899  1.00  0.00          N   \nATOM   1025  CA  GLU A 135       2.429  18.946  -9.410  1.00  0.00          C   \nATOM   1026  C   GLU A 135       1.714  17.669  -9.840  1.00  0.00          C   \nATOM   1027  CB  GLU A 135       2.559  18.988  -7.885  1.00  0.00          C   \nATOM   1028  O   GLU A 135       2.282  16.577  -9.766  1.00  0.00          O   \nATOM   1029  CG  GLU A 135       3.439  20.120  -7.374  1.00  0.00          C   \nATOM   1030  CD  GLU A 135       3.561  20.146  -5.859  1.00  0.00          C   \nATOM   1031  OE1 GLU A 135       2.885  19.340  -5.181  1.00  0.00          O   \nATOM   1032  OE2 GLU A 135       4.339  20.981  -5.346  1.00  0.00          O   \nATOM   1033  N   HIS A 136       0.480  17.885 -10.293  1.00  0.00          N   \nATOM   1034  CA  HIS A 136      -0.314  16.733 -10.704  1.00  0.00          C   \nATOM   1035  C   HIS A 136       0.053  16.287 -12.116  1.00  0.00          C   \nATOM   1036  CB  HIS A 136      -1.807  17.057 -10.628  1.00  0.00          C   \nATOM   1037  O   HIS A 136       0.114  17.107 -13.035  1.00  0.00          O   \nATOM   1038  CG  HIS A 136      -2.685  15.846 -10.645  1.00  0.00          C   \nATOM   1039  CD2 HIS A 136      -3.469  15.303  -9.684  1.00  0.00          C   \nATOM   1040  ND1 HIS A 136      -2.822  15.042 -11.756  1.00  0.00          N   \nATOM   1041  CE1 HIS A 136      -3.655  14.054 -11.476  1.00  0.00          C   \nATOM   1042  NE2 HIS A 136      -4.062  14.189 -10.225  1.00  0.00          N   \nATOM   1043  N   PRO A 137       0.226  15.184 -12.322  1.00  0.00          N   \nATOM   1044  CA  PRO A 137       0.690  14.688 -13.619  1.00  0.00          C   \nATOM   1045  C   PRO A 137      -0.331  14.908 -14.734  1.00  0.00          C   \nATOM   1046  CB  PRO A 137       0.910  13.194 -13.368  1.00  0.00          C   \nATOM   1047  O   PRO A 137       0.032  14.929 -15.913  1.00  0.00          O   \nATOM   1048  CG  PRO A 137       0.170  12.907 -12.101  1.00  0.00          C   \nATOM   1049  CD  PRO A 137       0.003  14.193 -11.344  1.00  0.00          C   \nATOM   1050  N   CYS A 138      -1.650  15.096 -14.399  1.00  0.00          N   \nATOM   1051  CA  CYS A 138      -2.702  15.293 -15.390  1.00  0.00          C   \nATOM   1052  C   CYS A 138      -2.947  16.776 -15.639  1.00  0.00          C   \nATOM   1053  CB  CYS A 138      -3.998  14.621 -14.937  1.00  0.00          C   \nATOM   1054  O   CYS A 138      -3.870  17.144 -16.368  1.00  0.00          O   \nATOM   1055  SG  CYS A 138      -3.887  12.822 -14.830  1.00  0.00          S   \nATOM   1056  N   TYR A 139      -2.050  17.530 -14.923  1.00  0.00          N   \nATOM   1057  CA  TYR A 139      -2.147  18.977 -15.082  1.00  0.00          C   \nATOM   1058  C   TYR A 139      -1.580  19.417 -16.427  1.00  0.00          C   \nATOM   1059  CB  TYR A 139      -1.411  19.693 -13.946  1.00  0.00          C   \nATOM   1060  O   TYR A 139      -0.470  19.029 -16.796  1.00  0.00          O   \nATOM   1061  CG  TYR A 139      -1.400  21.197 -14.083  1.00  0.00          C   \nATOM   1062  CD1 TYR A 139      -0.320  21.854 -14.668  1.00  0.00          C   \nATOM   1063  CD2 TYR A 139      -2.468  21.962 -13.627  1.00  0.00          C   \nATOM   1064  CE1 TYR A 139      -0.305  23.239 -14.795  1.00  0.00          C   \nATOM   1065  CE2 TYR A 139      -2.463  23.348 -13.748  1.00  0.00          C   \nATOM   1066  OH  TYR A 139      -1.369  25.348 -14.456  1.00  0.00          O   \nATOM   1067  CZ  TYR A 139      -1.379  23.976 -14.333  1.00  0.00          C   \nATOM   1068  N   ARG A 140      -2.489  20.100 -17.284  1.00  0.00          N   \nATOM   1069  CA  ARG A 140      -2.036  20.668 -18.550  1.00  0.00          C   \nATOM   1070  C   ARG A 140      -2.355  22.157 -18.626  1.00  0.00          C   \nATOM   1071  CB  ARG A 140      -2.678  19.934 -19.729  1.00  0.00          C   \nATOM   1072  O   ARG A 140      -3.435  22.589 -18.217  1.00  0.00          O   \nATOM   1073  CG  ARG A 140      -2.260  18.477 -19.849  1.00  0.00          C   \nATOM   1074  CD  ARG A 140      -2.856  17.819 -21.086  1.00  0.00          C   \nATOM   1075  NE  ARG A 140      -2.303  16.486 -21.307  1.00  0.00          N   \nATOM   1076  NH1 ARG A 140      -1.510  16.942 -23.429  1.00  0.00          N   \nATOM   1077  NH2 ARG A 140      -1.212  14.863 -22.510  1.00  0.00          N   \nATOM   1078  CZ  ARG A 140      -1.676  16.100 -22.415  1.00  0.00          C   \nATOM   1079  N   LYS A 141      -1.270  22.911 -18.875  1.00  0.00          N   \nATOM   1080  CA  LYS A 141      -1.432  24.343 -19.105  1.00  0.00          C   \nATOM   1081  C   LYS A 141      -1.210  24.693 -20.574  1.00  0.00          C   \nATOM   1082  CB  LYS A 141      -0.468  25.141 -18.226  1.00  0.00          C   \nATOM   1083  O   LYS A 141      -0.111  24.513 -21.101  1.00  0.00          O   \nATOM   1084  CG  LYS A 141      -0.749  26.636 -18.196  1.00  0.00          C   \nATOM   1085  CD  LYS A 141       0.167  27.359 -17.217  1.00  0.00          C   \nATOM   1086  CE  LYS A 141      -0.124  28.853 -17.175  1.00  0.00          C   \nATOM   1087  NZ  LYS A 141       0.783  29.568 -16.230  1.00  0.00          N   \nATOM   1088  N   GLU A 142      -2.285  24.849 -21.311  1.00  0.00          N   \nATOM   1089  CA  GLU A 142      -2.217  25.247 -22.713  1.00  0.00          C   \nATOM   1090  C   GLU A 142      -2.920  26.583 -22.942  1.00  0.00          C   \nATOM   1091  CB  GLU A 142      -2.832  24.169 -23.609  1.00  0.00          C   \nATOM   1092  O   GLU A 142      -4.113  26.718 -22.665  1.00  0.00          O   \nATOM   1093  CG  GLU A 142      -2.588  24.391 -25.095  1.00  0.00          C   \nATOM   1094  CD  GLU A 142      -3.160  23.287 -25.969  1.00  0.00          C   \nATOM   1095  OE1 GLU A 142      -3.890  22.415 -25.445  1.00  0.00          O   \nATOM   1096  OE2 GLU A 142      -2.875  23.292 -27.187  1.00  0.00          O   \nATOM   1097  N   GLY A 143      -2.182  27.579 -23.469  1.00  0.00          N   \nATOM   1098  CA  GLY A 143      -2.758  28.882 -23.764  1.00  0.00          C   \nATOM   1099  C   GLY A 143      -3.342  29.566 -22.543  1.00  0.00          C   \nATOM   1100  O   GLY A 143      -4.385  30.217 -22.629  1.00  0.00          O   \nATOM   1101  N   GLY A 144      -2.777  29.290 -21.354  1.00  0.00          N   \nATOM   1102  CA  GLY A 144      -3.245  29.947 -20.144  1.00  0.00          C   \nATOM   1103  C   GLY A 144      -4.395  29.217 -19.476  1.00  0.00          C   \nATOM   1104  O   GLY A 144      -4.892  29.651 -18.435  1.00  0.00          O   \nATOM   1105  N   VAL A 145      -4.936  28.140 -20.164  1.00  0.00          N   \nATOM   1106  CA  VAL A 145      -6.039  27.365 -19.605  1.00  0.00          C   \nATOM   1107  C   VAL A 145      -5.504  26.079 -18.980  1.00  0.00          C   \nATOM   1108  CB  VAL A 145      -7.101  27.035 -20.678  1.00  0.00          C   \nATOM   1109  O   VAL A 145      -4.666  25.395 -19.573  1.00  0.00          O   \nATOM   1110  CG1 VAL A 145      -8.253  26.236 -20.071  1.00  0.00          C   \nATOM   1111  CG2 VAL A 145      -7.619  28.316 -21.328  1.00  0.00          C   \nATOM   1112  N   VAL A 146      -5.959  25.837 -17.763  1.00  0.00          N   \nATOM   1113  CA  VAL A 146      -5.574  24.626 -17.045  1.00  0.00          C   \nATOM   1114  C   VAL A 146      -6.593  23.521 -17.311  1.00  0.00          C   \nATOM   1115  CB  VAL A 146      -5.450  24.882 -15.526  1.00  0.00          C   \nATOM   1116  O   VAL A 146      -7.803  23.758 -17.264  1.00  0.00          O   \nATOM   1117  CG1 VAL A 146      -5.098  23.592 -14.788  1.00  0.00          C   \nATOM   1118  CG2 VAL A 146      -4.405  25.962 -15.251  1.00  0.00          C   \nATOM   1119  N   SER A 147      -6.150  22.494 -17.818  1.00  0.00          N   \nATOM   1120  CA  SER A 147      -7.007  21.324 -17.979  1.00  0.00          C   \nATOM   1121  C   SER A 147      -6.522  20.161 -17.121  1.00  0.00          C   \nATOM   1122  CB  SER A 147      -7.062  20.898 -19.447  1.00  0.00          C   \nATOM   1123  O   SER A 147      -5.316  19.946 -16.982  1.00  0.00          O   \nATOM   1124  OG  SER A 147      -7.912  19.776 -19.614  1.00  0.00          O   \nATOM   1125  N   CYS A 148      -7.409  19.637 -16.271  1.00  0.00          N   \nATOM   1126  CA  CYS A 148      -7.135  18.448 -15.471  1.00  0.00          C   \nATOM   1127  C   CYS A 148      -7.876  17.237 -16.024  1.00  0.00          C   \nATOM   1128  CB  CYS A 148      -7.534  18.680 -14.014  1.00  0.00          C   \nATOM   1129  O   CYS A 148      -8.941  16.873 -15.523  1.00  0.00          O   \nATOM   1130  SG  CYS A 148      -6.884  17.438 -12.875  1.00  0.00          S   \nATOM   1131  N   ASP A 149      -7.699  16.869 -17.159  1.00  0.00          N   \nATOM   1132  CA  ASP A 149      -8.393  15.760 -17.806  1.00  0.00          C   \nATOM   1133  C   ASP A 149      -7.445  14.590 -18.056  1.00  0.00          C   \nATOM   1134  CB  ASP A 149      -9.023  16.217 -19.124  1.00  0.00          C   \nATOM   1135  O   ASP A 149      -6.548  14.679 -18.896  1.00  0.00          O   \nATOM   1136  CG  ASP A 149      -9.976  15.192 -19.713  1.00  0.00          C   \nATOM   1137  OD1 ASP A 149     -10.762  15.540 -20.620  1.00  0.00          O   \nATOM   1138  OD2 ASP A 149      -9.941  14.025 -19.265  1.00  0.00          O   \nATOM   1139  N   CYS A 150      -7.567  13.519 -17.222  1.00  0.00          N   \nATOM   1140  CA  CYS A 150      -6.727  12.334 -17.354  1.00  0.00          C   \nATOM   1141  C   CYS A 150      -7.054  11.573 -18.634  1.00  0.00          C   \nATOM   1142  CB  CYS A 150      -6.900  11.416 -16.145  1.00  0.00          C   \nATOM   1143  O   CYS A 150      -6.244  10.777 -19.112  1.00  0.00          O   \nATOM   1144  SG  CYS A 150      -6.406  12.171 -14.581  1.00  0.00          S   \nATOM   1145  N   LYS A 151      -8.188  11.835 -19.161  1.00  0.00          N   \nATOM   1146  CA  LYS A 151      -8.679  11.063 -20.298  1.00  0.00          C   \nATOM   1147  C   LYS A 151      -8.050  11.543 -21.603  1.00  0.00          C   \nATOM   1148  CB  LYS A 151     -10.204  11.151 -20.388  1.00  0.00          C   \nATOM   1149  O   LYS A 151      -7.990  10.796 -22.581  1.00  0.00          O   \nATOM   1150  CG  LYS A 151     -10.931  10.505 -19.219  1.00  0.00          C   \nATOM   1151  CD  LYS A 151     -12.443  10.620 -19.368  1.00  0.00          C   \nATOM   1152  CE  LYS A 151     -13.172   9.972 -18.199  1.00  0.00          C   \nATOM   1153  NZ  LYS A 151     -14.653  10.132 -18.313  1.00  0.00          N   \nATOM   1154  N   THR A 152      -7.674  12.782 -21.597  1.00  0.00          N   \nATOM   1155  CA  THR A 152      -7.207  13.367 -22.850  1.00  0.00          C   \nATOM   1156  C   THR A 152      -5.688  13.279 -22.954  1.00  0.00          C   \nATOM   1157  CB  THR A 152      -7.649  14.836 -22.979  1.00  0.00          C   \nATOM   1158  O   THR A 152      -5.115  13.562 -24.008  1.00  0.00          O   \nATOM   1159  CG2 THR A 152      -9.168  14.950 -23.052  1.00  0.00          C   \nATOM   1160  OG1 THR A 152      -7.180  15.572 -21.843  1.00  0.00          O   \nATOM   1161  N   ILE A 153      -5.064  12.924 -21.810  1.00  0.00          N   \nATOM   1162  CA  ILE A 153      -3.608  12.834 -21.820  1.00  0.00          C   \nATOM   1163  C   ILE A 153      -3.181  11.435 -22.259  1.00  0.00          C   \nATOM   1164  CB  ILE A 153      -3.011  13.167 -20.435  1.00  0.00          C   \nATOM   1165  O   ILE A 153      -3.826  10.444 -21.909  1.00  0.00          O   \nATOM   1166  CG1 ILE A 153      -3.390  14.593 -20.018  1.00  0.00          C   \nATOM   1167  CG2 ILE A 153      -1.490  12.986 -20.444  1.00  0.00          C   \nATOM   1168  CD1 ILE A 153      -2.744  15.679 -20.868  1.00  0.00          C   \nATOM   1169  N   THR A 154      -2.270  11.363 -23.110  1.00  0.00          N   \nATOM   1170  CA  THR A 154      -1.713  10.090 -23.553  1.00  0.00          C   \nATOM   1171  C   THR A 154      -1.160   9.301 -22.370  1.00  0.00          C   \nATOM   1172  CB  THR A 154      -0.603  10.299 -24.599  1.00  0.00          C   \nATOM   1173  O   THR A 154      -0.336   9.812 -21.607  1.00  0.00          O   \nATOM   1174  CG2 THR A 154      -0.102   8.965 -25.144  1.00  0.00          C   \nATOM   1175  OG1 THR A 154      -1.117  11.082 -25.683  1.00  0.00          O   \nATOM   1176  N   CYS A 155      -1.859   8.148 -22.092  1.00  0.00          N   \nATOM   1177  CA  CYS A 155      -1.409   7.282 -21.008  1.00  0.00          C   \nATOM   1178  C   CYS A 155      -0.060   6.653 -21.338  1.00  0.00          C   \nATOM   1179  CB  CYS A 155      -2.439   6.187 -20.734  1.00  0.00          C   \nATOM   1180  O   CYS A 155       0.086   5.991 -22.367  1.00  0.00          O   \nATOM   1181  SG  CYS A 155      -4.010   6.809 -20.095  1.00  0.00          S   \nATOM   1182  N   ASN A 156       0.893   7.176 -20.743  1.00  0.00          N   \nATOM   1183  CA  ASN A 156       2.201   6.536 -20.836  1.00  0.00          C   \nATOM   1184  C   ASN A 156       2.611   5.904 -19.509  1.00  0.00          C   \nATOM   1185  CB  ASN A 156       3.259   7.541 -21.294  1.00  0.00          C   \nATOM   1186  O   ASN A 156       1.841   5.916 -18.546  1.00  0.00          O   \nATOM   1187  CG  ASN A 156       3.393   8.721 -20.351  1.00  0.00          C   \nATOM   1188  ND2 ASN A 156       3.554   9.913 -20.912  1.00  0.00          N   \nATOM   1189  OD1 ASN A 156       3.352   8.561 -19.128  1.00  0.00          O   \nATOM   1190  N   GLU A 157       3.624   5.165 -19.538  1.00  0.00          N   \nATOM   1191  CA  GLU A 157       4.078   4.402 -18.379  1.00  0.00          C   \nATOM   1192  C   GLU A 157       4.196   5.291 -17.145  1.00  0.00          C   \nATOM   1193  CB  GLU A 157       5.421   3.727 -18.672  1.00  0.00          C   \nATOM   1194  O   GLU A 157       4.169   4.799 -16.014  1.00  0.00          O   \nATOM   1195  CG  GLU A 157       5.336   2.611 -19.703  1.00  0.00          C   \nATOM   1196  CD  GLU A 157       6.670   1.925 -19.955  1.00  0.00          C   \nATOM   1197  OE1 GLU A 157       7.660   2.250 -19.261  1.00  0.00          O   \nATOM   1198  OE2 GLU A 157       6.725   1.058 -20.855  1.00  0.00          O   \nATOM   1199  N   ASP A 158       4.203   6.614 -17.357  1.00  0.00          N   \nATOM   1200  CA  ASP A 158       4.344   7.540 -16.237  1.00  0.00          C   \nATOM   1201  C   ASP A 158       2.979   8.001 -15.731  1.00  0.00          C   \nATOM   1202  CB  ASP A 158       5.190   8.748 -16.643  1.00  0.00          C   \nATOM   1203  O   ASP A 158       2.882   8.629 -14.675  1.00  0.00          O   \nATOM   1204  CG  ASP A 158       6.638   8.390 -16.927  1.00  0.00          C   \nATOM   1205  OD1 ASP A 158       7.251   8.999 -17.830  1.00  0.00          O   \nATOM   1206  OD2 ASP A 158       7.169   7.487 -16.244  1.00  0.00          O   \nATOM   1207  N   HIS A 159       2.048   7.688 -16.589  1.00  0.00          N   \nATOM   1208  CA  HIS A 159       0.697   8.104 -16.230  1.00  0.00          C   \nATOM   1209  C   HIS A 159       0.098   7.180 -15.176  1.00  0.00          C   \nATOM   1210  CB  HIS A 159      -0.199   8.139 -17.469  1.00  0.00          C   \nATOM   1211  O   HIS A 159       0.148   5.956 -15.317  1.00  0.00          O   \nATOM   1212  CG  HIS A 159      -1.463   8.914 -17.273  1.00  0.00          C   \nATOM   1213  CD2 HIS A 159      -1.859  10.110 -17.769  1.00  0.00          C   \nATOM   1214  ND1 HIS A 159      -2.495   8.466 -16.477  1.00  0.00          N   \nATOM   1215  CE1 HIS A 159      -3.474   9.356 -16.493  1.00  0.00          C   \nATOM   1216  NE2 HIS A 159      -3.113  10.363 -17.270  1.00  0.00          N   \nATOM   1217  N   PRO A 160      -0.393   7.607 -14.171  1.00  0.00          N   \nATOM   1218  CA  PRO A 160      -0.882   6.789 -13.059  1.00  0.00          C   \nATOM   1219  C   PRO A 160      -2.041   5.880 -13.461  1.00  0.00          C   \nATOM   1220  CB  PRO A 160      -1.334   7.828 -12.030  1.00  0.00          C   \nATOM   1221  O   PRO A 160      -2.326   4.896 -12.773  1.00  0.00          O   \nATOM   1222  CG  PRO A 160      -1.619   9.058 -12.828  1.00  0.00          C   \nATOM   1223  CD  PRO A 160      -0.678   9.096 -13.998  1.00  0.00          C   \nATOM   1224  N   CYS A 161      -2.737   6.193 -14.475  1.00  0.00          N   \nATOM   1225  CA  CYS A 161      -3.885   5.408 -14.913  1.00  0.00          C   \nATOM   1226  C   CYS A 161      -3.470   4.357 -15.936  1.00  0.00          C   \nATOM   1227  CB  CYS A 161      -4.960   6.317 -15.509  1.00  0.00          C   \nATOM   1228  O   CYS A 161      -4.312   3.621 -16.453  1.00  0.00          O   \nATOM   1229  SG  CYS A 161      -5.656   7.493 -14.328  1.00  0.00          S   \nATOM   1230  N   TYR A 162      -2.132   4.465 -16.183  1.00  0.00          N   \nATOM   1231  CA  TYR A 162      -1.573   3.516 -17.140  1.00  0.00          C   \nATOM   1232  C   TYR A 162      -1.452   2.127 -16.525  1.00  0.00          C   \nATOM   1233  CB  TYR A 162      -0.201   3.992 -17.629  1.00  0.00          C   \nATOM   1234  O   TYR A 162      -0.908   1.972 -15.429  1.00  0.00          O   \nATOM   1235  CG  TYR A 162       0.469   3.033 -18.583  1.00  0.00          C   \nATOM   1236  CD1 TYR A 162       1.424   2.124 -18.131  1.00  0.00          C   \nATOM   1237  CD2 TYR A 162       0.151   3.035 -19.936  1.00  0.00          C   \nATOM   1238  CE1 TYR A 162       2.046   1.240 -19.007  1.00  0.00          C   \nATOM   1239  CE2 TYR A 162       0.766   2.155 -20.821  1.00  0.00          C   \nATOM   1240  OH  TYR A 162       2.323   0.390 -21.219  1.00  0.00          O   \nATOM   1241  CZ  TYR A 162       1.710   1.263 -20.348  1.00  0.00          C   \nATOM   1242  N   HIS A 163      -2.235   1.147 -17.118  1.00  0.00          N   \nATOM   1243  CA  HIS A 163      -2.129  -0.243 -16.689  1.00  0.00          C   \nATOM   1244  C   HIS A 163      -1.553  -1.119 -17.797  1.00  0.00          C   \nATOM   1245  CB  HIS A 163      -3.496  -0.776 -16.256  1.00  0.00          C   \nATOM   1246  O   HIS A 163      -1.953  -1.002 -18.957  1.00  0.00          O   \nATOM   1247  CG  HIS A 163      -4.058  -0.081 -15.057  1.00  0.00          C   \nATOM   1248  CD2 HIS A 163      -5.018   0.867 -14.948  1.00  0.00          C   \nATOM   1249  ND1 HIS A 163      -3.625  -0.342 -13.775  1.00  0.00          N   \nATOM   1250  CE1 HIS A 163      -4.297   0.419 -12.926  1.00  0.00          C   \nATOM   1251  NE2 HIS A 163      -5.148   1.162 -13.613  1.00  0.00          N   \nATOM   1252  N   SER A 164      -0.416  -1.652 -17.433  1.00  0.00          N   \nATOM   1253  CA  SER A 164       0.122  -2.646 -18.356  1.00  0.00          C   \nATOM   1254  C   SER A 164      -0.175  -4.063 -17.877  1.00  0.00          C   \nATOM   1255  CB  SER A 164       1.630  -2.462 -18.523  1.00  0.00          C   \nATOM   1256  O   SER A 164      -0.055  -4.360 -16.687  1.00  0.00          O   \nATOM   1257  OG  SER A 164       2.304  -2.686 -17.297  1.00  0.00          O   \nATOM   1258  N   TYR A 165      -0.841  -4.799 -18.656  1.00  0.00          N   \nATOM   1259  CA  TYR A 165      -1.123  -6.182 -18.287  1.00  0.00          C   \nATOM   1260  C   TYR A 165      -0.783  -7.132 -19.429  1.00  0.00          C   \nATOM   1261  CB  TYR A 165      -2.594  -6.345 -17.894  1.00  0.00          C   \nATOM   1262  O   TYR A 165      -0.643  -6.705 -20.578  1.00  0.00          O   \nATOM   1263  CG  TYR A 165      -3.559  -6.039 -19.013  1.00  0.00          C   \nATOM   1264  CD1 TYR A 165      -3.953  -4.730 -19.282  1.00  0.00          C   \nATOM   1265  CD2 TYR A 165      -4.080  -7.058 -19.804  1.00  0.00          C   \nATOM   1266  CE1 TYR A 165      -4.843  -4.444 -20.312  1.00  0.00          C   \nATOM   1267  CE2 TYR A 165      -4.971  -6.783 -20.836  1.00  0.00          C   \nATOM   1268  OH  TYR A 165      -6.228  -5.197 -22.103  1.00  0.00          O   \nATOM   1269  CZ  TYR A 165      -5.346  -5.475 -21.082  1.00  0.00          C   \nATOM   1270  N   GLU A 166      -0.437  -8.271 -19.075  1.00  0.00          N   \nATOM   1271  CA  GLU A 166      -0.092  -9.311 -20.039  1.00  0.00          C   \nATOM   1272  C   GLU A 166      -1.292 -10.203 -20.342  1.00  0.00          C   \nATOM   1273  CB  GLU A 166       1.075 -10.158 -19.523  1.00  0.00          C   \nATOM   1274  O   GLU A 166      -1.951 -10.699 -19.426  1.00  0.00          O   \nATOM   1275  CG  GLU A 166       1.667 -11.091 -20.569  1.00  0.00          C   \nATOM   1276  CD  GLU A 166       2.944 -11.776 -20.108  1.00  0.00          C   \nATOM   1277  OE1 GLU A 166       3.581 -11.289 -19.146  1.00  0.00          O   \nATOM   1278  OE2 GLU A 166       3.310 -12.808 -20.713  1.00  0.00          O   \nATOM   1279  N   GLU A 167      -1.701 -10.268 -21.599  1.00  0.00          N   \nATOM   1280  CA  GLU A 167      -2.770 -11.135 -22.087  1.00  0.00          C   \nATOM   1281  C   GLU A 167      -2.310 -11.956 -23.288  1.00  0.00          C   \nATOM   1282  CB  GLU A 167      -4.006 -10.310 -22.455  1.00  0.00          C   \nATOM   1283  O   GLU A 167      -1.837 -11.400 -24.282  1.00  0.00          O   \nATOM   1284  CG  GLU A 167      -5.232 -11.150 -22.780  1.00  0.00          C   \nATOM   1285  CD  GLU A 167      -6.476 -10.318 -23.048  1.00  0.00          C   \nATOM   1286  OE1 GLU A 167      -6.367  -9.075 -23.139  1.00  0.00          O   \nATOM   1287  OE2 GLU A 167      -7.570 -10.915 -23.165  1.00  0.00          O   \nATOM   1288  N   ASP A 168      -2.308 -13.235 -23.226  1.00  0.00          N   \nATOM   1289  CA  ASP A 168      -1.919 -14.168 -24.278  1.00  0.00          C   \nATOM   1290  C   ASP A 168      -0.472 -13.938 -24.708  1.00  0.00          C   \nATOM   1291  CB  ASP A 168      -2.852 -14.039 -25.483  1.00  0.00          C   \nATOM   1292  O   ASP A 168      -0.162 -13.963 -25.901  1.00  0.00          O   \nATOM   1293  CG  ASP A 168      -4.284 -14.437 -25.170  1.00  0.00          C   \nATOM   1294  OD1 ASP A 168      -5.222 -13.831 -25.730  1.00  0.00          O   \nATOM   1295  OD2 ASP A 168      -4.475 -15.363 -24.352  1.00  0.00          O   \nATOM   1296  N   GLY A 169       0.378 -13.615 -23.661  1.00  0.00          N   \nATOM   1297  CA  GLY A 169       1.802 -13.483 -23.928  1.00  0.00          C   \nATOM   1298  C   GLY A 169       2.181 -12.123 -24.482  1.00  0.00          C   \nATOM   1299  O   GLY A 169       3.340 -11.889 -24.830  1.00  0.00          O   \nATOM   1300  N   VAL A 170       1.173 -11.220 -24.645  1.00  0.00          N   \nATOM   1301  CA  VAL A 170       1.451  -9.891 -25.180  1.00  0.00          C   \nATOM   1302  C   VAL A 170       1.131  -8.832 -24.128  1.00  0.00          C   \nATOM   1303  CB  VAL A 170       0.648  -9.620 -26.472  1.00  0.00          C   \nATOM   1304  O   VAL A 170       0.124  -8.932 -23.423  1.00  0.00          O   \nATOM   1305  CG1 VAL A 170       0.954  -8.226 -27.016  1.00  0.00          C   \nATOM   1306  CG2 VAL A 170       0.952 -10.686 -27.523  1.00  0.00          C   \nATOM   1307  N   THR A 171       2.053  -7.976 -23.977  1.00  0.00          N   \nATOM   1308  CA  THR A 171       1.846  -6.867 -23.053  1.00  0.00          C   \nATOM   1309  C   THR A 171       0.857  -5.859 -23.631  1.00  0.00          C   \nATOM   1310  CB  THR A 171       3.173  -6.158 -22.725  1.00  0.00          C   \nATOM   1311  O   THR A 171       1.042  -5.370 -24.747  1.00  0.00          O   \nATOM   1312  CG2 THR A 171       2.958  -5.020 -21.732  1.00  0.00          C   \nATOM   1313  OG1 THR A 171       4.087  -7.105 -22.158  1.00  0.00          O   \nATOM   1314  N   LYS A 172      -0.220  -5.669 -22.883  1.00  0.00          N   \nATOM   1315  CA  LYS A 172      -1.215  -4.669 -23.260  1.00  0.00          C   \nATOM   1316  C   LYS A 172      -1.232  -3.510 -22.267  1.00  0.00          C   \nATOM   1317  CB  LYS A 172      -2.604  -5.301 -23.351  1.00  0.00          C   \nATOM   1318  O   LYS A 172      -0.846  -3.673 -21.107  1.00  0.00          O   \nATOM   1319  CG  LYS A 172      -2.720  -6.393 -24.405  1.00  0.00          C   \nATOM   1320  CD  LYS A 172      -4.154  -6.886 -24.543  1.00  0.00          C   \nATOM   1321  CE  LYS A 172      -4.280  -7.941 -25.634  1.00  0.00          C   \nATOM   1322  NZ  LYS A 172      -5.700  -8.358 -25.841  1.00  0.00          N   \nATOM   1323  N   SER A 173      -1.325  -2.368 -22.806  1.00  0.00          N   \nATOM   1324  CA  SER A 173      -1.442  -1.178 -21.969  1.00  0.00          C   \nATOM   1325  C   SER A 173      -2.815  -0.530 -22.119  1.00  0.00          C   \nATOM   1326  CB  SER A 173      -0.350  -0.167 -22.320  1.00  0.00          C   \nATOM   1327  O   SER A 173      -3.418  -0.584 -23.193  1.00  0.00          O   \nATOM   1328  OG  SER A 173      -0.430   0.207 -23.684  1.00  0.00          O   \nATOM   1329  N   ASP A 174      -3.338  -0.380 -21.075  1.00  0.00          N   \nATOM   1330  CA  ASP A 174      -4.630   0.300 -21.062  1.00  0.00          C   \nATOM   1331  C   ASP A 174      -4.627   1.467 -20.077  1.00  0.00          C   \nATOM   1332  CB  ASP A 174      -5.749  -0.682 -20.712  1.00  0.00          C   \nATOM   1333  O   ASP A 174      -3.834   1.488 -19.134  1.00  0.00          O   \nATOM   1334  CG  ASP A 174      -7.118  -0.209 -21.168  1.00  0.00          C   \nATOM   1335  OD1 ASP A 174      -8.137  -0.811 -20.767  1.00  0.00          O   \nATOM   1336  OD2 ASP A 174      -7.178   0.774 -21.938  1.00  0.00          O   \nATOM   1337  N   CYS A 175      -5.254   2.474 -20.569  1.00  0.00          N   \nATOM   1338  CA  CYS A 175      -5.511   3.614 -19.696  1.00  0.00          C   \nATOM   1339  C   CYS A 175      -6.886   3.506 -19.049  1.00  0.00          C   \nATOM   1340  CB  CYS A 175      -5.407   4.922 -20.479  1.00  0.00          C   \nATOM   1341  O   CYS A 175      -7.906   3.530 -19.740  1.00  0.00          O   \nATOM   1342  SG  CYS A 175      -5.469   6.399 -19.441  1.00  0.00          S   \nATOM   1343  N   ASP A 176      -6.926   3.117 -17.897  1.00  0.00          N   \nATOM   1344  CA  ASP A 176      -8.216   2.947 -17.236  1.00  0.00          C   \nATOM   1345  C   ASP A 176      -8.579   4.181 -16.413  1.00  0.00          C   \nATOM   1346  CB  ASP A 176      -8.202   1.705 -16.343  1.00  0.00          C   \nATOM   1347  O   ASP A 176      -8.390   4.199 -15.195  1.00  0.00          O   \nATOM   1348  CG  ASP A 176      -9.574   1.352 -15.795  1.00  0.00          C   \nATOM   1349  OD1 ASP A 176      -9.681   0.413 -14.978  1.00  0.00          O   \nATOM   1350  OD2 ASP A 176     -10.557   2.018 -16.187  1.00  0.00          O   \nATOM   1351  N   CYS A 177      -8.999   5.207 -17.129  1.00  0.00          N   \nATOM   1352  CA  CYS A 177      -9.425   6.426 -16.450  1.00  0.00          C   \nATOM   1353  C   CYS A 177     -10.930   6.422 -16.214  1.00  0.00          C   \nATOM   1354  CB  CYS A 177      -9.030   7.658 -17.264  1.00  0.00          C   \nATOM   1355  O   CYS A 177     -11.489   7.406 -15.726  1.00  0.00          O   \nATOM   1356  SG  CYS A 177      -7.251   7.814 -17.535  1.00  0.00          S   \nATOM   1357  N   GLU A 178     -11.529   5.450 -16.815  1.00  0.00          N   \nATOM   1358  CA  GLU A 178     -12.986   5.385 -16.754  1.00  0.00          C   \nATOM   1359  C   GLU A 178     -13.473   5.263 -15.313  1.00  0.00          C   \nATOM   1360  CB  GLU A 178     -13.508   4.211 -17.586  1.00  0.00          C   \nATOM   1361  O   GLU A 178     -14.584   5.686 -14.990  1.00  0.00          O   \nATOM   1362  CG  GLU A 178     -13.379   4.417 -19.089  1.00  0.00          C   \nATOM   1363  CD  GLU A 178     -13.985   3.285 -19.903  1.00  0.00          C   \nATOM   1364  OE1 GLU A 178     -14.377   2.254 -19.312  1.00  0.00          O   \nATOM   1365  OE2 GLU A 178     -14.069   3.431 -21.143  1.00  0.00          O   \nATOM   1366  N   HIS A 179     -12.602   4.539 -14.596  1.00  0.00          N   \nATOM   1367  CA  HIS A 179     -13.083   4.370 -13.230  1.00  0.00          C   \nATOM   1368  C   HIS A 179     -12.913   5.654 -12.423  1.00  0.00          C   \nATOM   1369  CB  HIS A 179     -12.350   3.217 -12.542  1.00  0.00          C   \nATOM   1370  O   HIS A 179     -13.259   5.699 -11.241  1.00  0.00          O   \nATOM   1371  CG  HIS A 179     -12.672   1.874 -13.117  1.00  0.00          C   \nATOM   1372  CD2 HIS A 179     -11.913   1.007 -13.828  1.00  0.00          C   \nATOM   1373  ND1 HIS A 179     -13.911   1.286 -12.986  1.00  0.00          N   \nATOM   1374  CE1 HIS A 179     -13.900   0.111 -13.593  1.00  0.00          C   \nATOM   1375  NE2 HIS A 179     -12.700  -0.082 -14.113  1.00  0.00          N   \nATOM   1376  N   SER A 180     -12.761   6.762 -13.153  1.00  0.00          N   \nATOM   1377  CA  SER A 180     -12.625   8.074 -12.529  1.00  0.00          C   \nATOM   1378  C   SER A 180     -13.967   8.797 -12.465  1.00  0.00          C   \nATOM   1379  CB  SER A 180     -11.612   8.928 -13.291  1.00  0.00          C   \nATOM   1380  O   SER A 180     -14.740   8.767 -13.424  1.00  0.00          O   \nATOM   1381  OG  SER A 180     -12.114   9.284 -14.568  1.00  0.00          O   \nATOM   1382  N   PRO A 181     -14.719   8.802 -11.393  1.00  0.00          N   \nATOM   1383  CA  PRO A 181     -15.790   9.799 -11.316  1.00  0.00          C   \nATOM   1384  C   PRO A 181     -15.334  11.190 -11.748  1.00  0.00          C   \nATOM   1385  CB  PRO A 181     -16.178   9.786  -9.836  1.00  0.00          C   \nATOM   1386  O   PRO A 181     -14.337  11.704 -11.233  1.00  0.00          O   \nATOM   1387  CG  PRO A 181     -14.965   9.275  -9.127  1.00  0.00          C   \nATOM   1388  CD  PRO A 181     -14.184   8.416 -10.079  1.00  0.00          C   \nATOM   1389  N   GLY A 182     -15.240  11.453 -13.029  1.00  0.00          N   \nATOM   1390  CA  GLY A 182     -15.037  12.822 -13.476  1.00  0.00          C   \nATOM   1391  C   GLY A 182     -15.937  13.820 -12.770  1.00  0.00          C   \nATOM   1392  O   GLY A 182     -16.871  13.431 -12.066  1.00  0.00          O   \nATOM   1393  N   PRO A 183     -15.396  14.822 -12.165  1.00  0.00          N   \nATOM   1394  CA  PRO A 183     -16.219  15.888 -11.589  1.00  0.00          C   \nATOM   1395  C   PRO A 183     -17.636  15.913 -12.158  1.00  0.00          C   \nATOM   1396  CB  PRO A 183     -15.458  17.162 -11.964  1.00  0.00          C   \nATOM   1397  O   PRO A 183     -17.838  15.604 -13.335  1.00  0.00          O   \nATOM   1398  CG  PRO A 183     -14.695  16.803 -13.198  1.00  0.00          C   \nATOM   1399  CD  PRO A 183     -14.401  15.330 -13.164  1.00  0.00          C   \nATOM   1400  N   SER A 184     -18.521  15.085 -11.531  1.00  0.00          N   \nATOM   1401  CA  SER A 184     -19.918  15.360 -11.852  1.00  0.00          C   \nATOM   1402  C   SER A 184     -20.093  16.779 -12.385  1.00  0.00          C   \nATOM   1403  CB  SER A 184     -20.801  15.157 -10.620  1.00  0.00          C   \nATOM   1404  O   SER A 184     -19.543  17.730 -11.826  1.00  0.00          O   \nATOM   1405  OG  SER A 184     -20.375  15.985  -9.553  1.00  0.00          O   \nATOM   1406  N   GLU A 185     -19.658  16.958 -13.662  1.00  0.00          N   \nATOM   1407  CA  GLU A 185     -20.167  18.200 -14.237  1.00  0.00          C   \nATOM   1408  C   GLU A 185     -21.492  18.603 -13.597  1.00  0.00          C   \nATOM   1409  CB  GLU A 185     -20.336  18.061 -15.752  1.00  0.00          C   \nATOM   1410  O   GLU A 185     -22.450  17.827 -13.598  1.00  0.00          O   \nATOM   1411  CG  GLU A 185     -19.029  17.836 -16.499  1.00  0.00          C   \nATOM   1412  CD  GLU A 185     -18.110  19.046 -16.478  1.00  0.00          C   \nATOM   1413  OE1 GLU A 185     -18.546  20.132 -16.032  1.00  0.00          O   \nATOM   1414  OE2 GLU A 185     -16.944  18.908 -16.911  1.00  0.00          O   \nATOM   1415  N   HIS A 186     -21.419  18.961 -12.324  1.00  0.00          N   \nATOM   1416  CA  HIS A 186     -22.672  19.612 -11.958  1.00  0.00          C   \nATOM   1417  C   HIS A 186     -23.102  20.617 -13.022  1.00  0.00          C   \nATOM   1418  CB  HIS A 186     -22.539  20.307 -10.602  1.00  0.00          C   \nATOM   1419  O   HIS A 186     -22.311  21.471 -13.430  1.00  0.00          O   \nATOM   1420  CG  HIS A 186     -22.402  19.359  -9.453  1.00  0.00          C   \nATOM   1421  CD2 HIS A 186     -21.354  19.097  -8.637  1.00  0.00          C   \nATOM   1422  ND1 HIS A 186     -23.431  18.543  -9.034  1.00  0.00          N   \nATOM   1423  CE1 HIS A 186     -23.020  17.819  -8.007  1.00  0.00          C   \nATOM   1424  NE2 HIS A 186     -21.763  18.136  -7.746  1.00  0.00          N   \nATOM   1425  N   HIS A 187     -23.592  20.072 -14.139  1.00  0.00          N   \nATOM   1426  CA  HIS A 187     -24.308  20.983 -15.025  1.00  0.00          C   \nATOM   1427  C   HIS A 187     -24.996  22.092 -14.235  1.00  0.00          C   \nATOM   1428  CB  HIS A 187     -25.335  20.219 -15.862  1.00  0.00          C   \nATOM   1429  O   HIS A 187     -25.860  21.819 -13.399  1.00  0.00          O   \nATOM   1430  CG  HIS A 187     -24.723  19.267 -16.840  1.00  0.00          C   \nATOM   1431  CD2 HIS A 187     -24.703  17.913 -16.868  1.00  0.00          C   \nATOM   1432  ND1 HIS A 187     -24.026  19.687 -17.952  1.00  0.00          N   \nATOM   1433  CE1 HIS A 187     -23.603  18.630 -18.624  1.00  0.00          C   \nATOM   1434  NE2 HIS A 187     -24.000  17.541 -17.988  1.00  0.00          N   \nATOM   1435  N   HIS A 188     -24.187  22.915 -13.610  1.00  0.00          N   \nATOM   1436  CA  HIS A 188     -24.905  24.094 -13.140  1.00  0.00          C   \nATOM   1437  C   HIS A 188     -25.814  24.656 -14.228  1.00  0.00          C   \nATOM   1438  CB  HIS A 188     -23.923  25.168 -12.669  1.00  0.00          C   \nATOM   1439  O   HIS A 188     -25.380  24.849 -15.366  1.00  0.00          O   \nATOM   1440  CG  HIS A 188     -23.207  24.814 -11.404  1.00  0.00          C   \nATOM   1441  CD2 HIS A 188     -21.913  24.489 -11.176  1.00  0.00          C   \nATOM   1442  ND1 HIS A 188     -23.839  24.765 -10.181  1.00  0.00          N   \nATOM   1443  CE1 HIS A 188     -22.961  24.425  -9.252  1.00  0.00          C   \nATOM   1444  NE2 HIS A 188     -21.785  24.251  -9.830  1.00  0.00          N   \nATOM   1445  N   HIS A 189     -26.993  24.045 -14.412  1.00  0.00          N   \nATOM   1446  CA  HIS A 189     -28.031  24.708 -15.193  1.00  0.00          C   \nATOM   1447  C   HIS A 189     -28.031  26.213 -14.944  1.00  0.00          C   \nATOM   1448  CB  HIS A 189     -29.406  24.122 -14.865  1.00  0.00          C   \nATOM   1449  O   HIS A 189     -27.980  26.656 -13.795  1.00  0.00          O   \nATOM   1450  CG  HIS A 189     -29.586  22.714 -15.335  1.00  0.00          C   \nATOM   1451  CD2 HIS A 189     -29.619  21.546 -14.652  1.00  0.00          C   \nATOM   1452  ND1 HIS A 189     -29.755  22.390 -16.664  1.00  0.00          N   \nATOM   1453  CE1 HIS A 189     -29.887  21.079 -16.778  1.00  0.00          C   \nATOM   1454  NE2 HIS A 189     -29.808  20.543 -15.572  1.00  0.00          N   \nATOM   1455  N   HIS A 190     -27.150  26.911 -15.639  1.00  0.00          N   \nATOM   1456  CA  HIS A 190     -27.271  28.363 -15.688  1.00  0.00          C   \nATOM   1457  C   HIS A 190     -28.733  28.796 -15.667  1.00  0.00          C   \nATOM   1458  CB  HIS A 190     -26.577  28.917 -16.934  1.00  0.00          C   \nATOM   1459  O   HIS A 190     -29.546  28.288 -16.443  1.00  0.00          O   \nATOM   1460  CG  HIS A 190     -25.087  28.794 -16.896  1.00  0.00          C   \nATOM   1461  CD2 HIS A 190     -24.243  27.997 -17.592  1.00  0.00          C   \nATOM   1462  ND1 HIS A 190     -24.299  29.553 -16.058  1.00  0.00          N   \nATOM   1463  CE1 HIS A 190     -23.030  29.227 -16.242  1.00  0.00          C   \nATOM   1464  NE2 HIS A 190     -22.969  28.285 -17.168  1.00  0.00          N   \nATOM   1465  N   HIS A 191     -29.301  28.820 -14.496  1.00  0.00          N   \nATOM   1466  CA  HIS A 191     -30.497  29.651 -14.423  1.00  0.00          C   \nATOM   1467  C   HIS A 191     -30.240  31.039 -15.001  1.00  0.00          C   \nATOM   1468  CB  HIS A 191     -30.981  29.766 -12.976  1.00  0.00          C   \nATOM   1469  O   HIS A 191     -29.144  31.584 -14.855  1.00  0.00          O   \nATOM   1470  CG  HIS A 191     -31.644  28.528 -12.465  1.00  0.00          C   \nATOM   1471  CD2 HIS A 191     -31.230  27.603 -11.566  1.00  0.00          C   \nATOM   1472  ND1 HIS A 191     -32.892  28.123 -12.888  1.00  0.00          N   \nATOM   1473  CE1 HIS A 191     -33.217  27.000 -12.270  1.00  0.00          C   \nATOM   1474  NE2 HIS A 191     -32.226  26.664 -11.462  1.00  0.00          N   \nTER    1475      HIS A 191\nENDMDL\nEND\n"
  },
  {
    "path": "alphafold/relax/testdata/with_violations.pdb",
    "content": "MODEL        0\nATOM      1  N   SER A   1      23.291   1.505   0.613  1.00  6.08          N   \nATOM      2  CA  SER A   1      22.518   0.883  -0.457  1.00  6.08          C   \nATOM      3  C   SER A   1      21.020   1.015  -0.206  1.00  6.08          C   \nATOM      4  CB  SER A   1      22.891  -0.593  -0.601  1.00  6.08          C   \nATOM      5  O   SER A   1      20.593   1.246   0.928  1.00  6.08          O   \nATOM      6  OG  SER A   1      22.364  -1.352   0.474  1.00  6.08          O   \nATOM      7  N   PHE A   2      20.180   1.317  -1.280  1.00  6.08          N   \nATOM      8  CA  PHE A   2      18.725   1.321  -1.187  1.00  6.08          C   \nATOM      9  C   PHE A   2      18.244   0.288  -0.175  1.00  6.08          C   \nATOM     10  CB  PHE A   2      18.097   1.046  -2.557  1.00  6.08          C   \nATOM     11  O   PHE A   2      17.437   0.600   0.703  1.00  6.08          O   \nATOM     12  CG  PHE A   2      16.601   0.880  -2.517  1.00  6.08          C   \nATOM     13  CD1 PHE A   2      15.765   1.989  -2.519  1.00  6.08          C   \nATOM     14  CD2 PHE A   2      16.033  -0.386  -2.478  1.00  6.08          C   \nATOM     15  CE1 PHE A   2      14.380   1.838  -2.482  1.00  6.08          C   \nATOM     16  CE2 PHE A   2      14.650  -0.545  -2.441  1.00  6.08          C   \nATOM     17  CZ  PHE A   2      13.826   0.569  -2.442  1.00  6.08          C   \nATOM     18  N   GLU A   3      18.695  -0.904  -0.178  1.00  6.08          N   \nATOM     19  CA  GLU A   3      18.305  -2.028   0.668  1.00  6.08          C   \nATOM     20  C   GLU A   3      18.535  -1.714   2.144  1.00  6.08          C   \nATOM     21  CB  GLU A   3      19.073  -3.291   0.273  1.00  6.08          C   \nATOM     22  O   GLU A   3      17.664  -1.961   2.980  1.00  6.08          O   \nATOM     23  CG  GLU A   3      18.413  -4.088  -0.843  1.00  6.08          C   \nATOM     24  CD  GLU A   3      19.408  -4.840  -1.713  1.00  6.08          C   \nATOM     25  OE1 GLU A   3      18.977  -5.585  -2.622  1.00  6.08          O   \nATOM     26  OE2 GLU A   3      20.628  -4.683  -1.482  1.00  6.08          O   \nATOM     27  N   GLU A   4      19.823  -1.305   2.459  1.00  6.08          N   \nATOM     28  CA  GLU A   4      20.190  -1.047   3.848  1.00  6.08          C   \nATOM     29  C   GLU A   4      19.315   0.044   4.456  1.00  6.08          C   \nATOM     30  CB  GLU A   4      21.666  -0.656   3.950  1.00  6.08          C   \nATOM     31  O   GLU A   4      18.868  -0.076   5.599  1.00  6.08          O   \nATOM     32  CG  GLU A   4      22.621  -1.841   3.913  1.00  6.08          C   \nATOM     33  CD  GLU A   4      24.085  -1.434   3.973  1.00  6.08          C   \nATOM     34  OE1 GLU A   4      24.957  -2.324   4.094  1.00  6.08          O   \nATOM     35  OE2 GLU A   4      24.361  -0.216   3.899  1.00  6.08          O   \nATOM     36  N   GLN A   5      19.061   1.102   3.590  1.00  6.08          N   \nATOM     37  CA  GLN A   5      18.207   2.189   4.056  1.00  6.08          C   \nATOM     38  C   GLN A   5      16.771   1.714   4.255  1.00  6.08          C   \nATOM     39  CB  GLN A   5      18.241   3.359   3.071  1.00  6.08          C   \nATOM     40  O   GLN A   5      16.113   2.097   5.225  1.00  6.08          O   \nATOM     41  CG  GLN A   5      19.395   4.326   3.304  1.00  6.08          C   \nATOM     42  CD  GLN A   5      19.384   5.496   2.338  1.00  6.08          C   \nATOM     43  NE2 GLN A   5      20.565   6.022   2.031  1.00  6.08          N   \nATOM     44  OE1 GLN A   5      18.323   5.922   1.871  1.00  6.08          O   \nATOM     45  N   PHE A   6      16.354   0.831   3.208  1.00  5.36          N   \nATOM     46  CA  PHE A   6      15.014   0.260   3.283  1.00  5.36          C   \nATOM     47  C   PHE A   6      14.844  -0.555   4.559  1.00  5.36          C   \nATOM     48  CB  PHE A   6      14.732  -0.616   2.059  1.00  5.36          C   \nATOM     49  O   PHE A   6      13.859  -0.388   5.282  1.00  5.36          O   \nATOM     50  CG  PHE A   6      13.331  -1.164   2.014  1.00  5.36          C   \nATOM     51  CD1 PHE A   6      12.278  -0.379   1.561  1.00  5.36          C   \nATOM     52  CD2 PHE A   6      13.068  -2.464   2.424  1.00  5.36          C   \nATOM     53  CE1 PHE A   6      10.980  -0.884   1.518  1.00  5.36          C   \nATOM     54  CE2 PHE A   6      11.774  -2.975   2.384  1.00  5.36          C   \nATOM     55  CZ  PHE A   6      10.731  -2.183   1.932  1.00  5.36          C   \nATOM     56  N   ILE A   7      15.772  -1.382   4.937  1.00  6.08          N   \nATOM     57  CA  ILE A   7      15.726  -2.220   6.131  1.00  6.08          C   \nATOM     58  C   ILE A   7      15.811  -1.345   7.379  1.00  6.08          C   \nATOM     59  CB  ILE A   7      16.864  -3.266   6.130  1.00  6.08          C   \nATOM     60  O   ILE A   7      15.052  -1.538   8.332  1.00  6.08          O   \nATOM     61  CG1 ILE A   7      16.652  -4.286   5.006  1.00  6.08          C   \nATOM     62  CG2 ILE A   7      16.957  -3.962   7.491  1.00  6.08          C   \nATOM     63  CD1 ILE A   7      17.837  -5.214   4.781  1.00  6.08          C   \nATOM     64  N   LYS A   8      16.750  -0.406   7.403  1.00  6.08          N   \nATOM     65  CA  LYS A   8      16.953   0.493   8.535  1.00  6.08          C   \nATOM     66  C   LYS A   8      15.689   1.294   8.836  1.00  6.08          C   \nATOM     67  CB  LYS A   8      18.122   1.442   8.265  1.00  6.08          C   \nATOM     68  O   LYS A   8      15.304   1.443   9.997  1.00  6.08          O   \nATOM     69  CG  LYS A   8      18.564   2.242   9.481  1.00  6.08          C   \nATOM     70  CD  LYS A   8      19.735   3.159   9.151  1.00  6.08          C   \nATOM     71  CE  LYS A   8      20.102   4.046  10.333  1.00  6.08          C   \nATOM     72  NZ  LYS A   8      21.192   5.007   9.987  1.00  6.08          N   \nATOM     73  N   ASN A   9      14.988   1.804   7.750  1.00  6.08          N   \nATOM     74  CA  ASN A   9      13.799   2.629   7.937  1.00  6.08          C   \nATOM     75  C   ASN A   9      12.593   1.788   8.349  1.00  6.08          C   \nATOM     76  CB  ASN A   9      13.486   3.416   6.663  1.00  6.08          C   \nATOM     77  O   ASN A   9      11.581   2.327   8.801  1.00  6.08          O   \nATOM     78  CG  ASN A   9      14.404   4.608   6.473  1.00  6.08          C   \nATOM     79  ND2 ASN A   9      14.484   5.105   5.244  1.00  6.08          N   \nATOM     80  OD1 ASN A   9      15.036   5.078   7.423  1.00  6.08          O   \nATOM     81  N   ASN A  10      12.800   0.438   8.337  1.00  6.08          N   \nATOM     82  CA  ASN A  10      11.572  -0.311   8.581  1.00  6.08          C   \nATOM     83  C   ASN A  10      11.753  -1.335   9.699  1.00  6.08          C   \nATOM     84  CB  ASN A  10      11.100  -1.002   7.300  1.00  6.08          C   \nATOM     85  O   ASN A  10      10.808  -2.039  10.060  1.00  6.08          O   \nATOM     86  CG  ASN A  10      10.549  -0.025   6.280  1.00  6.08          C   \nATOM     87  ND2 ASN A  10      11.285   0.176   5.193  1.00  6.08          N   \nATOM     88  OD1 ASN A  10       9.471   0.545   6.467  1.00  6.08          O   \nATOM     89  N   SER A  11      12.959  -1.512  10.211  1.00  6.08          N   \nATOM     90  CA  SER A  11      13.197  -2.465  11.291  1.00  6.08          C   \nATOM     91  C   SER A  11      12.666  -1.938  12.620  1.00  6.08          C   \nATOM     92  CB  SER A  11      14.690  -2.772  11.415  1.00  6.08          C   \nATOM     93  O   SER A  11      12.451  -2.709  13.557  1.00  6.08          O   \nATOM     94  OG  SER A  11      15.435  -1.581  11.601  1.00  6.08          O   \nATOM     95  N   ASP A  12      12.220  -0.675  12.710  1.00  6.08          N   \nATOM     96  CA  ASP A  12      11.747  -0.267  14.029  1.00  6.08          C   \nATOM     97  C   ASP A  12      10.304  -0.711  14.256  1.00  6.08          C   \nATOM     98  CB  ASP A  12      11.864   1.249  14.196  1.00  6.08          C   \nATOM     99  O   ASP A  12       9.847  -0.792  15.398  1.00  6.08          O   \nATOM    100  CG  ASP A  12      13.206   1.682  14.760  1.00  6.08          C   \nATOM    101  OD1 ASP A  12      13.586   2.861  14.592  1.00  6.08          O   \nATOM    102  OD2 ASP A  12      13.890   0.837  15.376  1.00  6.08          O   \nATOM    103  N   SER A  13       9.678  -1.277  13.274  1.00  6.08          N   \nATOM    104  CA  SER A  13       8.274  -1.520  13.587  1.00  6.08          C   \nATOM    105  C   SER A  13       8.041  -2.973  13.988  1.00  6.08          C   \nATOM    106  CB  SER A  13       7.389  -1.164  12.393  1.00  6.08          C   \nATOM    107  O   SER A  13       8.569  -3.889  13.355  1.00  6.08          O   \nATOM    108  OG  SER A  13       7.871  -1.776  11.209  1.00  6.08          O   \nATOM    109  N   ASN A  14       8.368  -3.385  15.178  1.00  6.08          N   \nATOM    110  CA  ASN A  14       7.591  -4.466  15.775  1.00  6.08          C   \nATOM    111  C   ASN A  14       6.843  -5.271  14.716  1.00  6.08          C   \nATOM    112  CB  ASN A  14       6.610  -3.912  16.812  1.00  6.08          C   \nATOM    113  O   ASN A  14       6.016  -6.122  15.047  1.00  6.08          O   \nATOM    114  CG  ASN A  14       7.250  -3.709  18.171  1.00  6.08          C   \nATOM    115  ND2 ASN A  14       6.608  -2.910  19.015  1.00  6.08          N   \nATOM    116  OD1 ASN A  14       8.313  -4.265  18.460  1.00  6.08          O   \nATOM    117  N   ILE A  15       7.204  -5.229  13.474  1.00  6.08          N   \nATOM    118  CA  ILE A  15       6.430  -5.995  12.502  1.00  6.08          C   \nATOM    119  C   ILE A  15       7.095  -7.349  12.265  1.00  6.08          C   \nATOM    120  CB  ILE A  15       6.282  -5.229  11.168  1.00  6.08          C   \nATOM    121  O   ILE A  15       8.306  -7.422  12.045  1.00  6.08          O   \nATOM    122  CG1 ILE A  15       5.583  -3.885  11.398  1.00  6.08          C   \nATOM    123  CG2 ILE A  15       5.520  -6.074  10.143  1.00  6.08          C   \nATOM    124  CD1 ILE A  15       5.473  -3.022  10.149  1.00  6.08          C   \nATOM    125  N   LEU A  16       6.669  -8.397  13.068  1.00  6.08          N   \nATOM    126  CA  LEU A  16       6.808  -9.846  12.972  1.00  6.08          C   \nATOM    127  C   LEU A  16       6.967 -10.281  11.519  1.00  6.08          C   \nATOM    128  CB  LEU A  16       5.597 -10.544  13.596  1.00  6.08          C   \nATOM    129  O   LEU A  16       6.238  -9.812  10.643  1.00  6.08          O   \nATOM    130  CG  LEU A  16       5.559 -10.598  15.125  1.00  6.08          C   \nATOM    131  CD1 LEU A  16       4.134 -10.839  15.611  1.00  6.08          C   \nATOM    132  CD2 LEU A  16       6.498 -11.682  15.644  1.00  6.08          C   \nATOM    133  N   ALA A  17       8.248 -10.386  11.036  1.00  6.08          N   \nATOM    134  CA  ALA A  17       8.700 -10.996   9.788  1.00  6.08          C   \nATOM    135  C   ALA A  17       7.863 -12.224   9.444  1.00  6.08          C   \nATOM    136  CB  ALA A  17      10.177 -11.372   9.884  1.00  6.08          C   \nATOM    137  O   ALA A  17       7.473 -12.986  10.332  1.00  6.08          O   \nATOM    138  N   PRO A  18       7.023 -12.218   8.206  1.00  6.08          N   \nATOM    139  CA  PRO A  18       6.298 -13.437   7.841  1.00  6.08          C   \nATOM    140  C   PRO A  18       7.204 -14.499   7.222  1.00  6.08          C   \nATOM    141  CB  PRO A  18       5.264 -12.942   6.826  1.00  6.08          C   \nATOM    142  O   PRO A  18       8.307 -14.186   6.767  1.00  6.08          O   \nATOM    143  CG  PRO A  18       5.663 -11.532   6.531  1.00  6.08          C   \nATOM    144  CD  PRO A  18       6.762 -11.140   7.476  1.00  6.08          C   \nATOM    145  N   LYS A  19       6.910 -15.813   7.261  1.00  6.08          N   \nATOM    146  CA  LYS A  19       7.401 -17.032   6.627  1.00  6.08          C   \nATOM    147  C   LYS A  19       6.700 -17.279   5.294  1.00  6.08          C   \nATOM    148  CB  LYS A  19       7.206 -18.235   7.552  1.00  6.08          C   \nATOM    149  O   LYS A  19       5.494 -17.054   5.170  1.00  6.08          O   \nATOM    150  CG  LYS A  19       8.289 -18.383   8.610  1.00  6.08          C   \nATOM    151  CD  LYS A  19       8.149 -19.695   9.372  1.00  6.08          C   \nATOM    152  CE  LYS A  19       9.213 -19.830  10.454  1.00  6.08          C   \nATOM    153  NZ  LYS A  19       9.104 -21.132  11.178  1.00  6.08          N   \nATOM    154  N   VAL A  20       7.272 -17.218   4.055  1.00  6.08          N   \nATOM    155  CA  VAL A  20       6.741 -17.404   2.708  1.00  6.08          C   \nATOM    156  C   VAL A  20       7.061 -18.814   2.217  1.00  6.08          C   \nATOM    157  CB  VAL A  20       7.307 -16.355   1.725  1.00  6.08          C   \nATOM    158  O   VAL A  20       8.148 -19.336   2.476  1.00  6.08          O   \nATOM    159  CG1 VAL A  20       6.686 -16.524   0.339  1.00  6.08          C   \nATOM    160  CG2 VAL A  20       7.064 -14.943   2.254  1.00  6.08          C   \nATOM    161  N   SER A  21       6.082 -19.480   1.504  1.00  6.08          N   \nATOM    162  CA  SER A  21       6.281 -20.787   0.888  1.00  6.08          C   \nATOM    163  C   SER A  21       7.315 -20.720  -0.230  1.00  6.08          C   \nATOM    164  CB  SER A  21       4.960 -21.329   0.340  1.00  6.08          C   \nATOM    165  O   SER A  21       7.458 -19.688  -0.889  1.00  6.08          O   \nATOM    166  OG  SER A  21       4.811 -20.999  -1.030  1.00  6.08          O   \nATOM    167  N   GLN A  22       8.094 -21.778  -0.457  1.00  6.08          N   \nATOM    168  CA  GLN A  22       9.146 -22.023  -1.437  1.00  6.08          C   \nATOM    169  C   GLN A  22       8.608 -21.912  -2.861  1.00  6.08          C   \nATOM    170  CB  GLN A  22       9.774 -23.400  -1.218  1.00  6.08          C   \nATOM    171  O   GLN A  22       9.307 -21.436  -3.758  1.00  6.08          O   \nATOM    172  CG  GLN A  22      11.028 -23.375  -0.356  1.00  6.08          C   \nATOM    173  CD  GLN A  22      11.900 -24.601  -0.550  1.00  6.08          C   \nATOM    174  NE2 GLN A  22      13.017 -24.654   0.167  1.00  6.08          N   \nATOM    175  OE1 GLN A  22      11.570 -25.495  -1.337  1.00  6.08          O   \nATOM    176  N   SER A  23       7.326 -22.350  -3.087  1.00  6.08          N   \nATOM    177  CA  SER A  23       6.818 -22.344  -4.455  1.00  6.08          C   \nATOM    178  C   SER A  23       6.627 -20.921  -4.968  1.00  6.08          C   \nATOM    179  CB  SER A  23       5.494 -23.106  -4.539  1.00  6.08          C   \nATOM    180  O   SER A  23       6.916 -20.631  -6.131  1.00  6.08          O   \nATOM    181  OG  SER A  23       4.496 -22.467  -3.762  1.00  6.08          O   \nATOM    182  N   VAL A  24       6.156 -19.987  -4.125  1.00  6.08          N   \nATOM    183  CA  VAL A  24       5.987 -18.582  -4.483  1.00  6.08          C   \nATOM    184  C   VAL A  24       7.353 -17.938  -4.708  1.00  6.08          C   \nATOM    185  CB  VAL A  24       5.206 -17.809  -3.397  1.00  6.08          C   \nATOM    186  O   VAL A  24       7.534 -17.165  -5.652  1.00  6.08          O   \nATOM    187  CG1 VAL A  24       5.211 -16.310  -3.691  1.00  6.08          C   \nATOM    188  CG2 VAL A  24       3.775 -18.332  -3.296  1.00  6.08          C   \nATOM    189  N   ILE A  25       8.365 -18.356  -3.827  1.00  6.08          N   \nATOM    190  CA  ILE A  25       9.724 -17.836  -3.937  1.00  6.08          C   \nATOM    191  C   ILE A  25      10.325 -18.244  -5.280  1.00  6.08          C   \nATOM    192  CB  ILE A  25      10.616 -18.332  -2.777  1.00  6.08          C   \nATOM    193  O   ILE A  25      11.011 -17.450  -5.928  1.00  6.08          O   \nATOM    194  CG1 ILE A  25      10.127 -17.755  -1.444  1.00  6.08          C   \nATOM    195  CG2 ILE A  25      12.081 -17.966  -3.028  1.00  6.08          C   \nATOM    196  CD1 ILE A  25      10.848 -18.316  -0.226  1.00  6.08          C   \nATOM    197  N   LYS A  26       9.942 -19.394  -5.728  1.00  6.08          N   \nATOM    198  CA  LYS A  26      10.533 -19.885  -6.969  1.00  6.08          C   \nATOM    199  C   LYS A  26       9.961 -19.150  -8.178  1.00  6.08          C   \nATOM    200  CB  LYS A  26      10.303 -21.391  -7.115  1.00  6.08          C   \nATOM    201  O   LYS A  26      10.615 -19.055  -9.219  1.00  6.08          O   \nATOM    202  CG  LYS A  26      11.247 -22.244  -6.281  1.00  6.08          C   \nATOM    203  CD  LYS A  26      11.022 -23.730  -6.527  1.00  6.08          C   \nATOM    204  CE  LYS A  26      11.909 -24.587  -5.634  1.00  6.08          C   \nATOM    205  NZ  LYS A  26      11.672 -26.045  -5.852  1.00  6.08          N   \nATOM    206  N   SER A  27       8.716 -18.585  -8.016  1.00  6.08          N   \nATOM    207  CA  SER A  27       8.115 -17.884  -9.146  1.00  6.08          C   \nATOM    208  C   SER A  27       8.597 -16.439  -9.220  1.00  6.08          C   \nATOM    209  CB  SER A  27       6.589 -17.917  -9.047  1.00  6.08          C   \nATOM    210  O   SER A  27       8.389 -15.761 -10.229  1.00  6.08          O   \nATOM    211  OG  SER A  27       6.145 -17.239  -7.885  1.00  6.08          O   \nATOM    212  N   ILE A  28       9.326 -16.021  -8.127  1.00  6.08          N   \nATOM    213  CA  ILE A  28       9.655 -14.600  -8.095  1.00  6.08          C   \nATOM    214  C   ILE A  28      11.013 -14.370  -8.753  1.00  6.08          C   \nATOM    215  CB  ILE A  28       9.660 -14.055  -6.649  1.00  6.08          C   \nATOM    216  O   ILE A  28      12.005 -15.000  -8.381  1.00  6.08          O   \nATOM    217  CG1 ILE A  28       8.282 -14.238  -6.004  1.00  6.08          C   \nATOM    218  CG2 ILE A  28      10.082 -12.583  -6.629  1.00  6.08          C   \nATOM    219  CD1 ILE A  28       8.241 -13.892  -4.522  1.00  6.08          C   \nATOM    220  N   LYS A  29      11.102 -13.748  -9.982  1.00  6.08          N   \nATOM    221  CA  LYS A  29      12.253 -13.354 -10.790  1.00  6.08          C   \nATOM    222  C   LYS A  29      12.954 -12.137 -10.192  1.00  6.08          C   \nATOM    223  CB  LYS A  29      11.825 -13.058 -12.228  1.00  6.08          C   \nATOM    224  O   LYS A  29      12.302 -11.156  -9.829  1.00  6.08          O   \nATOM    225  CG  LYS A  29      11.657 -14.299 -13.092  1.00  6.08          C   \nATOM    226  CD  LYS A  29      11.456 -13.937 -14.557  1.00  6.08          C   \nATOM    227  CE  LYS A  29      11.272 -15.178 -15.421  1.00  6.08          C   \nATOM    228  NZ  LYS A  29      11.145 -14.832 -16.868  1.00  6.08          N   \nATOM    229  N   GLY A  30      13.888 -12.322  -9.217  1.00  6.08          N   \nATOM    230  CA  GLY A  30      14.719 -11.185  -8.854  1.00  6.08          C   \nATOM    231  C   GLY A  30      14.960 -11.074  -7.361  1.00  6.08          C   \nATOM    232  O   GLY A  30      14.940  -9.975  -6.804  1.00  6.08          O   \nATOM    233  N   ILE A  31      15.279 -12.138  -6.638  1.00  6.08          N   \nATOM    234  CA  ILE A  31      15.591 -12.164  -5.214  1.00  6.08          C   \nATOM    235  C   ILE A  31      16.885 -11.396  -4.954  1.00  6.08          C   \nATOM    236  CB  ILE A  31      15.713 -13.612  -4.689  1.00  6.08          C   \nATOM    237  O   ILE A  31      17.945 -11.761  -5.468  1.00  6.08          O   \nATOM    238  CG1 ILE A  31      14.396 -14.369  -4.897  1.00  6.08          C   \nATOM    239  CG2 ILE A  31      16.121 -13.619  -3.212  1.00  6.08          C   \nATOM    240  CD1 ILE A  31      14.475 -15.853  -4.565  1.00  6.08          C   \nATOM    241  N   LYS A  32      16.933 -10.089  -4.574  1.00  6.08          N   \nATOM    242  CA  LYS A  32      18.183  -9.378  -4.323  1.00  6.08          C   \nATOM    243  C   LYS A  32      18.755  -9.738  -2.954  1.00  6.08          C   \nATOM    244  CB  LYS A  32      17.970  -7.867  -4.420  1.00  6.08          C   \nATOM    245  O   LYS A  32      19.969  -9.892  -2.804  1.00  6.08          O   \nATOM    246  CG  LYS A  32      18.023  -7.324  -5.841  1.00  6.08          C   \nATOM    247  CD  LYS A  32      18.626  -5.926  -5.883  1.00  6.08          C   \nATOM    248  CE  LYS A  32      18.645  -5.367  -7.300  1.00  6.08          C   \nATOM    249  NZ  LYS A  32      19.320  -4.036  -7.361  1.00  6.08          N   \nATOM    250  N   SER A  33      17.909 -10.205  -1.893  1.00  6.08          N   \nATOM    251  CA  SER A  33      18.320 -10.572  -0.542  1.00  6.08          C   \nATOM    252  C   SER A  33      17.215 -11.331   0.185  1.00  6.08          C   \nATOM    253  CB  SER A  33      18.707  -9.328   0.258  1.00  6.08          C   \nATOM    254  O   SER A  33      16.099 -11.450  -0.324  1.00  6.08          O   \nATOM    255  OG  SER A  33      17.560  -8.560   0.581  1.00  6.08          O   \nATOM    256  N   LYS A  34      17.506 -12.068   1.188  1.00  6.08          N   \nATOM    257  CA  LYS A  34      16.610 -12.918   1.967  1.00  6.08          C   \nATOM    258  C   LYS A  34      15.403 -12.131   2.468  1.00  6.08          C   \nATOM    259  CB  LYS A  34      17.356 -13.542   3.148  1.00  6.08          C   \nATOM    260  O   LYS A  34      14.341 -12.706   2.718  1.00  6.08          O   \nATOM    261  CG  LYS A  34      18.074 -14.840   2.810  1.00  6.08          C   \nATOM    262  CD  LYS A  34      18.733 -15.451   4.040  1.00  6.08          C   \nATOM    263  CE  LYS A  34      19.519 -16.707   3.689  1.00  6.08          C   \nATOM    264  NZ  LYS A  34      20.155 -17.318   4.894  1.00  6.08          N   \nATOM    265  N   HIS A  35      15.371 -10.863   2.266  1.00  5.36          N   \nATOM    266  CA  HIS A  35      14.261 -10.259   2.994  1.00  5.36          C   \nATOM    267  C   HIS A  35      13.500  -9.270   2.117  1.00  5.36          C   \nATOM    268  CB  HIS A  35      14.765  -9.560   4.258  1.00  5.36          C   \nATOM    269  O   HIS A  35      12.451  -8.760   2.515  1.00  5.36          O   \nATOM    270  CG  HIS A  35      15.436 -10.482   5.225  1.00  5.36          C   \nATOM    271  CD2 HIS A  35      16.730 -10.574   5.614  1.00  5.36          C   \nATOM    272  ND1 HIS A  35      14.755 -11.461   5.916  1.00  5.36          N   \nATOM    273  CE1 HIS A  35      15.604 -12.116   6.691  1.00  5.36          C   \nATOM    274  NE2 HIS A  35      16.808 -11.597   6.526  1.00  5.36          N   \nATOM    275  N   VAL A  36      14.059  -8.954   0.978  1.00  5.36          N   \nATOM    276  CA  VAL A  36      13.407  -7.973   0.118  1.00  5.36          C   \nATOM    277  C   VAL A  36      13.086  -8.603  -1.235  1.00  5.36          C   \nATOM    278  CB  VAL A  36      14.284  -6.715  -0.074  1.00  5.36          C   \nATOM    279  O   VAL A  36      13.962  -9.187  -1.878  1.00  5.36          O   \nATOM    280  CG1 VAL A  36      13.591  -5.709  -0.992  1.00  5.36          C   \nATOM    281  CG2 VAL A  36      14.605  -6.078   1.277  1.00  5.36          C   \nATOM    282  N   PHE A  37      11.770  -8.603  -1.484  1.00  5.36          N   \nATOM    283  CA  PHE A  37      11.361  -9.204  -2.749  1.00  5.36          C   \nATOM    284  C   PHE A  37      10.980  -8.129  -3.760  1.00  5.36          C   \nATOM    285  CB  PHE A  37      10.186 -10.163  -2.535  1.00  5.36          C   \nATOM    286  O   PHE A  37      10.245  -7.195  -3.434  1.00  5.36          O   \nATOM    287  CG  PHE A  37      10.500 -11.311  -1.614  1.00  5.36          C   \nATOM    288  CD1 PHE A  37      10.346 -11.180  -0.239  1.00  5.36          C   \nATOM    289  CD2 PHE A  37      10.949 -12.522  -2.124  1.00  5.36          C   \nATOM    290  CE1 PHE A  37      10.636 -12.242   0.616  1.00  5.36          C   \nATOM    291  CE2 PHE A  37      11.241 -13.587  -1.276  1.00  5.36          C   \nATOM    292  CZ  PHE A  37      11.084 -13.445   0.093  1.00  5.36          C   \nATOM    293  N   GLU A  38      11.560  -8.160  -4.884  1.00  5.36          N   \nATOM    294  CA  GLU A  38      11.250  -7.279  -6.006  1.00  5.36          C   \nATOM    295  C   GLU A  38      10.193  -7.897  -6.917  1.00  5.36          C   \nATOM    296  CB  GLU A  38      12.516  -6.965  -6.808  1.00  5.36          C   \nATOM    297  O   GLU A  38      10.363  -9.016  -7.405  1.00  5.36          O   \nATOM    298  CG  GLU A  38      12.298  -5.965  -7.934  1.00  5.36          C   \nATOM    299  CD  GLU A  38      13.552  -5.698  -8.751  1.00  5.36          C   \nATOM    300  OE1 GLU A  38      13.571  -6.025  -9.960  1.00  5.36          O   \nATOM    301  OE2 GLU A  38      14.525  -5.158  -8.178  1.00  5.36          O   \nATOM    302  N   LEU A  39       9.040  -7.269  -6.940  1.00  5.36          N   \nATOM    303  CA  LEU A  39       7.988  -7.741  -7.834  1.00  5.36          C   \nATOM    304  C   LEU A  39       7.842  -6.816  -9.038  1.00  5.36          C   \nATOM    305  CB  LEU A  39       6.655  -7.839  -7.087  1.00  5.36          C   \nATOM    306  O   LEU A  39       7.250  -5.740  -8.931  1.00  5.36          O   \nATOM    307  CG  LEU A  39       6.571  -8.896  -5.984  1.00  5.36          C   \nATOM    308  CD1 LEU A  39       5.425  -8.577  -5.030  1.00  5.36          C   \nATOM    309  CD2 LEU A  39       6.401 -10.286  -6.587  1.00  5.36          C   \nATOM    310  N   PRO A  40       8.487  -7.251 -10.143  1.00  6.08          N   \nATOM    311  CA  PRO A  40       8.346  -6.359 -11.296  1.00  6.08          C   \nATOM    312  C   PRO A  40       6.896  -6.208 -11.751  1.00  6.08          C   \nATOM    313  CB  PRO A  40       9.189  -7.043 -12.376  1.00  6.08          C   \nATOM    314  O   PRO A  40       6.198  -7.207 -11.942  1.00  6.08          O   \nATOM    315  CG  PRO A  40       9.550  -8.371 -11.794  1.00  6.08          C   \nATOM    316  CD  PRO A  40       9.068  -8.416 -10.373  1.00  6.08          C   \nATOM    317  N   ILE A  41       6.243  -4.982 -11.734  1.00  6.08          N   \nATOM    318  CA  ILE A  41       4.884  -4.747 -12.210  1.00  6.08          C   \nATOM    319  C   ILE A  41       4.900  -4.508 -13.718  1.00  6.08          C   \nATOM    320  CB  ILE A  41       4.229  -3.551 -11.484  1.00  6.08          C   \nATOM    321  O   ILE A  41       4.158  -5.153 -14.463  1.00  6.08          O   \nATOM    322  CG1 ILE A  41       4.176  -3.807  -9.974  1.00  6.08          C   \nATOM    323  CG2 ILE A  41       2.829  -3.280 -12.044  1.00  6.08          C   \nATOM    324  CD1 ILE A  41       3.647  -2.630  -9.165  1.00  6.08          C   \nATOM    325  N   ASN A  42       5.810  -3.703 -14.250  1.00  6.08          N   \nATOM    326  CA  ASN A  42       6.141  -3.456 -15.649  1.00  6.08          C   \nATOM    327  C   ASN A  42       7.598  -3.034 -15.814  1.00  6.08          C   \nATOM    328  CB  ASN A  42       5.210  -2.396 -16.242  1.00  6.08          C   \nATOM    329  O   ASN A  42       8.396  -3.167 -14.885  1.00  6.08          O   \nATOM    330  CG  ASN A  42       5.303  -1.067 -15.518  1.00  6.08          C   \nATOM    331  ND2 ASN A  42       4.156  -0.448 -15.267  1.00  6.08          N   \nATOM    332  OD1 ASN A  42       6.397  -0.600 -15.189  1.00  6.08          O   \nATOM    333  N   ASP A  43       7.989  -2.622 -17.089  1.00  6.08          N   \nATOM    334  CA  ASP A  43       9.387  -2.328 -17.387  1.00  6.08          C   \nATOM    335  C   ASP A  43       9.898  -1.169 -16.534  1.00  6.08          C   \nATOM    336  CB  ASP A  43       9.563  -2.005 -18.873  1.00  6.08          C   \nATOM    337  O   ASP A  43      11.101  -1.051 -16.294  1.00  6.08          O   \nATOM    338  CG  ASP A  43       9.350  -3.211 -19.771  1.00  6.08          C   \nATOM    339  OD1 ASP A  43       9.124  -3.033 -20.987  1.00  6.08          O   \nATOM    340  OD2 ASP A  43       9.406  -4.349 -19.257  1.00  6.08          O   \nATOM    341  N   LYS A  44       8.964  -0.340 -16.036  1.00  6.08          N   \nATOM    342  CA  LYS A  44       9.421   0.879 -15.374  1.00  6.08          C   \nATOM    343  C   LYS A  44       9.078   0.858 -13.887  1.00  6.08          C   \nATOM    344  CB  LYS A  44       8.806   2.113 -16.036  1.00  6.08          C   \nATOM    345  O   LYS A  44       9.523   1.723 -13.130  1.00  6.08          O   \nATOM    346  CG  LYS A  44       9.329   2.388 -17.438  1.00  6.08          C   \nATOM    347  CD  LYS A  44       8.792   3.704 -17.986  1.00  6.08          C   \nATOM    348  CE  LYS A  44       9.281   3.960 -19.405  1.00  6.08          C   \nATOM    349  NZ  LYS A  44       8.775   5.260 -19.939  1.00  6.08          N   \nATOM    350  N   THR A  45       8.261  -0.019 -13.522  1.00  6.08          N   \nATOM    351  CA  THR A  45       7.740   0.030 -12.161  1.00  6.08          C   \nATOM    352  C   THR A  45       8.037  -1.272 -11.421  1.00  6.08          C   \nATOM    353  CB  THR A  45       6.223   0.293 -12.152  1.00  6.08          C   \nATOM    354  O   THR A  45       7.755  -2.359 -11.929  1.00  6.08          O   \nATOM    355  CG2 THR A  45       5.716   0.544 -10.736  1.00  6.08          C   \nATOM    356  OG1 THR A  45       5.938   1.442 -12.960  1.00  6.08          O   \nATOM    357  N   LYS A  46       8.731  -1.136 -10.322  1.00  5.36          N   \nATOM    358  CA  LYS A  46       9.040  -2.324  -9.532  1.00  5.36          C   \nATOM    359  C   LYS A  46       8.519  -2.186  -8.104  1.00  5.36          C   \nATOM    360  CB  LYS A  46      10.548  -2.581  -9.517  1.00  5.36          C   \nATOM    361  O   LYS A  46       8.374  -1.073  -7.595  1.00  5.36          O   \nATOM    362  CG  LYS A  46      11.163  -2.738 -10.899  1.00  5.36          C   \nATOM    363  CD  LYS A  46      12.677  -2.883 -10.824  1.00  5.36          C   \nATOM    364  CE  LYS A  46      13.302  -2.960 -12.211  1.00  5.36          C   \nATOM    365  NZ  LYS A  46      14.790  -2.843 -12.156  1.00  5.36          N   \nATOM    366  N   ARG A  47       8.105  -3.267  -7.558  1.00  5.36          N   \nATOM    367  CA  ARG A  47       7.620  -3.302  -6.182  1.00  5.36          C   \nATOM    368  C   ARG A  47       8.642  -3.956  -5.258  1.00  5.36          C   \nATOM    369  CB  ARG A  47       6.286  -4.047  -6.100  1.00  5.36          C   \nATOM    370  O   ARG A  47       9.291  -4.934  -5.635  1.00  5.36          O   \nATOM    371  CG  ARG A  47       5.588  -3.915  -4.756  1.00  5.36          C   \nATOM    372  CD  ARG A  47       4.227  -4.596  -4.758  1.00  5.36          C   \nATOM    373  NE  ARG A  47       3.162  -3.674  -4.374  1.00  5.36          N   \nATOM    374  NH1 ARG A  47       1.449  -5.188  -4.705  1.00  5.36          N   \nATOM    375  NH2 ARG A  47       0.983  -3.060  -3.991  1.00  5.36          N   \nATOM    376  CZ  ARG A  47       1.867  -3.976  -4.358  1.00  5.36          C   \nATOM    377  N   TYR A  48       8.748  -3.477  -3.978  1.00  5.36          N   \nATOM    378  CA  TYR A  48       9.593  -4.175  -3.016  1.00  5.36          C   \nATOM    379  C   TYR A  48       8.779  -4.649  -1.818  1.00  5.36          C   \nATOM    380  CB  TYR A  48      10.734  -3.268  -2.546  1.00  5.36          C   \nATOM    381  O   TYR A  48       7.943  -3.908  -1.295  1.00  5.36          O   \nATOM    382  CG  TYR A  48      11.694  -2.881  -3.645  1.00  5.36          C   \nATOM    383  CD1 TYR A  48      11.441  -1.781  -4.462  1.00  5.36          C   \nATOM    384  CD2 TYR A  48      12.854  -3.613  -3.869  1.00  5.36          C   \nATOM    385  CE1 TYR A  48      12.321  -1.421  -5.477  1.00  5.36          C   \nATOM    386  CE2 TYR A  48      13.742  -3.263  -4.881  1.00  5.36          C   \nATOM    387  OH  TYR A  48      14.342  -1.815  -6.682  1.00  5.36          O   \nATOM    388  CZ  TYR A  48      13.467  -2.167  -5.678  1.00  5.36          C   \nATOM    389  N   ILE A  49       8.717  -5.888  -1.613  1.00  5.36          N   \nATOM    390  CA  ILE A  49       7.989  -6.430  -0.471  1.00  5.36          C   \nATOM    391  C   ILE A  49       8.975  -6.856   0.614  1.00  5.36          C   \nATOM    392  CB  ILE A  49       7.097  -7.622  -0.882  1.00  5.36          C   \nATOM    393  O   ILE A  49      10.017  -7.445   0.318  1.00  5.36          O   \nATOM    394  CG1 ILE A  49       6.166  -7.220  -2.032  1.00  5.36          C   \nATOM    395  CG2 ILE A  49       6.296  -8.136   0.317  1.00  5.36          C   \nATOM    396  CD1 ILE A  49       5.367  -8.378  -2.615  1.00  5.36          C   \nATOM    397  N   LEU A  50       8.862  -6.262   1.857  1.00  5.36          N   \nATOM    398  CA  LEU A  50       9.614  -6.778   2.996  1.00  5.36          C   \nATOM    399  C   LEU A  50       8.946  -8.023   3.570  1.00  5.36          C   \nATOM    400  CB  LEU A  50       9.742  -5.707   4.083  1.00  5.36          C   \nATOM    401  O   LEU A  50       7.743  -8.018   3.842  1.00  5.36          O   \nATOM    402  CG  LEU A  50      11.100  -5.606   4.779  1.00  5.36          C   \nATOM    403  CD1 LEU A  50      11.885  -4.416   4.238  1.00  5.36          C   \nATOM    404  CD2 LEU A  50      10.920  -5.493   6.289  1.00  5.36          C   \nATOM    405  N   GLY A  51       9.463  -9.224   3.543  1.00  5.36          N   \nATOM    406  CA  GLY A  51       9.015 -10.310   4.400  1.00  5.36          C   \nATOM    407  C   GLY A  51       7.865 -11.102   3.807  1.00  5.36          C   \nATOM    408  O   GLY A  51       6.957 -10.529   3.200  1.00  5.36          O   \nATOM    409  N   ALA A  52       8.049 -12.344   3.364  1.00  5.36          N   \nATOM    410  CA  ALA A  52       6.949 -13.257   3.063  1.00  5.36          C   \nATOM    411  C   ALA A  52       6.954 -14.454   4.009  1.00  5.36          C   \nATOM    412  CB  ALA A  52       7.031 -13.728   1.613  1.00  5.36          C   \nATOM    413  O   ALA A  52       8.016 -14.901   4.449  1.00  5.36          O   \nATOM    414  N   THR A  53       5.741 -14.626   4.821  1.00  6.08          N   \nATOM    415  CA  THR A  53       5.638 -15.818   5.655  1.00  6.08          C   \nATOM    416  C   THR A  53       4.816 -16.898   4.956  1.00  6.08          C   \nATOM    417  CB  THR A  53       5.005 -15.492   7.020  1.00  6.08          C   \nATOM    418  O   THR A  53       4.163 -16.631   3.944  1.00  6.08          O   \nATOM    419  CG2 THR A  53       5.758 -14.364   7.719  1.00  6.08          C   \nATOM    420  OG1 THR A  53       3.643 -15.093   6.826  1.00  6.08          O   \nATOM    421  N   GLU A  54       4.971 -18.204   5.377  1.00  6.08          N   \nATOM    422  CA  GLU A  54       4.419 -19.510   5.031  1.00  6.08          C   \nATOM    423  C   GLU A  54       2.894 -19.498   5.093  1.00  6.08          C   \nATOM    424  CB  GLU A  54       4.974 -20.593   5.960  1.00  6.08          C   \nATOM    425  O   GLU A  54       2.229 -20.148   4.283  1.00  6.08          O   \nATOM    426  CG  GLU A  54       6.145 -21.367   5.371  1.00  6.08          C   \nATOM    427  CD  GLU A  54       6.620 -22.505   6.261  1.00  6.08          C   \nATOM    428  OE1 GLU A  54       7.586 -23.207   5.885  1.00  6.08          O   \nATOM    429  OE2 GLU A  54       6.021 -22.696   7.343  1.00  6.08          O   \nATOM    430  N   THR A  55       2.284 -18.768   6.100  1.00  6.08          N   \nATOM    431  CA  THR A  55       0.931 -19.163   6.472  1.00  6.08          C   \nATOM    432  C   THR A  55      -0.065 -18.051   6.153  1.00  6.08          C   \nATOM    433  CB  THR A  55       0.844 -19.519   7.968  1.00  6.08          C   \nATOM    434  O   THR A  55      -1.275 -18.282   6.132  1.00  6.08          O   \nATOM    435  CG2 THR A  55       1.686 -20.749   8.290  1.00  6.08          C   \nATOM    436  OG1 THR A  55       1.318 -18.412   8.745  1.00  6.08          O   \nATOM    437  N   LYS A  56       0.188 -16.955   5.564  1.00  6.08          N   \nATOM    438  CA  LYS A  56      -0.870 -15.980   5.311  1.00  6.08          C   \nATOM    439  C   LYS A  56      -0.294 -14.671   4.777  1.00  6.08          C   \nATOM    440  CB  LYS A  56      -1.676 -15.719   6.584  1.00  6.08          C   \nATOM    441  O   LYS A  56       0.578 -14.069   5.406  1.00  6.08          O   \nATOM    442  CG  LYS A  56      -2.640 -16.838   6.947  1.00  6.08          C   \nATOM    443  CD  LYS A  56      -3.584 -16.421   8.067  1.00  6.08          C   \nATOM    444  CE  LYS A  56      -4.524 -17.554   8.458  1.00  6.08          C   \nATOM    445  NZ  LYS A  56      -5.505 -17.125   9.499  1.00  6.08          N   \nATOM    446  N   GLU A  57      -0.274 -14.530   3.508  1.00  6.08          N   \nATOM    447  CA  GLU A  57      -0.600 -13.449   2.582  1.00  6.08          C   \nATOM    448  C   GLU A  57      -0.543 -12.092   3.276  1.00  6.08          C   \nATOM    449  CB  GLU A  57      -1.984 -13.668   1.966  1.00  6.08          C   \nATOM    450  O   GLU A  57      -0.932 -11.075   2.696  1.00  6.08          O   \nATOM    451  CG  GLU A  57      -1.976 -14.563   0.735  1.00  6.08          C   \nATOM    452  CD  GLU A  57      -3.338 -14.683   0.071  1.00  6.08          C   \nATOM    453  OE1 GLU A  57      -3.423 -15.253  -1.040  1.00  6.08          O   \nATOM    454  OE2 GLU A  57      -4.328 -14.203   0.667  1.00  6.08          O   \nATOM    455  N   GLU A  58       0.126 -11.928   4.480  1.00  6.08          N   \nATOM    456  CA  GLU A  58      -0.009 -10.492   4.706  1.00  6.08          C   \nATOM    457  C   GLU A  58       1.168  -9.726   4.108  1.00  6.08          C   \nATOM    458  CB  GLU A  58      -0.125 -10.192   6.203  1.00  6.08          C   \nATOM    459  O   GLU A  58       2.323 -10.126   4.271  1.00  6.08          O   \nATOM    460  CG  GLU A  58      -1.553  -9.953   6.673  1.00  6.08          C   \nATOM    461  CD  GLU A  58      -1.648  -9.595   8.147  1.00  6.08          C   \nATOM    462  OE1 GLU A  58      -2.761  -9.279   8.625  1.00  6.08          O   \nATOM    463  OE2 GLU A  58      -0.600  -9.629   8.830  1.00  6.08          O   \nATOM    464  N   VAL A  59       0.923  -8.970   3.115  1.00  5.36          N   \nATOM    465  CA  VAL A  59       1.676  -8.056   2.262  1.00  5.36          C   \nATOM    466  C   VAL A  59       1.616  -6.644   2.838  1.00  5.36          C   \nATOM    467  CB  VAL A  59       1.141  -8.064   0.812  1.00  5.36          C   \nATOM    468  O   VAL A  59       0.550  -6.026   2.875  1.00  5.36          O   \nATOM    469  CG1 VAL A  59       2.113  -7.351  -0.126  1.00  5.36          C   \nATOM    470  CG2 VAL A  59       0.894  -9.496   0.342  1.00  5.36          C   \nATOM    471  N   LEU A  60       2.134  -6.382   4.062  1.00  5.36          N   \nATOM    472  CA  LEU A  60       2.206  -4.926   4.093  1.00  5.36          C   \nATOM    473  C   LEU A  60       3.467  -4.459   4.813  1.00  5.36          C   \nATOM    474  CB  LEU A  60       0.968  -4.342   4.778  1.00  5.36          C   \nATOM    475  O   LEU A  60       3.645  -4.732   6.002  1.00  5.36          O   \nATOM    476  CG  LEU A  60      -0.362  -4.523   4.044  1.00  5.36          C   \nATOM    477  CD1 LEU A  60      -1.528  -4.217   4.977  1.00  5.36          C   \nATOM    478  CD2 LEU A  60      -0.414  -3.635   2.805  1.00  5.36          C   \nATOM    479  N   PRO A  61       4.690  -3.899   4.294  1.00  5.36          N   \nATOM    480  CA  PRO A  61       4.413  -2.559   3.771  1.00  5.36          C   \nATOM    481  C   PRO A  61       4.305  -2.531   2.248  1.00  5.36          C   \nATOM    482  CB  PRO A  61       5.614  -1.739   4.248  1.00  5.36          C   \nATOM    483  O   PRO A  61       4.930  -3.348   1.566  1.00  5.36          O   \nATOM    484  CG  PRO A  61       6.588  -2.750   4.760  1.00  5.36          C   \nATOM    485  CD  PRO A  61       5.908  -4.089   4.803  1.00  5.36          C   \nATOM    486  N   ASN A  62       3.352  -1.777   1.774  1.00  4.42          N   \nATOM    487  CA  ASN A  62       2.773  -1.209   0.561  1.00  4.42          C   \nATOM    488  C   ASN A  62       3.673  -0.134  -0.041  1.00  4.42          C   \nATOM    489  CB  ASN A  62       1.382  -0.637   0.847  1.00  4.42          C   \nATOM    490  O   ASN A  62       3.461   1.058   0.186  1.00  4.42          O   \nATOM    491  CG  ASN A  62       0.321  -1.714   0.963  1.00  4.42          C   \nATOM    492  ND2 ASN A  62      -0.756  -1.410   1.679  1.00  4.42          N   \nATOM    493  OD1 ASN A  62       0.468  -2.809   0.415  1.00  4.42          O   \nATOM    494  N   TYR A  63       4.982  -0.411  -0.311  1.00  4.42          N   \nATOM    495  CA  TYR A  63       5.766   0.563  -1.062  1.00  4.42          C   \nATOM    496  C   TYR A  63       5.569   0.381  -2.563  1.00  4.42          C   \nATOM    497  CB  TYR A  63       7.252   0.442  -0.712  1.00  4.42          C   \nATOM    498  O   TYR A  63       5.291  -0.726  -3.029  1.00  4.42          O   \nATOM    499  CG  TYR A  63       7.556   0.705   0.743  1.00  4.42          C   \nATOM    500  CD1 TYR A  63       7.564  -0.333   1.672  1.00  4.42          C   \nATOM    501  CD2 TYR A  63       7.835   1.992   1.191  1.00  4.42          C   \nATOM    502  CE1 TYR A  63       7.842  -0.094   3.014  1.00  4.42          C   \nATOM    503  CE2 TYR A  63       8.114   2.242   2.531  1.00  4.42          C   \nATOM    504  OH  TYR A  63       8.392   1.435   4.760  1.00  4.42          O   \nATOM    505  CZ  TYR A  63       8.116   1.194   3.433  1.00  4.42          C   \nATOM    506  N   VAL A  64       5.361   1.479  -3.257  1.00  4.42          N   \nATOM    507  CA  VAL A  64       5.323   1.484  -4.716  1.00  4.42          C   \nATOM    508  C   VAL A  64       6.456   2.350  -5.260  1.00  4.42          C   \nATOM    509  CB  VAL A  64       3.963   1.991  -5.246  1.00  4.42          C   \nATOM    510  O   VAL A  64       6.668   3.472  -4.794  1.00  4.42          O   \nATOM    511  CG1 VAL A  64       4.005   2.161  -6.764  1.00  4.42          C   \nATOM    512  CG2 VAL A  64       2.843   1.034  -4.844  1.00  4.42          C   \nATOM    513  N   LYS A  65       7.501   1.678  -5.944  1.00  5.36          N   \nATOM    514  CA  LYS A  65       8.535   2.445  -6.634  1.00  5.36          C   \nATOM    515  C   LYS A  65       8.078   2.847  -8.033  1.00  5.36          C   \nATOM    516  CB  LYS A  65       9.834   1.643  -6.717  1.00  5.36          C   \nATOM    517  O   LYS A  65       7.631   2.004  -8.812  1.00  5.36          O   \nATOM    518  CG  LYS A  65      11.017   2.434  -7.256  1.00  5.36          C   \nATOM    519  CD  LYS A  65      12.295   1.605  -7.245  1.00  5.36          C   \nATOM    520  CE  LYS A  65      13.479   2.395  -7.786  1.00  5.36          C   \nATOM    521  NZ  LYS A  65      14.742   1.599  -7.745  1.00  5.36          N   \nATOM    522  N   VAL A  66       8.093   4.091  -8.333  1.00  5.36          N   \nATOM    523  CA  VAL A  66       7.778   4.641  -9.647  1.00  5.36          C   \nATOM    524  C   VAL A  66       9.008   5.340 -10.223  1.00  5.36          C   \nATOM    525  CB  VAL A  66       6.589   5.625  -9.580  1.00  5.36          C   \nATOM    526  O   VAL A  66       9.375   6.430  -9.779  1.00  5.36          O   \nATOM    527  CG1 VAL A  66       6.222   6.125 -10.977  1.00  5.36          C   \nATOM    528  CG2 VAL A  66       5.385   4.962  -8.914  1.00  5.36          C   \nATOM    529  N   GLY A  67       9.659   4.635 -11.193  1.00  5.36          N   \nATOM    530  CA  GLY A  67      10.950   5.142 -11.630  1.00  5.36          C   \nATOM    531  C   GLY A  67      12.012   5.081 -10.548  1.00  5.36          C   \nATOM    532  O   GLY A  67      12.305   4.007 -10.019  1.00  5.36          O   \nATOM    533  N   SER A  68      12.514   6.343 -10.271  1.00  5.36          N   \nATOM    534  CA  SER A  68      13.526   6.411  -9.222  1.00  5.36          C   \nATOM    535  C   SER A  68      12.902   6.759  -7.874  1.00  5.36          C   \nATOM    536  CB  SER A  68      14.598   7.442  -9.577  1.00  5.36          C   \nATOM    537  O   SER A  68      13.608   6.894  -6.873  1.00  5.36          O   \nATOM    538  OG  SER A  68      14.006   8.654 -10.011  1.00  5.36          O   \nATOM    539  N   ASP A  69      11.527   6.878  -7.937  1.00  5.36          N   \nATOM    540  CA  ASP A  69      10.872   7.348  -6.720  1.00  5.36          C   \nATOM    541  C   ASP A  69      10.208   6.193  -5.973  1.00  5.36          C   \nATOM    542  CB  ASP A  69       9.837   8.425  -7.049  1.00  5.36          C   \nATOM    543  O   ASP A  69       9.669   5.274  -6.594  1.00  5.36          O   \nATOM    544  CG  ASP A  69      10.453   9.672  -7.660  1.00  5.36          C   \nATOM    545  OD1 ASP A  69       9.841  10.271  -8.571  1.00  5.36          O   \nATOM    546  OD2 ASP A  69      11.561  10.057  -7.229  1.00  5.36          O   \nATOM    547  N   LEU A  70      10.310   6.167  -4.690  1.00  4.42          N   \nATOM    548  CA  LEU A  70       9.712   5.170  -3.810  1.00  4.42          C   \nATOM    549  C   LEU A  70       8.614   5.789  -2.952  1.00  4.42          C   \nATOM    550  CB  LEU A  70      10.780   4.537  -2.914  1.00  4.42          C   \nATOM    551  O   LEU A  70       8.810   6.853  -2.359  1.00  4.42          O   \nATOM    552  CG  LEU A  70      10.378   3.255  -2.182  1.00  4.42          C   \nATOM    553  CD1 LEU A  70      10.240   2.102  -3.170  1.00  4.42          C   \nATOM    554  CD2 LEU A  70      11.395   2.918  -1.097  1.00  4.42          C   \nATOM    555  N   TYR A  71       7.500   5.181  -2.953  1.00  4.42          N   \nATOM    556  CA  TYR A  71       6.370   5.703  -2.192  1.00  4.42          C   \nATOM    557  C   TYR A  71       5.940   4.719  -1.110  1.00  4.42          C   \nATOM    558  CB  TYR A  71       5.190   6.006  -3.121  1.00  4.42          C   \nATOM    559  O   TYR A  71       5.994   3.504  -1.311  1.00  4.42          O   \nATOM    560  CG  TYR A  71       5.502   7.031  -4.184  1.00  4.42          C   \nATOM    561  CD1 TYR A  71       6.112   6.661  -5.380  1.00  4.42          C   \nATOM    562  CD2 TYR A  71       5.190   8.373  -3.993  1.00  4.42          C   \nATOM    563  CE1 TYR A  71       6.403   7.603  -6.361  1.00  4.42          C   \nATOM    564  CE2 TYR A  71       5.476   9.324  -4.967  1.00  4.42          C   \nATOM    565  OH  TYR A  71       6.367   9.867  -7.114  1.00  4.42          O   \nATOM    566  CZ  TYR A  71       6.081   8.930  -6.146  1.00  4.42          C   \nATOM    567  N   ARG A  72       5.750   5.231   0.077  1.00  4.42          N   \nATOM    568  CA  ARG A  72       5.102   4.470   1.140  1.00  4.42          C   \nATOM    569  C   ARG A  72       3.588   4.648   1.097  1.00  4.42          C   \nATOM    570  CB  ARG A  72       5.641   4.892   2.509  1.00  4.42          C   \nATOM    571  O   ARG A  72       3.093   5.772   0.987  1.00  4.42          O   \nATOM    572  CG  ARG A  72       5.185   4.000   3.652  1.00  4.42          C   \nATOM    573  CD  ARG A  72       5.797   4.427   4.979  1.00  4.42          C   \nATOM    574  NE  ARG A  72       5.284   3.630   6.090  1.00  4.42          N   \nATOM    575  NH1 ARG A  72       6.305   4.890   7.736  1.00  4.42          N   \nATOM    576  NH2 ARG A  72       5.019   3.079   8.304  1.00  4.42          N   \nATOM    577  CZ  ARG A  72       5.538   3.868   7.374  1.00  4.42          C   \nATOM    578  N   LEU A  73       2.852   3.545   1.039  1.00  3.21          N   \nATOM    579  CA  LEU A  73       1.395   3.610   1.029  1.00  3.21          C   \nATOM    580  C   LEU A  73       0.833   3.435   2.436  1.00  3.21          C   \nATOM    581  CB  LEU A  73       0.816   2.541   0.099  1.00  3.21          C   \nATOM    582  O   LEU A  73       1.261   2.544   3.173  1.00  3.21          O   \nATOM    583  CG  LEU A  73       1.212   2.639  -1.375  1.00  3.21          C   \nATOM    584  CD1 LEU A  73       1.030   1.291  -2.064  1.00  3.21          C   \nATOM    585  CD2 LEU A  73       0.396   3.719  -2.078  1.00  3.21          C   \nATOM    586  N   LYS A  74       0.064   4.404   2.921  1.00  4.42          N   \nATOM    587  CA  LYS A  74      -0.627   4.299   4.203  1.00  4.42          C   \nATOM    588  C   LYS A  74      -2.140   4.374   4.020  1.00  4.42          C   \nATOM    589  CB  LYS A  74      -0.159   5.400   5.156  1.00  4.42          C   \nATOM    590  O   LYS A  74      -2.643   5.256   3.320  1.00  4.42          O   \nATOM    591  CG  LYS A  74      -0.498   5.139   6.617  1.00  4.42          C   \nATOM    592  CD  LYS A  74       0.083   6.214   7.526  1.00  4.42          C   \nATOM    593  CE  LYS A  74      -0.315   5.993   8.979  1.00  4.42          C   \nATOM    594  NZ  LYS A  74       0.270   7.033   9.878  1.00  4.42          N   \nATOM    595  N   ALA A  75      -2.781   3.329   4.523  1.00  4.42          N   \nATOM    596  CA  ALA A  75      -4.241   3.343   4.479  1.00  4.42          C   \nATOM    597  C   ALA A  75      -4.826   3.741   5.831  1.00  4.42          C   \nATOM    598  CB  ALA A  75      -4.774   1.977   4.053  1.00  4.42          C   \nATOM    599  O   ALA A  75      -4.275   3.396   6.879  1.00  4.42          O   \nATOM    600  N   TYR A  76      -5.770   4.597   5.772  1.00  5.36          N   \nATOM    601  CA  TYR A  76      -6.435   4.990   7.009  1.00  5.36          C   \nATOM    602  C   TYR A  76      -7.924   5.215   6.781  1.00  5.36          C   \nATOM    603  CB  TYR A  76      -5.797   6.259   7.583  1.00  5.36          C   \nATOM    604  O   TYR A  76      -8.375   5.314   5.637  1.00  5.36          O   \nATOM    605  CG  TYR A  76      -5.887   7.453   6.665  1.00  5.36          C   \nATOM    606  CD1 TYR A  76      -6.916   8.382   6.798  1.00  5.36          C   \nATOM    607  CD2 TYR A  76      -4.946   7.653   5.661  1.00  5.36          C   \nATOM    608  CE1 TYR A  76      -7.005   9.483   5.952  1.00  5.36          C   \nATOM    609  CE2 TYR A  76      -5.024   8.750   4.809  1.00  5.36          C   \nATOM    610  OH  TYR A  76      -6.138  10.746   4.123  1.00  5.36          O   \nATOM    611  CZ  TYR A  76      -6.055   9.659   4.963  1.00  5.36          C   \nATOM    612  N   ARG A  77      -8.726   5.218   7.799  1.00  5.36          N   \nATOM    613  CA  ARG A  77     -10.169   5.419   7.723  1.00  5.36          C   \nATOM    614  C   ARG A  77     -10.570   6.753   8.344  1.00  5.36          C   \nATOM    615  CB  ARG A  77     -10.909   4.274   8.418  1.00  5.36          C   \nATOM    616  O   ARG A  77     -10.028   7.151   9.377  1.00  5.36          O   \nATOM    617  CG  ARG A  77     -12.424   4.372   8.322  1.00  5.36          C   \nATOM    618  CD  ARG A  77     -13.109   3.207   9.024  1.00  5.36          C   \nATOM    619  NE  ARG A  77     -13.016   1.977   8.244  1.00  5.36          N   \nATOM    620  NH1 ARG A  77     -14.417   0.756   9.616  1.00  5.36          N   \nATOM    621  NH2 ARG A  77     -13.484  -0.219   7.763  1.00  5.36          N   \nATOM    622  CZ  ARG A  77     -13.639   0.841   8.542  1.00  5.36          C   \nATOM    623  N   GLU A  78     -11.384   7.464   7.705  1.00  5.36          N   \nATOM    624  CA  GLU A  78     -12.045   8.659   8.221  1.00  5.36          C   \nATOM    625  C   GLU A  78     -13.563   8.519   8.164  1.00  5.36          C   \nATOM    626  CB  GLU A  78     -11.601   9.899   7.439  1.00  5.36          C   \nATOM    627  O   GLU A  78     -14.081   7.514   7.673  1.00  5.36          O   \nATOM    628  CG  GLU A  78     -10.154  10.298   7.690  1.00  5.36          C   \nATOM    629  CD  GLU A  78      -9.792  11.648   7.092  1.00  5.36          C   \nATOM    630  OE1 GLU A  78      -8.647  12.113   7.291  1.00  5.36          O   \nATOM    631  OE2 GLU A  78     -10.661  12.247   6.420  1.00  5.36          O   \nATOM    632  N   LYS A  79     -14.255   9.510   8.676  1.00  5.36          N   \nATOM    633  CA  LYS A  79     -15.715   9.478   8.716  1.00  5.36          C   \nATOM    634  C   LYS A  79     -16.297   9.210   7.332  1.00  5.36          C   \nATOM    635  CB  LYS A  79     -16.265  10.793   9.271  1.00  5.36          C   \nATOM    636  O   LYS A  79     -17.266   8.460   7.195  1.00  5.36          O   \nATOM    637  CG  LYS A  79     -16.312  10.853  10.790  1.00  5.36          C   \nATOM    638  CD  LYS A  79     -16.955  12.144  11.279  1.00  5.36          C   \nATOM    639  CE  LYS A  79     -16.920  12.247  12.798  1.00  5.36          C   \nATOM    640  NZ  LYS A  79     -17.524  13.525  13.281  1.00  5.36          N   \nATOM    641  N   SER A  80     -15.615   9.685   6.280  1.00  5.36          N   \nATOM    642  CA  SER A  80     -16.194   9.676   4.940  1.00  5.36          C   \nATOM    643  C   SER A  80     -15.768   8.435   4.163  1.00  5.36          C   \nATOM    644  CB  SER A  80     -15.787  10.934   4.171  1.00  5.36          C   \nATOM    645  O   SER A  80     -16.312   8.148   3.094  1.00  5.36          O   \nATOM    646  OG  SER A  80     -14.376  11.064   4.131  1.00  5.36          O   \nATOM    647  N   GLY A  81     -14.790   7.696   4.700  1.00  5.36          N   \nATOM    648  CA  GLY A  81     -14.368   6.508   3.975  1.00  5.36          C   \nATOM    649  C   GLY A  81     -12.932   6.112   4.264  1.00  5.36          C   \nATOM    650  O   GLY A  81     -12.367   6.508   5.285  1.00  5.36          O   \nATOM    651  N   VAL A  82     -12.402   5.137   3.681  1.00  5.36          N   \nATOM    652  CA  VAL A  82     -11.030   4.653   3.791  1.00  5.36          C   \nATOM    653  C   VAL A  82     -10.148   5.364   2.767  1.00  5.36          C   \nATOM    654  CB  VAL A  82     -10.951   3.123   3.591  1.00  5.36          C   \nATOM    655  O   VAL A  82     -10.540   5.531   1.610  1.00  5.36          O   \nATOM    656  CG1 VAL A  82      -9.503   2.642   3.674  1.00  5.36          C   \nATOM    657  CG2 VAL A  82     -11.816   2.405   4.626  1.00  5.36          C   \nATOM    658  N   TYR A  83      -9.046   5.835   3.278  1.00  5.36          N   \nATOM    659  CA  TYR A  83      -8.137   6.587   2.421  1.00  5.36          C   \nATOM    660  C   TYR A  83      -6.784   5.894   2.319  1.00  5.36          C   \nATOM    661  CB  TYR A  83      -7.955   8.013   2.949  1.00  5.36          C   \nATOM    662  O   TYR A  83      -6.401   5.132   3.211  1.00  5.36          O   \nATOM    663  CG  TYR A  83      -9.240   8.802   3.021  1.00  5.36          C   \nATOM    664  CD1 TYR A  83     -10.101   8.671   4.108  1.00  5.36          C   \nATOM    665  CD2 TYR A  83      -9.595   9.680   2.003  1.00  5.36          C   \nATOM    666  CE1 TYR A  83     -11.287   9.395   4.177  1.00  5.36          C   \nATOM    667  CE2 TYR A  83     -10.778  10.409   2.062  1.00  5.36          C   \nATOM    668  OH  TYR A  83     -12.789  10.979   3.215  1.00  5.36          O   \nATOM    669  CZ  TYR A  83     -11.616  10.260   3.151  1.00  5.36          C   \nATOM    670  N   VAL A  84      -6.217   5.977   1.159  1.00  4.42          N   \nATOM    671  CA  VAL A  84      -4.820   5.583   1.013  1.00  4.42          C   \nATOM    672  C   VAL A  84      -3.961   6.815   0.737  1.00  4.42          C   \nATOM    673  CB  VAL A  84      -4.638   4.544  -0.116  1.00  4.42          C   \nATOM    674  O   VAL A  84      -4.300   7.638  -0.117  1.00  4.42          O   \nATOM    675  CG1 VAL A  84      -3.161   4.207  -0.308  1.00  4.42          C   \nATOM    676  CG2 VAL A  84      -5.442   3.281   0.188  1.00  4.42          C   \nATOM    677  N   ARG A  85      -3.015   6.909   1.573  1.00  4.42          N   \nATOM    678  CA  ARG A  85      -2.052   8.001   1.472  1.00  4.42          C   \nATOM    679  C   ARG A  85      -0.722   7.508   0.912  1.00  4.42          C   \nATOM    680  CB  ARG A  85      -1.835   8.655   2.838  1.00  4.42          C   \nATOM    681  O   ARG A  85      -0.256   6.423   1.268  1.00  4.42          O   \nATOM    682  CG  ARG A  85      -1.113   9.992   2.773  1.00  4.42          C   \nATOM    683  CD  ARG A  85      -0.941  10.607   4.154  1.00  4.42          C   \nATOM    684  NE  ARG A  85      -2.049  11.496   4.491  1.00  4.42          N   \nATOM    685  NH1 ARG A  85      -1.423  11.780   6.696  1.00  4.42          N   \nATOM    686  NH2 ARG A  85      -3.293  12.829   5.887  1.00  4.42          N   \nATOM    687  CZ  ARG A  85      -2.252  12.033   5.691  1.00  4.42          C   \nATOM    688  N   THR A  86      -0.152   8.200  -0.153  1.00  4.42          N   \nATOM    689  CA  THR A  86       1.170   7.866  -0.672  1.00  4.42          C   \nATOM    690  C   THR A  86       2.192   8.924  -0.269  1.00  4.42          C   \nATOM    691  CB  THR A  86       1.148   7.726  -2.205  1.00  4.42          C   \nATOM    692  O   THR A  86       1.918  10.123  -0.351  1.00  4.42          O   \nATOM    693  CG2 THR A  86       0.290   6.542  -2.638  1.00  4.42          C   \nATOM    694  OG1 THR A  86       0.614   8.925  -2.781  1.00  4.42          O   \nATOM    695  N   ASN A  87       3.286   8.434   0.354  1.00  5.36          N   \nATOM    696  CA  ASN A  87       4.370   9.361   0.664  1.00  5.36          C   \nATOM    697  C   ASN A  87       5.610   9.075  -0.179  1.00  5.36          C   \nATOM    698  CB  ASN A  87       4.716   9.304   2.153  1.00  5.36          C   \nATOM    699  O   ASN A  87       6.062   7.932  -0.258  1.00  5.36          O   \nATOM    700  CG  ASN A  87       3.662   9.959   3.024  1.00  5.36          C   \nATOM    701  ND2 ASN A  87       3.845   9.882   4.336  1.00  5.36          N   \nATOM    702  OD1 ASN A  87       2.690  10.529   2.520  1.00  5.36          O   \nATOM    703  N   LYS A  88       6.095  10.057  -0.960  1.00  5.36          N   \nATOM    704  CA  LYS A  88       7.392   9.866  -1.603  1.00  5.36          C   \nATOM    705  C   LYS A  88       8.509   9.764  -0.569  1.00  5.36          C   \nATOM    706  CB  LYS A  88       7.682  11.009  -2.577  1.00  5.36          C   \nATOM    707  O   LYS A  88       8.639  10.630   0.299  1.00  5.36          O   \nATOM    708  CG  LYS A  88       8.904  10.780  -3.454  1.00  5.36          C   \nATOM    709  CD  LYS A  88       9.096  11.914  -4.452  1.00  5.36          C   \nATOM    710  CE  LYS A  88      10.325  11.692  -5.323  1.00  5.36          C   \nATOM    711  NZ  LYS A  88      10.494  12.781  -6.331  1.00  5.36          N   \nATOM    712  N   LEU A  89       9.164   8.645  -0.576  1.00  5.36          N   \nATOM    713  CA  LEU A  89      10.225   8.484   0.412  1.00  5.36          C   \nATOM    714  C   LEU A  89      11.425   9.361   0.069  1.00  5.36          C   \nATOM    715  CB  LEU A  89      10.658   7.018   0.498  1.00  5.36          C   \nATOM    716  O   LEU A  89      11.670   9.653  -1.104  1.00  5.36          O   \nATOM    717  CG  LEU A  89       9.718   6.077   1.253  1.00  5.36          C   \nATOM    718  CD1 LEU A  89      10.100   4.624   0.990  1.00  5.36          C   \nATOM    719  CD2 LEU A  89       9.744   6.380   2.747  1.00  5.36          C   \nATOM    720  N   GLY A  90      12.223   9.812   1.163  1.00  5.36          N   \nATOM    721  CA  GLY A  90      13.408  10.650   1.084  1.00  5.36          C   \nATOM    722  C   GLY A  90      13.092  12.133   1.100  1.00  5.36          C   \nATOM    723  O   GLY A  90      13.993  12.967   0.984  1.00  5.36          O   \nATOM    724  N   PHE A  91      11.852  12.465   1.066  1.00  6.08          N   \nATOM    725  CA  PHE A  91      11.399  13.841   1.233  1.00  6.08          C   \nATOM    726  C   PHE A  91      10.518  13.974   2.470  1.00  6.08          C   \nATOM    727  CB  PHE A  91      10.634  14.312  -0.008  1.00  6.08          C   \nATOM    728  O   PHE A  91       9.318  13.699   2.417  1.00  6.08          O   \nATOM    729  CG  PHE A  91      11.519  14.611  -1.188  1.00  6.08          C   \nATOM    730  CD1 PHE A  91      11.797  13.630  -2.132  1.00  6.08          C   \nATOM    731  CD2 PHE A  91      12.073  15.874  -1.353  1.00  6.08          C   \nATOM    732  CE1 PHE A  91      12.615  13.904  -3.226  1.00  6.08          C   \nATOM    733  CE2 PHE A  91      12.891  16.155  -2.443  1.00  6.08          C   \nATOM    734  CZ  PHE A  91      13.162  15.168  -3.378  1.00  6.08          C   \nATOM    735  N   GLU A  92      11.137  13.459   3.617  1.00  6.08          N   \nATOM    736  CA  GLU A  92      10.535  13.509   4.945  1.00  6.08          C   \nATOM    737  C   GLU A  92      10.313  14.950   5.397  1.00  6.08          C   \nATOM    738  CB  GLU A  92      11.409  12.768   5.960  1.00  6.08          C   \nATOM    739  O   GLU A  92      11.270  15.664   5.704  1.00  6.08          O   \nATOM    740  CG  GLU A  92      10.998  11.320   6.186  1.00  6.08          C   \nATOM    741  CD  GLU A  92      11.819  10.623   7.259  1.00  6.08          C   \nATOM    742  OE1 GLU A  92      11.506   9.461   7.604  1.00  6.08          O   \nATOM    743  OE2 GLU A  92      12.783  11.245   7.759  1.00  6.08          O   \nATOM    744  N   ASP A  93       9.620  15.891   4.677  1.00  6.08          N   \nATOM    745  CA  ASP A  93       9.157  16.934   5.587  1.00  6.08          C   \nATOM    746  C   ASP A  93       7.745  16.640   6.087  1.00  6.08          C   \nATOM    747  CB  ASP A  93       9.199  18.302   4.902  1.00  6.08          C   \nATOM    748  O   ASP A  93       6.797  16.602   5.299  1.00  6.08          O   \nATOM    749  CG  ASP A  93       8.970  19.454   5.864  1.00  6.08          C   \nATOM    750  OD1 ASP A  93       9.176  20.624   5.475  1.00  6.08          O   \nATOM    751  OD2 ASP A  93       8.583  19.190   7.023  1.00  6.08          O   \nATOM    752  N   PRO A  94       7.665  15.732   7.134  1.00  6.08          N   \nATOM    753  CA  PRO A  94       6.298  15.546   7.627  1.00  6.08          C   \nATOM    754  C   PRO A  94       5.438  16.798   7.468  1.00  6.08          C   \nATOM    755  CB  PRO A  94       6.500  15.207   9.106  1.00  6.08          C   \nATOM    756  O   PRO A  94       4.211  16.701   7.386  1.00  6.08          O   \nATOM    757  CG  PRO A  94       7.963  15.397   9.346  1.00  6.08          C   \nATOM    758  CD  PRO A  94       8.633  15.652   8.026  1.00  6.08          C   \nATOM    759  N   LYS A  95       6.057  18.015   7.264  1.00  6.08          N   \nATOM    760  CA  LYS A  95       5.244  19.214   7.077  1.00  6.08          C   \nATOM    761  C   LYS A  95       5.046  19.517   5.595  1.00  6.08          C   \nATOM    762  CB  LYS A  95       5.887  20.413   7.776  1.00  6.08          C   \nATOM    763  O   LYS A  95       4.278  20.413   5.236  1.00  6.08          O   \nATOM    764  CG  LYS A  95       5.879  20.321   9.295  1.00  6.08          C   \nATOM    765  CD  LYS A  95       6.403  21.600   9.935  1.00  6.08          C   \nATOM    766  CE  LYS A  95       6.462  21.483  11.452  1.00  6.08          C   \nATOM    767  NZ  LYS A  95       6.972  22.736  12.085  1.00  6.08          N   \nATOM    768  N   SER A  96       5.718  18.813   4.741  1.00  6.08          N   \nATOM    769  CA  SER A  96       5.637  19.195   3.335  1.00  6.08          C   \nATOM    770  C   SER A  96       4.505  18.459   2.626  1.00  6.08          C   \nATOM    771  CB  SER A  96       6.963  18.912   2.626  1.00  6.08          C   \nATOM    772  O   SER A  96       4.417  17.231   2.696  1.00  6.08          O   \nATOM    773  OG  SER A  96       6.791  17.942   1.607  1.00  6.08          O   \nATOM    774  N   PHE A  97       3.312  18.985   2.701  1.00  6.08          N   \nATOM    775  CA  PHE A  97       2.069  18.645   2.019  1.00  6.08          C   \nATOM    776  C   PHE A  97       2.310  18.435   0.529  1.00  6.08          C   \nATOM    777  CB  PHE A  97       1.020  19.741   2.232  1.00  6.08          C   \nATOM    778  O   PHE A  97       1.445  17.913  -0.178  1.00  6.08          O   \nATOM    779  CG  PHE A  97       0.311  19.653   3.556  1.00  6.08          C   \nATOM    780  CD1 PHE A  97       0.741  20.404   4.643  1.00  6.08          C   \nATOM    781  CD2 PHE A  97      -0.787  18.817   3.714  1.00  6.08          C   \nATOM    782  CE1 PHE A  97       0.086  20.325   5.869  1.00  6.08          C   \nATOM    783  CE2 PHE A  97      -1.447  18.732   4.937  1.00  6.08          C   \nATOM    784  CZ  PHE A  97      -1.008  19.486   6.014  1.00  6.08          C   \nATOM    785  N   LEU A  98       3.513  18.640   0.039  1.00  6.08          N   \nATOM    786  CA  LEU A  98       3.587  18.842  -1.404  1.00  6.08          C   \nATOM    787  C   LEU A  98       3.826  17.520  -2.126  1.00  6.08          C   \nATOM    788  CB  LEU A  98       4.699  19.835  -1.751  1.00  6.08          C   \nATOM    789  O   LEU A  98       3.478  17.377  -3.300  1.00  6.08          O   \nATOM    790  CG  LEU A  98       4.372  21.315  -1.552  1.00  6.08          C   \nATOM    791  CD1 LEU A  98       5.651  22.145  -1.553  1.00  6.08          C   \nATOM    792  CD2 LEU A  98       3.413  21.801  -2.634  1.00  6.08          C   \nATOM    793  N   SER A  99       3.933  16.395  -1.418  1.00  6.08          N   \nATOM    794  CA  SER A  99       3.847  15.299  -2.377  1.00  6.08          C   \nATOM    795  C   SER A  99       2.856  14.236  -1.915  1.00  6.08          C   \nATOM    796  CB  SER A  99       5.222  14.666  -2.593  1.00  6.08          C   \nATOM    797  O   SER A  99       3.126  13.039  -2.024  1.00  6.08          O   \nATOM    798  OG  SER A  99       6.045  14.848  -1.453  1.00  6.08          O   \nATOM    799  N   ILE A 100       1.863  14.672  -1.135  1.00  6.08          N   \nATOM    800  CA  ILE A 100       0.897  13.774  -0.510  1.00  6.08          C   \nATOM    801  C   ILE A 100      -0.327  13.626  -1.411  1.00  6.08          C   \nATOM    802  CB  ILE A 100       0.475  14.281   0.887  1.00  6.08          C   \nATOM    803  O   ILE A 100      -0.866  14.619  -1.905  1.00  6.08          O   \nATOM    804  CG1 ILE A 100       1.693  14.364   1.815  1.00  6.08          C   \nATOM    805  CG2 ILE A 100      -0.608  13.379   1.485  1.00  6.08          C   \nATOM    806  CD1 ILE A 100       1.410  15.041   3.149  1.00  6.08          C   \nATOM    807  N   LYS A 101      -0.627  12.452  -2.003  1.00  6.08          N   \nATOM    808  CA  LYS A 101      -1.914  12.267  -2.668  1.00  6.08          C   \nATOM    809  C   LYS A 101      -2.834  11.369  -1.846  1.00  6.08          C   \nATOM    810  CB  LYS A 101      -1.717  11.677  -4.065  1.00  6.08          C   \nATOM    811  O   LYS A 101      -2.372  10.433  -1.190  1.00  6.08          O   \nATOM    812  CG  LYS A 101      -1.039  12.621  -5.046  1.00  6.08          C   \nATOM    813  CD  LYS A 101      -1.055  12.062  -6.463  1.00  6.08          C   \nATOM    814  CE  LYS A 101      -0.350  12.992  -7.441  1.00  6.08          C   \nATOM    815  NZ  LYS A 101      -0.430  12.486  -8.844  1.00  6.08          N   \nATOM    816  N   GLU A 102      -3.972  11.868  -1.441  1.00  6.08          N   \nATOM    817  CA  GLU A 102      -5.024  11.157  -0.721  1.00  6.08          C   \nATOM    818  C   GLU A 102      -6.074  10.605  -1.681  1.00  6.08          C   \nATOM    819  CB  GLU A 102      -5.686  12.076   0.310  1.00  6.08          C   \nATOM    820  O   GLU A 102      -6.525  11.308  -2.587  1.00  6.08          O   \nATOM    821  CG  GLU A 102      -6.179  11.350   1.553  1.00  6.08          C   \nATOM    822  CD  GLU A 102      -6.742  12.286   2.611  1.00  6.08          C   \nATOM    823  OE1 GLU A 102      -7.929  12.141   2.980  1.00  6.08          O   \nATOM    824  OE2 GLU A 102      -5.989  13.172   3.073  1.00  6.08          O   \nATOM    825  N   TYR A 103      -6.415   9.341  -1.509  1.00  5.36          N   \nATOM    826  CA  TYR A 103      -7.466   8.743  -2.325  1.00  5.36          C   \nATOM    827  C   TYR A 103      -8.614   8.244  -1.456  1.00  5.36          C   \nATOM    828  CB  TYR A 103      -6.906   7.589  -3.163  1.00  5.36          C   \nATOM    829  O   TYR A 103      -8.406   7.443  -0.541  1.00  5.36          O   \nATOM    830  CG  TYR A 103      -5.758   7.990  -4.057  1.00  5.36          C   \nATOM    831  CD1 TYR A 103      -4.440   7.899  -3.614  1.00  5.36          C   \nATOM    832  CD2 TYR A 103      -5.988   8.459  -5.345  1.00  5.36          C   \nATOM    833  CE1 TYR A 103      -3.379   8.269  -4.434  1.00  5.36          C   \nATOM    834  CE2 TYR A 103      -4.935   8.832  -6.174  1.00  5.36          C   \nATOM    835  OH  TYR A 103      -2.589   9.101  -6.526  1.00  5.36          O   \nATOM    836  CZ  TYR A 103      -3.636   8.733  -5.710  1.00  5.36          C   \nATOM    837  N   LYS A 104      -9.836   8.844  -1.571  1.00  6.08          N   \nATOM    838  CA  LYS A 104     -11.038   8.471  -0.832  1.00  6.08          C   \nATOM    839  C   LYS A 104     -11.649   7.188  -1.387  1.00  6.08          C   \nATOM    840  CB  LYS A 104     -12.066   9.602  -0.872  1.00  6.08          C   \nATOM    841  O   LYS A 104     -11.782   7.033  -2.603  1.00  6.08          O   \nATOM    842  CG  LYS A 104     -13.244   9.402   0.070  1.00  6.08          C   \nATOM    843  CD  LYS A 104     -14.209  10.579   0.017  1.00  6.08          C   \nATOM    844  CE  LYS A 104     -15.411  10.360   0.925  1.00  6.08          C   \nATOM    845  NZ  LYS A 104     -16.346  11.524   0.898  1.00  6.08          N   \nATOM    846  N   PHE A 105     -11.952   6.243  -0.555  1.00  6.08          N   \nATOM    847  CA  PHE A 105     -12.601   4.981  -0.891  1.00  6.08          C   \nATOM    848  C   PHE A 105     -14.029   4.948  -0.359  1.00  6.08          C   \nATOM    849  CB  PHE A 105     -11.804   3.799  -0.330  1.00  6.08          C   \nATOM    850  O   PHE A 105     -14.252   5.098   0.844  1.00  6.08          O   \nATOM    851  CG  PHE A 105     -11.481   2.744  -1.354  1.00  6.08          C   \nATOM    852  CD1 PHE A 105     -10.418   2.913  -2.234  1.00  6.08          C   \nATOM    853  CD2 PHE A 105     -12.239   1.584  -1.436  1.00  6.08          C   \nATOM    854  CE1 PHE A 105     -10.116   1.938  -3.182  1.00  6.08          C   \nATOM    855  CE2 PHE A 105     -11.944   0.606  -2.382  1.00  6.08          C   \nATOM    856  CZ  PHE A 105     -10.883   0.785  -3.254  1.00  6.08          C   \nATOM    857  N   GLY A 106     -15.105   4.749  -1.141  1.00  6.08          N   \nATOM    858  CA  GLY A 106     -16.469   4.462  -0.727  1.00  6.08          C   \nATOM    859  C   GLY A 106     -17.097   5.584   0.078  1.00  6.08          C   \nATOM    860  O   GLY A 106     -16.419   6.547   0.445  1.00  6.08          O   \nATOM    861  N   THR A 107     -18.460   5.770  -0.034  1.00  6.08          N   \nATOM    862  CA  THR A 107     -19.388   6.728   0.555  1.00  6.08          C   \nATOM    863  C   THR A 107     -20.150   6.098   1.717  1.00  6.08          C   \nATOM    864  CB  THR A 107     -20.386   7.256  -0.492  1.00  6.08          C   \nATOM    865  O   THR A 107     -21.036   5.267   1.507  1.00  6.08          O   \nATOM    866  CG2 THR A 107     -19.699   8.182  -1.490  1.00  6.08          C   \nATOM    867  OG1 THR A 107     -20.957   6.148  -1.200  1.00  6.08          O   \nATOM    868  N   ARG A 108     -19.518   5.476   2.709  1.00  6.08          N   \nATOM    869  CA  ARG A 108     -20.503   5.366   3.780  1.00  6.08          C   \nATOM    870  C   ARG A 108     -20.263   6.422   4.855  1.00  6.08          C   \nATOM    871  CB  ARG A 108     -20.469   3.968   4.402  1.00  6.08          C   \nATOM    872  O   ARG A 108     -19.123   6.646   5.268  1.00  6.08          O   \nATOM    873  CG  ARG A 108     -21.303   2.941   3.653  1.00  6.08          C   \nATOM    874  CD  ARG A 108     -21.351   1.609   4.389  1.00  6.08          C   \nATOM    875  NE  ARG A 108     -22.338   0.706   3.804  1.00  6.08          N   \nATOM    876  NH1 ARG A 108     -22.022  -0.977   5.356  1.00  6.08          N   \nATOM    877  NH2 ARG A 108     -23.549  -1.241   3.667  1.00  6.08          N   \nATOM    878  CZ  ARG A 108     -22.634  -0.502   4.277  1.00  6.08          C   \nATOM    879  N   THR A 109     -21.000   7.550   4.650  1.00  6.08          N   \nATOM    880  CA  THR A 109     -21.263   8.726   5.472  1.00  6.08          C   \nATOM    881  C   THR A 109     -21.852   8.323   6.821  1.00  6.08          C   \nATOM    882  CB  THR A 109     -22.219   9.702   4.762  1.00  6.08          C   \nATOM    883  O   THR A 109     -22.761   7.492   6.883  1.00  6.08          O   \nATOM    884  CG2 THR A 109     -21.477  10.545   3.730  1.00  6.08          C   \nATOM    885  OG1 THR A 109     -23.249   8.956   4.102  1.00  6.08          O   \nATOM    886  N   GLY A 110     -21.151   8.030   7.805  1.00  6.08          N   \nATOM    887  CA  GLY A 110     -21.715   8.302   9.117  1.00  6.08          C   \nATOM    888  C   GLY A 110     -20.888   7.731  10.253  1.00  6.08          C   \nATOM    889  O   GLY A 110     -20.720   6.514  10.354  1.00  6.08          O   \nATOM    890  N   GLY A 111     -20.142   8.505  10.862  1.00  6.08          N   \nATOM    891  CA  GLY A 111     -19.936   8.533  12.301  1.00  6.08          C   \nATOM    892  C   GLY A 111     -18.518   8.904  12.693  1.00  6.08          C   \nATOM    893  O   GLY A 111     -17.638   9.007  11.836  1.00  6.08          O   \nATOM    894  N   ASN A 112     -18.313   9.718  13.747  1.00  6.08          N   \nATOM    895  CA  ASN A 112     -17.174  10.179  14.534  1.00  6.08          C   \nATOM    896  C   ASN A 112     -16.127   9.082  14.702  1.00  6.08          C   \nATOM    897  CB  ASN A 112     -17.637  10.685  15.902  1.00  6.08          C   \nATOM    898  O   ASN A 112     -16.444   7.978  15.149  1.00  6.08          O   \nATOM    899  CG  ASN A 112     -18.364  12.013  15.817  1.00  6.08          C   \nATOM    900  ND2 ASN A 112     -19.255  12.262  16.770  1.00  6.08          N   \nATOM    901  OD1 ASN A 112     -18.128  12.807  14.904  1.00  6.08          O   \nATOM    902  N   PHE A 113     -14.987   8.972  14.050  1.00  6.08          N   \nATOM    903  CA  PHE A 113     -14.107   7.891  14.478  1.00  6.08          C   \nATOM    904  C   PHE A 113     -12.665   8.373  14.576  1.00  6.08          C   \nATOM    905  CB  PHE A 113     -14.201   6.706  13.512  1.00  6.08          C   \nATOM    906  O   PHE A 113     -12.245   9.251  13.819  1.00  6.08          O   \nATOM    907  CG  PHE A 113     -15.131   5.617  13.975  1.00  6.08          C   \nATOM    908  CD1 PHE A 113     -16.472   5.629  13.613  1.00  6.08          C   \nATOM    909  CD2 PHE A 113     -14.664   4.581  14.774  1.00  6.08          C   \nATOM    910  CE1 PHE A 113     -17.336   4.623  14.040  1.00  6.08          C   \nATOM    911  CE2 PHE A 113     -15.520   3.572  15.204  1.00  6.08          C   \nATOM    912  CZ  PHE A 113     -16.856   3.595  14.837  1.00  6.08          C   \nATOM    913  N   THR A 114     -11.825   7.651  15.237  1.00  6.08          N   \nATOM    914  CA  THR A 114     -10.413   7.467  15.554  1.00  6.08          C   \nATOM    915  C   THR A 114     -10.065   5.983  15.631  1.00  6.08          C   \nATOM    916  CB  THR A 114     -10.044   8.154  16.882  1.00  6.08          C   \nATOM    917  O   THR A 114     -10.307   5.336  16.652  1.00  6.08          O   \nATOM    918  CG2 THR A 114     -10.124   9.672  16.757  1.00  6.08          C   \nATOM    919  OG1 THR A 114     -10.951   7.722  17.904  1.00  6.08          O   \nATOM    920  N   GLY A 115     -10.385   5.096  14.476  1.00  6.08          N   \nATOM    921  CA  GLY A 115      -9.894   3.756  14.757  1.00  6.08          C   \nATOM    922  C   GLY A 115      -9.108   3.156  13.607  1.00  6.08          C   \nATOM    923  O   GLY A 115      -8.864   3.823  12.600  1.00  6.08          O   \nATOM    924  N   GLU A 116      -8.292   2.078  13.803  1.00  6.08          N   \nATOM    925  CA  GLU A 116      -7.455   1.166  13.029  1.00  6.08          C   \nATOM    926  C   GLU A 116      -8.271   0.435  11.966  1.00  6.08          C   \nATOM    927  CB  GLU A 116      -6.766   0.156  13.950  1.00  6.08          C   \nATOM    928  O   GLU A 116      -9.471   0.214  12.141  1.00  6.08          O   \nATOM    929  CG  GLU A 116      -5.620   0.745  14.760  1.00  6.08          C   \nATOM    930  CD  GLU A 116      -4.833  -0.301  15.533  1.00  6.08          C   \nATOM    931  OE1 GLU A 116      -3.793   0.046  16.138  1.00  6.08          O   \nATOM    932  OE2 GLU A 116      -5.258  -1.478  15.533  1.00  6.08          O   \nATOM    933  N   LEU A 117      -7.867   0.276  10.616  1.00  5.36          N   \nATOM    934  CA  LEU A 117      -8.515  -0.475   9.546  1.00  5.36          C   \nATOM    935  C   LEU A 117      -8.722  -1.930   9.952  1.00  5.36          C   \nATOM    936  CB  LEU A 117      -7.684  -0.404   8.263  1.00  5.36          C   \nATOM    937  O   LEU A 117      -7.933  -2.483  10.723  1.00  5.36          O   \nATOM    938  CG  LEU A 117      -7.563   0.973   7.608  1.00  5.36          C   \nATOM    939  CD1 LEU A 117      -6.504   0.947   6.511  1.00  5.36          C   \nATOM    940  CD2 LEU A 117      -8.910   1.418   7.048  1.00  5.36          C   \nATOM    941  N   THR A 118      -9.851  -2.455   9.647  1.00  5.36          N   \nATOM    942  CA  THR A 118     -10.035  -3.895   9.790  1.00  5.36          C   \nATOM    943  C   THR A 118      -9.157  -4.654   8.798  1.00  5.36          C   \nATOM    944  CB  THR A 118     -11.508  -4.294   9.584  1.00  5.36          C   \nATOM    945  O   THR A 118      -8.605  -4.060   7.869  1.00  5.36          O   \nATOM    946  CG2 THR A 118     -12.428  -3.487  10.493  1.00  5.36          C   \nATOM    947  OG1 THR A 118     -11.875  -4.057   8.219  1.00  5.36          O   \nATOM    948  N   LYS A 119      -8.889  -5.923   9.112  1.00  6.08          N   \nATOM    949  CA  LYS A 119      -8.123  -6.769   8.201  1.00  6.08          C   \nATOM    950  C   LYS A 119      -8.726  -6.753   6.799  1.00  6.08          C   \nATOM    951  CB  LYS A 119      -8.057  -8.204   8.727  1.00  6.08          C   \nATOM    952  O   LYS A 119      -8.000  -6.675   5.806  1.00  6.08          O   \nATOM    953  CG  LYS A 119      -7.022  -9.073   8.027  1.00  6.08          C   \nATOM    954  CD  LYS A 119      -6.951 -10.463   8.644  1.00  6.08          C   \nATOM    955  CE  LYS A 119      -6.004 -11.371   7.872  1.00  6.08          C   \nATOM    956  NZ  LYS A 119      -5.944 -12.741   8.463  1.00  6.08          N   \nATOM    957  N   GLN A 120     -10.033  -6.874   6.687  1.00  6.08          N   \nATOM    958  CA  GLN A 120     -10.739  -6.867   5.410  1.00  6.08          C   \nATOM    959  C   GLN A 120     -10.510  -5.558   4.661  1.00  6.08          C   \nATOM    960  CB  GLN A 120     -12.236  -7.096   5.623  1.00  6.08          C   \nATOM    961  O   GLN A 120     -10.287  -5.560   3.449  1.00  6.08          O   \nATOM    962  CG  GLN A 120     -12.965  -7.594   4.383  1.00  6.08          C   \nATOM    963  CD  GLN A 120     -14.269  -8.298   4.711  1.00  6.08          C   \nATOM    964  NE2 GLN A 120     -14.806  -9.032   3.742  1.00  6.08          N   \nATOM    965  OE1 GLN A 120     -14.788  -8.184   5.826  1.00  6.08          O   \nATOM    966  N   GLU A 121     -10.563  -4.457   5.339  1.00  5.36          N   \nATOM    967  CA  GLU A 121     -10.315  -3.150   4.738  1.00  5.36          C   \nATOM    968  C   GLU A 121      -8.891  -3.052   4.198  1.00  5.36          C   \nATOM    969  CB  GLU A 121     -10.571  -2.034   5.753  1.00  5.36          C   \nATOM    970  O   GLU A 121      -8.667  -2.500   3.119  1.00  5.36          O   \nATOM    971  CG  GLU A 121     -12.041  -1.836   6.092  1.00  5.36          C   \nATOM    972  CD  GLU A 121     -12.266  -0.891   7.262  1.00  5.36          C   \nATOM    973  OE1 GLU A 121     -13.256  -0.126   7.243  1.00  5.36          O   \nATOM    974  OE2 GLU A 121     -11.443  -0.916   8.205  1.00  5.36          O   \nATOM    975  N   LEU A 122      -7.942  -3.571   4.960  1.00  5.36          N   \nATOM    976  CA  LEU A 122      -6.554  -3.544   4.512  1.00  5.36          C   \nATOM    977  C   LEU A 122      -6.385  -4.331   3.217  1.00  5.36          C   \nATOM    978  CB  LEU A 122      -5.632  -4.115   5.593  1.00  5.36          C   \nATOM    979  O   LEU A 122      -5.705  -3.876   2.294  1.00  5.36          O   \nATOM    980  CG  LEU A 122      -5.295  -3.183   6.758  1.00  5.36          C   \nATOM    981  CD1 LEU A 122      -4.667  -3.971   7.903  1.00  5.36          C   \nATOM    982  CD2 LEU A 122      -4.365  -2.066   6.298  1.00  5.36          C   \nATOM    983  N   VAL A 123      -6.991  -5.567   3.232  1.00  5.36          N   \nATOM    984  CA  VAL A 123      -6.926  -6.409   2.042  1.00  5.36          C   \nATOM    985  C   VAL A 123      -7.518  -5.664   0.848  1.00  5.36          C   \nATOM    986  CB  VAL A 123      -7.667  -7.749   2.255  1.00  5.36          C   \nATOM    987  O   VAL A 123      -6.921  -5.633  -0.230  1.00  5.36          O   \nATOM    988  CG1 VAL A 123      -7.796  -8.509   0.936  1.00  5.36          C   \nATOM    989  CG2 VAL A 123      -6.942  -8.599   3.296  1.00  5.36          C   \nATOM    990  N   TYR A 124      -8.671  -5.070   1.043  1.00  5.36          N   \nATOM    991  CA  TYR A 124      -9.359  -4.338  -0.015  1.00  5.36          C   \nATOM    992  C   TYR A 124      -8.521  -3.160  -0.496  1.00  5.36          C   \nATOM    993  CB  TYR A 124     -10.724  -3.844   0.473  1.00  5.36          C   \nATOM    994  O   TYR A 124      -8.387  -2.937  -1.702  1.00  5.36          O   \nATOM    995  CG  TYR A 124     -11.884  -4.667  -0.033  1.00  5.36          C   \nATOM    996  CD1 TYR A 124     -12.554  -5.552   0.808  1.00  5.36          C   \nATOM    997  CD2 TYR A 124     -12.312  -4.561  -1.352  1.00  5.36          C   \nATOM    998  CE1 TYR A 124     -13.622  -6.314   0.346  1.00  5.36          C   \nATOM    999  CE2 TYR A 124     -13.379  -5.318  -1.825  1.00  5.36          C   \nATOM   1000  OH  TYR A 124     -15.084  -6.942  -1.432  1.00  5.36          O   \nATOM   1001  CZ  TYR A 124     -14.027  -6.190  -0.969  1.00  5.36          C   \nATOM   1002  N   THR A 125      -8.064  -2.317   0.476  1.00  5.36          N   \nATOM   1003  CA  THR A 125      -7.230  -1.175   0.117  1.00  5.36          C   \nATOM   1004  C   THR A 125      -6.008  -1.626  -0.679  1.00  5.36          C   \nATOM   1005  CB  THR A 125      -6.774  -0.402   1.368  1.00  5.36          C   \nATOM   1006  O   THR A 125      -5.643  -0.999  -1.675  1.00  5.36          O   \nATOM   1007  CG2 THR A 125      -7.392   0.992   1.408  1.00  5.36          C   \nATOM   1008  OG1 THR A 125      -7.173  -1.123   2.540  1.00  5.36          O   \nATOM   1009  N   ASN A 126      -5.437  -2.705  -0.271  1.00  5.36          N   \nATOM   1010  CA  ASN A 126      -4.265  -3.214  -0.977  1.00  5.36          C   \nATOM   1011  C   ASN A 126      -4.614  -3.656  -2.395  1.00  5.36          C   \nATOM   1012  CB  ASN A 126      -3.631  -4.370  -0.201  1.00  5.36          C   \nATOM   1013  O   ASN A 126      -3.866  -3.384  -3.336  1.00  5.36          O   \nATOM   1014  CG  ASN A 126      -2.693  -3.896   0.891  1.00  5.36          C   \nATOM   1015  ND2 ASN A 126      -2.429  -4.760   1.864  1.00  5.36          N   \nATOM   1016  OD1 ASN A 126      -2.209  -2.761   0.861  1.00  5.36          O   \nATOM   1017  N   GLN A 127      -5.691  -4.483  -2.497  1.00  5.36          N   \nATOM   1018  CA  GLN A 127      -6.138  -4.897  -3.823  1.00  5.36          C   \nATOM   1019  C   GLN A 127      -6.385  -3.689  -4.722  1.00  5.36          C   \nATOM   1020  CB  GLN A 127      -7.407  -5.744  -3.721  1.00  5.36          C   \nATOM   1021  O   GLN A 127      -5.973  -3.679  -5.884  1.00  5.36          O   \nATOM   1022  CG  GLN A 127      -7.729  -6.525  -4.989  1.00  5.36          C   \nATOM   1023  CD  GLN A 127      -8.927  -7.440  -4.826  1.00  5.36          C   \nATOM   1024  NE2 GLN A 127      -9.350  -8.064  -5.921  1.00  5.36          N   \nATOM   1025  OE1 GLN A 127      -9.468  -7.587  -3.726  1.00  5.36          O   \nATOM   1026  N   TRP A 128      -7.149  -2.688  -4.151  1.00  5.36          N   \nATOM   1027  CA  TRP A 128      -7.418  -1.471  -4.911  1.00  5.36          C   \nATOM   1028  C   TRP A 128      -6.119  -0.818  -5.371  1.00  5.36          C   \nATOM   1029  CB  TRP A 128      -8.232  -0.482  -4.072  1.00  5.36          C   \nATOM   1030  O   TRP A 128      -5.992  -0.427  -6.534  1.00  5.36          O   \nATOM   1031  CG  TRP A 128      -8.637   0.757  -4.813  1.00  5.36          C   \nATOM   1032  CD1 TRP A 128      -9.759   0.931  -5.576  1.00  5.36          C   \nATOM   1033  CD2 TRP A 128      -7.919   1.993  -4.866  1.00  5.36          C   \nATOM   1034  CE2 TRP A 128      -8.665   2.875  -5.680  1.00  5.36          C   \nATOM   1035  CE3 TRP A 128      -6.717   2.442  -4.304  1.00  5.36          C   \nATOM   1036  NE1 TRP A 128      -9.781   2.203  -6.099  1.00  5.36          N   \nATOM   1037  CH2 TRP A 128      -7.067   4.595  -5.381  1.00  5.36          C   \nATOM   1038  CZ2 TRP A 128      -8.247   4.181  -5.944  1.00  5.36          C   \nATOM   1039  CZ3 TRP A 128      -6.302   3.742  -4.568  1.00  5.36          C   \nATOM   1040  N   VAL A 129      -5.185  -0.613  -4.368  1.00  4.42          N   \nATOM   1041  CA  VAL A 129      -3.899  -0.000  -4.687  1.00  4.42          C   \nATOM   1042  C   VAL A 129      -3.213  -0.789  -5.800  1.00  4.42          C   \nATOM   1043  CB  VAL A 129      -2.983   0.077  -3.446  1.00  4.42          C   \nATOM   1044  O   VAL A 129      -2.691  -0.205  -6.753  1.00  4.42          O   \nATOM   1045  CG1 VAL A 129      -1.562   0.471  -3.846  1.00  4.42          C   \nATOM   1046  CG2 VAL A 129      -3.548   1.065  -2.427  1.00  4.42          C   \nATOM   1047  N   ASN A 130      -3.323  -2.084  -5.765  1.00  5.36          N   \nATOM   1048  CA  ASN A 130      -2.699  -2.948  -6.762  1.00  5.36          C   \nATOM   1049  C   ASN A 130      -3.320  -2.751  -8.142  1.00  5.36          C   \nATOM   1050  CB  ASN A 130      -2.799  -4.415  -6.339  1.00  5.36          C   \nATOM   1051  O   ASN A 130      -2.613  -2.751  -9.151  1.00  5.36          O   \nATOM   1052  CG  ASN A 130      -1.767  -4.793  -5.294  1.00  5.36          C   \nATOM   1053  ND2 ASN A 130      -2.027  -5.874  -4.568  1.00  5.36          N   \nATOM   1054  OD1 ASN A 130      -0.746  -4.118  -5.140  1.00  5.36          O   \nATOM   1055  N   GLU A 131      -4.600  -2.603  -8.153  1.00  5.36          N   \nATOM   1056  CA  GLU A 131      -5.337  -2.535  -9.412  1.00  5.36          C   \nATOM   1057  C   GLU A 131      -5.256  -1.140 -10.024  1.00  5.36          C   \nATOM   1058  CB  GLU A 131      -6.800  -2.932  -9.200  1.00  5.36          C   \nATOM   1059  O   GLU A 131      -5.324  -0.988 -11.246  1.00  5.36          O   \nATOM   1060  CG  GLU A 131      -7.000  -4.413  -8.911  1.00  5.36          C   \nATOM   1061  CD  GLU A 131      -8.445  -4.776  -8.611  1.00  5.36          C   \nATOM   1062  OE1 GLU A 131      -8.733  -5.970  -8.365  1.00  5.36          O   \nATOM   1063  OE2 GLU A 131      -9.297  -3.860  -8.623  1.00  5.36          O   \nATOM   1064  N   ASN A 132      -5.147  -0.162  -9.186  1.00  5.36          N   \nATOM   1065  CA  ASN A 132      -5.357   1.190  -9.693  1.00  5.36          C   \nATOM   1066  C   ASN A 132      -4.037   1.936  -9.863  1.00  5.36          C   \nATOM   1067  CB  ASN A 132      -6.292   1.971  -8.767  1.00  5.36          C   \nATOM   1068  O   ASN A 132      -3.931   2.838 -10.696  1.00  5.36          O   \nATOM   1069  CG  ASN A 132      -7.729   1.494  -8.851  1.00  5.36          C   \nATOM   1070  ND2 ASN A 132      -8.165   0.745  -7.845  1.00  5.36          N   \nATOM   1071  OD1 ASN A 132      -8.441   1.795  -9.813  1.00  5.36          O   \nATOM   1072  N   ILE A 133      -3.015   1.608  -8.992  1.00  5.36          N   \nATOM   1073  CA  ILE A 133      -1.781   2.384  -9.062  1.00  5.36          C   \nATOM   1074  C   ILE A 133      -0.907   1.861 -10.200  1.00  5.36          C   \nATOM   1075  CB  ILE A 133      -1.007   2.336  -7.726  1.00  5.36          C   \nATOM   1076  O   ILE A 133      -0.112   2.609 -10.773  1.00  5.36          O   \nATOM   1077  CG1 ILE A 133      -1.777   3.089  -6.635  1.00  5.36          C   \nATOM   1078  CG2 ILE A 133       0.402   2.911  -7.897  1.00  5.36          C   \nATOM   1079  CD1 ILE A 133      -1.113   3.045  -5.266  1.00  5.36          C   \nATOM   1080  N   THR A 134      -1.214   0.937 -10.975  1.00  6.08          N   \nATOM   1081  CA  THR A 134      -0.412   0.479 -12.104  1.00  6.08          C   \nATOM   1082  C   THR A 134      -0.466   1.485 -13.250  1.00  6.08          C   \nATOM   1083  CB  THR A 134      -0.887  -0.898 -12.605  1.00  6.08          C   \nATOM   1084  O   THR A 134       0.513   1.656 -13.980  1.00  6.08          O   \nATOM   1085  CG2 THR A 134       0.024  -2.012 -12.097  1.00  6.08          C   \nATOM   1086  OG1 THR A 134      -2.220  -1.137 -12.137  1.00  6.08          O   \nATOM   1087  N   LEU A 135      -1.656   2.194 -13.502  1.00  6.08          N   \nATOM   1088  CA  LEU A 135      -2.187   2.386 -14.847  1.00  6.08          C   \nATOM   1089  C   LEU A 135      -2.051   3.841 -15.283  1.00  6.08          C   \nATOM   1090  CB  LEU A 135      -3.656   1.958 -14.908  1.00  6.08          C   \nATOM   1091  O   LEU A 135      -2.144   4.147 -16.474  1.00  6.08          O   \nATOM   1092  CG  LEU A 135      -3.923   0.452 -14.925  1.00  6.08          C   \nATOM   1093  CD1 LEU A 135      -5.388   0.171 -14.609  1.00  6.08          C   \nATOM   1094  CD2 LEU A 135      -3.538  -0.144 -16.274  1.00  6.08          C   \nATOM   1095  N   ALA A 136      -1.314   4.761 -14.697  1.00  6.08          N   \nATOM   1096  CA  ALA A 136      -1.322   5.912 -15.597  1.00  6.08          C   \nATOM   1097  C   ALA A 136       0.036   6.607 -15.610  1.00  6.08          C   \nATOM   1098  CB  ALA A 136      -2.417   6.896 -15.193  1.00  6.08          C   \nATOM   1099  O   ALA A 136       0.626   6.851 -14.555  1.00  6.08          O   \nATOM   1100  N   ASN A 137       1.001   6.147 -16.376  1.00  6.08          N   \nATOM   1101  CA  ASN A 137       1.962   7.100 -16.923  1.00  6.08          C   \nATOM   1102  C   ASN A 137       2.561   7.982 -15.832  1.00  6.08          C   \nATOM   1103  CB  ASN A 137       1.305   7.963 -18.003  1.00  6.08          C   \nATOM   1104  O   ASN A 137       2.685   9.196 -16.007  1.00  6.08          O   \nATOM   1105  CG  ASN A 137       1.244   7.267 -19.349  1.00  6.08          C   \nATOM   1106  ND2 ASN A 137       0.354   7.734 -20.218  1.00  6.08          N   \nATOM   1107  OD1 ASN A 137       1.989   6.318 -19.606  1.00  6.08          O   \nATOM   1108  N   GLY A 138       2.939   7.445 -14.762  1.00  6.08          N   \nATOM   1109  CA  GLY A 138       3.642   8.286 -13.808  1.00  6.08          C   \nATOM   1110  C   GLY A 138       2.721   9.212 -13.036  1.00  6.08          C   \nATOM   1111  O   GLY A 138       3.179  10.003 -12.209  1.00  6.08          O   \nATOM   1112  N   TYR A 139       1.463   9.234 -13.302  1.00  6.08          N   \nATOM   1113  CA  TYR A 139       0.469  10.113 -12.696  1.00  6.08          C   \nATOM   1114  C   TYR A 139      -0.736   9.318 -12.207  1.00  6.08          C   \nATOM   1115  CB  TYR A 139       0.019  11.184 -13.694  1.00  6.08          C   \nATOM   1116  O   TYR A 139      -1.121   8.321 -12.822  1.00  6.08          O   \nATOM   1117  CG  TYR A 139       0.919  12.395 -13.732  1.00  6.08          C   \nATOM   1118  CD1 TYR A 139       1.986  12.467 -14.625  1.00  6.08          C   \nATOM   1119  CD2 TYR A 139       0.705  13.469 -12.874  1.00  6.08          C   \nATOM   1120  CE1 TYR A 139       2.819  13.580 -14.662  1.00  6.08          C   \nATOM   1121  CE2 TYR A 139       1.532  14.587 -12.903  1.00  6.08          C   \nATOM   1122  OH  TYR A 139       3.406  15.738 -13.831  1.00  6.08          O   \nATOM   1123  CZ  TYR A 139       2.584  14.634 -13.799  1.00  6.08          C   \nATOM   1124  N   ILE A 140      -0.939   9.058 -10.837  1.00  6.08          N   \nATOM   1125  CA  ILE A 140      -2.155   8.654 -10.138  1.00  6.08          C   \nATOM   1126  C   ILE A 140      -3.276   9.645 -10.440  1.00  6.08          C   \nATOM   1127  CB  ILE A 140      -1.924   8.553  -8.614  1.00  6.08          C   \nATOM   1128  O   ILE A 140      -3.182  10.824 -10.091  1.00  6.08          O   \nATOM   1129  CG1 ILE A 140      -0.789   7.569  -8.310  1.00  6.08          C   \nATOM   1130  CG2 ILE A 140      -3.213   8.140  -7.899  1.00  6.08          C   \nATOM   1131  CD1 ILE A 140      -0.415   7.492  -6.836  1.00  6.08          C   \nATOM   1132  N   SER A 141      -3.684   9.839 -11.715  1.00  6.08          N   \nATOM   1133  CA  SER A 141      -4.883  10.669 -11.786  1.00  6.08          C   \nATOM   1134  C   SER A 141      -6.105   9.922 -11.262  1.00  6.08          C   \nATOM   1135  CB  SER A 141      -5.133  11.127 -13.224  1.00  6.08          C   \nATOM   1136  O   SER A 141      -6.378   8.796 -11.682  1.00  6.08          O   \nATOM   1137  OG  SER A 141      -6.496  10.963 -13.574  1.00  6.08          O   \nATOM   1138  N   ALA A 142      -6.198   9.687  -9.878  1.00  6.08          N   \nATOM   1139  CA  ALA A 142      -7.356   9.155  -9.164  1.00  6.08          C   \nATOM   1140  C   ALA A 142      -8.656   9.539  -9.865  1.00  6.08          C   \nATOM   1141  CB  ALA A 142      -7.366   9.651  -7.721  1.00  6.08          C   \nATOM   1142  O   ALA A 142      -8.874  10.710 -10.184  1.00  6.08          O   \nATOM   1143  N   ASP A 143      -9.016   8.898 -10.877  1.00  6.08          N   \nATOM   1144  CA  ASP A 143     -10.425   8.964 -11.253  1.00  6.08          C   \nATOM   1145  C   ASP A 143     -11.295   9.345 -10.057  1.00  6.08          C   \nATOM   1146  CB  ASP A 143     -10.889   7.628 -11.836  1.00  6.08          C   \nATOM   1147  O   ASP A 143     -11.158   8.769  -8.975  1.00  6.08          O   \nATOM   1148  CG  ASP A 143     -11.385   7.746 -13.267  1.00  6.08          C   \nATOM   1149  OD1 ASP A 143     -11.573   6.706 -13.934  1.00  6.08          O   \nATOM   1150  OD2 ASP A 143     -11.586   8.889 -13.731  1.00  6.08          O   \nATOM   1151  N   SER A 144     -11.432  10.610  -9.724  1.00  6.08          N   \nATOM   1152  CA  SER A 144     -12.633  11.251  -9.197  1.00  6.08          C   \nATOM   1153  C   SER A 144     -13.803  10.274  -9.147  1.00  6.08          C   \nATOM   1154  CB  SER A 144     -13.009  12.466 -10.046  1.00  6.08          C   \nATOM   1155  O   SER A 144     -14.946  10.678  -8.919  1.00  6.08          O   \nATOM   1156  OG  SER A 144     -12.987  12.143 -11.426  1.00  6.08          O   \nATOM   1157  N   ARG A 145     -13.625   8.971  -9.055  1.00  6.08          N   \nATOM   1158  CA  ARG A 145     -14.877   8.231  -8.942  1.00  6.08          C   \nATOM   1159  C   ARG A 145     -15.517   8.442  -7.574  1.00  6.08          C   \nATOM   1160  CB  ARG A 145     -14.644   6.738  -9.187  1.00  6.08          C   \nATOM   1161  O   ARG A 145     -14.826   8.444  -6.554  1.00  6.08          O   \nATOM   1162  CG  ARG A 145     -14.402   6.383 -10.645  1.00  6.08          C   \nATOM   1163  CD  ARG A 145     -14.336   4.877 -10.856  1.00  6.08          C   \nATOM   1164  NE  ARG A 145     -13.186   4.497 -11.671  1.00  6.08          N   \nATOM   1165  NH1 ARG A 145     -13.735   2.255 -11.769  1.00  6.08          N   \nATOM   1166  NH2 ARG A 145     -11.852   3.025 -12.824  1.00  6.08          N   \nATOM   1167  CZ  ARG A 145     -12.927   3.260 -12.086  1.00  6.08          C   \nATOM   1168  N   THR A 146     -16.379   9.419  -7.415  1.00  6.08          N   \nATOM   1169  CA  THR A 146     -17.507   9.485  -6.494  1.00  6.08          C   \nATOM   1170  C   THR A 146     -18.280   8.169  -6.491  1.00  6.08          C   \nATOM   1171  CB  THR A 146     -18.458  10.641  -6.856  1.00  6.08          C   \nATOM   1172  O   THR A 146     -18.534   7.590  -7.549  1.00  6.08          O   \nATOM   1173  CG2 THR A 146     -18.028  11.939  -6.180  1.00  6.08          C   \nATOM   1174  OG1 THR A 146     -18.451  10.830  -8.276  1.00  6.08          O   \nATOM   1175  N   VAL A 147     -17.785   7.142  -5.708  1.00  6.08          N   \nATOM   1176  CA  VAL A 147     -18.621   5.978  -5.435  1.00  6.08          C   \nATOM   1177  C   VAL A 147     -20.048   6.427  -5.126  1.00  6.08          C   \nATOM   1178  CB  VAL A 147     -18.061   5.139  -4.264  1.00  6.08          C   \nATOM   1179  O   VAL A 147     -20.261   7.305  -4.287  1.00  6.08          O   \nATOM   1180  CG1 VAL A 147     -18.638   3.725  -4.289  1.00  6.08          C   \nATOM   1181  CG2 VAL A 147     -16.535   5.098  -4.321  1.00  6.08          C   \nATOM   1182  N   ASP A 148     -20.960   6.728  -6.190  1.00  6.08          N   \nATOM   1183  CA  ASP A 148     -22.394   6.829  -5.938  1.00  6.08          C   \nATOM   1184  C   ASP A 148     -22.901   5.619  -5.157  1.00  6.08          C   \nATOM   1185  CB  ASP A 148     -23.162   6.965  -7.254  1.00  6.08          C   \nATOM   1186  O   ASP A 148     -22.505   4.485  -5.432  1.00  6.08          O   \nATOM   1187  CG  ASP A 148     -22.902   8.285  -7.959  1.00  6.08          C   \nATOM   1188  OD1 ASP A 148     -23.140   8.380  -9.182  1.00  6.08          O   \nATOM   1189  OD2 ASP A 148     -22.451   9.237  -7.286  1.00  6.08          O   \nTER    1190      ASP A 148\nENDMDL\nEND\n"
  },
  {
    "path": "alphafold/relax/testdata/with_violations_casp14.pdb",
    "content": "MODEL        0\nATOM      1  N   SER A   1      27.311  -3.395  37.375  1.00  8.64          N   \nATOM      2  CA  SER A   1      26.072  -4.109  37.084  1.00  8.64          C   \nATOM      3  C   SER A   1      26.047  -4.608  35.643  1.00  8.64          C   \nATOM      4  CB  SER A   1      24.862  -3.211  37.342  1.00  8.64          C   \nATOM      5  O   SER A   1      26.782  -4.101  34.792  1.00  8.64          O   \nATOM      6  OG  SER A   1      24.740  -2.228  36.329  1.00  8.64          O   \nATOM      7  N   PHE A   2      25.619  -5.987  35.357  1.00  8.64          N   \nATOM      8  CA  PHE A   2      25.448  -6.479  33.995  1.00  8.64          C   \nATOM      9  C   PHE A   2      25.049  -5.347  33.056  1.00  8.64          C   \nATOM     10  CB  PHE A   2      24.395  -7.591  33.953  1.00  8.64          C   \nATOM     11  O   PHE A   2      25.590  -5.226  31.955  1.00  8.64          O   \nATOM     12  CG  PHE A   2      24.140  -8.134  32.573  1.00  8.64          C   \nATOM     13  CD1 PHE A   2      25.003  -9.063  32.006  1.00  8.64          C   \nATOM     14  CD2 PHE A   2      23.036  -7.714  31.842  1.00  8.64          C   \nATOM     15  CE1 PHE A   2      24.770  -9.567  30.728  1.00  8.64          C   \nATOM     16  CE2 PHE A   2      22.796  -8.214  30.565  1.00  8.64          C   \nATOM     17  CZ  PHE A   2      23.665  -9.139  30.010  1.00  8.64          C   \nATOM     18  N   GLU A   3      24.279  -4.453  33.583  1.00  8.64          N   \nATOM     19  CA  GLU A   3      23.756  -3.316  32.831  1.00  8.64          C   \nATOM     20  C   GLU A   3      24.858  -2.308  32.517  1.00  8.64          C   \nATOM     21  CB  GLU A   3      22.624  -2.635  33.604  1.00  8.64          C   \nATOM     22  O   GLU A   3      24.963  -1.828  31.387  1.00  8.64          O   \nATOM     23  CG  GLU A   3      21.251  -3.239  33.345  1.00  8.64          C   \nATOM     24  CD  GLU A   3      20.291  -3.067  34.511  1.00  8.64          C   \nATOM     25  OE1 GLU A   3      19.129  -3.525  34.413  1.00  8.64          O   \nATOM     26  OE2 GLU A   3      20.702  -2.469  35.530  1.00  8.64          O   \nATOM     27  N   GLU A   4      25.795  -2.118  33.499  1.00  8.64          N   \nATOM     28  CA  GLU A   4      26.873  -1.150  33.321  1.00  8.64          C   \nATOM     29  C   GLU A   4      27.923  -1.667  32.341  1.00  8.64          C   \nATOM     30  CB  GLU A   4      27.526  -0.820  34.666  1.00  8.64          C   \nATOM     31  O   GLU A   4      28.401  -0.920  31.485  1.00  8.64          O   \nATOM     32  CG  GLU A   4      26.709   0.130  35.529  1.00  8.64          C   \nATOM     33  CD  GLU A   4      27.351   0.416  36.878  1.00  8.64          C   \nATOM     34  OE1 GLU A   4      26.801   1.234  37.650  1.00  8.64          O   \nATOM     35  OE2 GLU A   4      28.412  -0.182  37.164  1.00  8.64          O   \nATOM     36  N   GLN A   5      28.078  -2.983  32.335  1.00  8.64          N   \nATOM     37  CA  GLN A   5      29.050  -3.614  31.449  1.00  8.64          C   \nATOM     38  C   GLN A   5      28.520  -3.696  30.020  1.00  8.64          C   \nATOM     39  CB  GLN A   5      29.410  -5.012  31.956  1.00  8.64          C   \nATOM     40  O   GLN A   5      29.268  -3.487  29.063  1.00  8.64          O   \nATOM     41  CG  GLN A   5      30.587  -5.031  32.922  1.00  8.64          C   \nATOM     42  CD  GLN A   5      30.906  -6.425  33.430  1.00  8.64          C   \nATOM     43  NE2 GLN A   5      31.803  -6.509  34.407  1.00  8.64          N   \nATOM     44  OE1 GLN A   5      30.350  -7.418  32.950  1.00  8.64          O   \nATOM     45  N   PHE A   6      27.127  -3.824  29.849  1.00  8.64          N   \nATOM     46  CA  PHE A   6      26.442  -3.868  28.562  1.00  8.64          C   \nATOM     47  C   PHE A   6      26.501  -2.512  27.870  1.00  8.64          C   \nATOM     48  CB  PHE A   6      24.983  -4.302  28.744  1.00  8.64          C   \nATOM     49  O   PHE A   6      26.819  -2.429  26.682  1.00  8.64          O   \nATOM     50  CG  PHE A   6      24.232  -4.461  27.450  1.00  8.64          C   \nATOM     51  CD1 PHE A   6      24.326  -5.636  26.715  1.00  8.64          C   \nATOM     52  CD2 PHE A   6      23.431  -3.434  26.968  1.00  8.64          C   \nATOM     53  CE1 PHE A   6      23.631  -5.786  25.517  1.00  8.64          C   \nATOM     54  CE2 PHE A   6      22.734  -3.576  25.771  1.00  8.64          C   \nATOM     55  CZ  PHE A   6      22.836  -4.753  25.047  1.00  8.64          C   \nATOM     56  N   ILE A   7      26.367  -1.421  28.620  1.00  8.64          N   \nATOM     57  CA  ILE A   7      26.395  -0.058  28.103  1.00  8.64          C   \nATOM     58  C   ILE A   7      27.816   0.304  27.677  1.00  8.64          C   \nATOM     59  CB  ILE A   7      25.874   0.954  29.148  1.00  8.64          C   \nATOM     60  O   ILE A   7      28.020   0.896  26.614  1.00  8.64          O   \nATOM     61  CG1 ILE A   7      24.383   0.725  29.417  1.00  8.64          C   \nATOM     62  CG2 ILE A   7      26.133   2.391  28.685  1.00  8.64          C   \nATOM     63  CD1 ILE A   7      23.831   1.540  30.579  1.00  8.64          C   \nATOM     64  N   LYS A   8      28.765  -0.137  28.420  1.00  8.64          N   \nATOM     65  CA  LYS A   8      30.171   0.158  28.160  1.00  8.64          C   \nATOM     66  C   LYS A   8      30.668  -0.584  26.922  1.00  8.64          C   \nATOM     67  CB  LYS A   8      31.030  -0.210  29.371  1.00  8.64          C   \nATOM     68  O   LYS A   8      31.368  -0.008  26.086  1.00  8.64          O   \nATOM     69  CG  LYS A   8      32.396   0.462  29.387  1.00  8.64          C   \nATOM     70  CD  LYS A   8      33.170   0.123  30.655  1.00  8.64          C   \nATOM     71  CE  LYS A   8      34.584   0.686  30.615  1.00  8.64          C   \nATOM     72  NZ  LYS A   8      35.350   0.348  31.852  1.00  8.64          N   \nATOM     73  N   ASN A   9      30.138  -1.772  26.738  1.00  8.64          N   \nATOM     74  CA  ASN A   9      30.622  -2.602  25.640  1.00  8.64          C   \nATOM     75  C   ASN A   9      29.908  -2.274  24.332  1.00  8.64          C   \nATOM     76  CB  ASN A   9      30.461  -4.086  25.976  1.00  8.64          C   \nATOM     77  O   ASN A   9      30.396  -2.610  23.252  1.00  8.64          O   \nATOM     78  CG  ASN A   9      31.429  -4.551  27.046  1.00  8.64          C   \nATOM     79  ND2 ASN A   9      31.123  -5.682  27.670  1.00  8.64          N   \nATOM     80  OD1 ASN A   9      32.442  -3.898  27.310  1.00  8.64          O   \nATOM     81  N   ASN A  10      28.860  -1.389  24.447  1.00  8.64          N   \nATOM     82  CA  ASN A  10      28.104  -1.128  23.227  1.00  8.64          C   \nATOM     83  C   ASN A  10      28.029   0.366  22.923  1.00  8.64          C   \nATOM     84  CB  ASN A  10      26.697  -1.720  23.330  1.00  8.64          C   \nATOM     85  O   ASN A  10      27.356   0.778  21.977  1.00  8.64          O   \nATOM     86  CG  ASN A  10      26.693  -3.234  23.250  1.00  8.64          C   \nATOM     87  ND2 ASN A  10      26.544  -3.888  24.396  1.00  8.64          N   \nATOM     88  OD1 ASN A  10      26.823  -3.811  22.167  1.00  8.64          O   \nATOM     89  N   SER A  11      28.833   1.149  23.636  1.00  8.64          N   \nATOM     90  CA  SER A  11      28.835   2.602  23.500  1.00  8.64          C   \nATOM     91  C   SER A  11      29.617   3.040  22.266  1.00  8.64          C   \nATOM     92  CB  SER A  11      29.427   3.257  24.748  1.00  8.64          C   \nATOM     93  O   SER A  11      29.395   4.132  21.740  1.00  8.64          O   \nATOM     94  OG  SER A  11      30.701   2.712  25.046  1.00  8.64          O   \nATOM     95  N   ASP A  12      30.212   2.067  21.630  1.00  8.64          N   \nATOM     96  CA  ASP A  12      30.855   2.541  20.408  1.00  8.64          C   \nATOM     97  C   ASP A  12      29.975   2.284  19.188  1.00  8.64          C   \nATOM     98  CB  ASP A  12      32.218   1.871  20.224  1.00  8.64          C   \nATOM     99  O   ASP A  12      30.218   2.836  18.113  1.00  8.64          O   \nATOM    100  CG  ASP A  12      33.270   2.391  21.189  1.00  8.64          C   \nATOM    101  OD1 ASP A  12      34.250   1.668  21.471  1.00  8.64          O   \nATOM    102  OD2 ASP A  12      33.116   3.533  21.673  1.00  8.64          O   \nATOM    103  N   SER A  13      28.711   1.753  19.485  1.00  8.64          N   \nATOM    104  CA  SER A  13      27.850   1.458  18.344  1.00  8.64          C   \nATOM    105  C   SER A  13      26.738   2.492  18.209  1.00  8.64          C   \nATOM    106  CB  SER A  13      27.245   0.060  18.477  1.00  8.64          C   \nATOM    107  O   SER A  13      26.268   3.040  19.208  1.00  8.64          O   \nATOM    108  OG  SER A  13      26.522  -0.062  19.690  1.00  8.64          O   \nATOM    109  N   ASN A  14      26.876   3.556  17.578  1.00  8.64          N   \nATOM    110  CA  ASN A  14      25.876   4.507  17.103  1.00  8.64          C   \nATOM    111  C   ASN A  14      24.502   3.857  16.973  1.00  8.64          C   \nATOM    112  CB  ASN A  14      26.306   5.114  15.766  1.00  8.64          C   \nATOM    113  O   ASN A  14      23.638   4.361  16.252  1.00  8.64          O   \nATOM    114  CG  ASN A  14      27.367   6.185  15.925  1.00  8.64          C   \nATOM    115  ND2 ASN A  14      28.105   6.452  14.854  1.00  8.64          N   \nATOM    116  OD1 ASN A  14      27.523   6.767  17.002  1.00  8.64          O   \nATOM    117  N   ILE A  15      24.147   2.876  17.739  1.00  8.64          N   \nATOM    118  CA  ILE A  15      22.782   2.392  17.562  1.00  8.64          C   \nATOM    119  C   ILE A  15      21.867   3.040  18.600  1.00  8.64          C   \nATOM    120  CB  ILE A  15      22.709   0.853  17.670  1.00  8.64          C   \nATOM    121  O   ILE A  15      22.173   3.037  19.794  1.00  8.64          O   \nATOM    122  CG1 ILE A  15      23.583   0.200  16.594  1.00  8.64          C   \nATOM    123  CG2 ILE A  15      21.259   0.372  17.564  1.00  8.64          C   \nATOM    124  CD1 ILE A  15      23.694  -1.313  16.720  1.00  8.64          C   \nATOM    125  N   LEU A  16      21.054   3.988  18.304  1.00  8.64          N   \nATOM    126  CA  LEU A  16      19.978   4.667  19.017  1.00  8.64          C   \nATOM    127  C   LEU A  16      18.932   3.668  19.501  1.00  8.64          C   \nATOM    128  CB  LEU A  16      19.320   5.718  18.120  1.00  8.64          C   \nATOM    129  O   LEU A  16      18.483   2.813  18.734  1.00  8.64          O   \nATOM    130  CG  LEU A  16      20.096   7.021  17.921  1.00  8.64          C   \nATOM    131  CD1 LEU A  16      19.696   7.681  16.605  1.00  8.64          C   \nATOM    132  CD2 LEU A  16      19.860   7.968  19.093  1.00  8.64          C   \nATOM    133  N   ALA A  17      18.869   3.238  20.703  1.00  8.64          N   \nATOM    134  CA  ALA A  17      17.774   2.555  21.387  1.00  8.64          C   \nATOM    135  C   ALA A  17      16.496   3.388  21.343  1.00  8.64          C   \nATOM    136  CB  ALA A  17      18.158   2.251  22.833  1.00  8.64          C   \nATOM    137  O   ALA A  17      16.550   4.620  21.358  1.00  8.64          O   \nATOM    138  N   PRO A  18      15.357   2.800  20.785  1.00  8.64          N   \nATOM    139  CA  PRO A  18      14.061   3.472  20.894  1.00  8.64          C   \nATOM    140  C   PRO A  18      13.755   3.936  22.317  1.00  8.64          C   \nATOM    141  CB  PRO A  18      13.067   2.397  20.446  1.00  8.64          C   \nATOM    142  O   PRO A  18      14.149   3.277  23.283  1.00  8.64          O   \nATOM    143  CG  PRO A  18      13.852   1.125  20.452  1.00  8.64          C   \nATOM    144  CD  PRO A  18      15.296   1.456  20.699  1.00  8.64          C   \nATOM    145  N   LYS A  19      13.655   5.179  22.533  1.00  8.64          N   \nATOM    146  CA  LYS A  19      13.091   5.770  23.743  1.00  8.64          C   \nATOM    147  C   LYS A  19      11.590   5.512  23.832  1.00  8.64          C   \nATOM    148  CB  LYS A  19      13.369   7.273  23.786  1.00  8.64          C   \nATOM    149  O   LYS A  19      10.851   5.783  22.884  1.00  8.64          O   \nATOM    150  CG  LYS A  19      14.728   7.635  24.367  1.00  8.64          C   \nATOM    151  CD  LYS A  19      14.887   9.143  24.519  1.00  8.64          C   \nATOM    152  CE  LYS A  19      16.267   9.509  25.048  1.00  8.64          C   \nATOM    153  NZ  LYS A  19      16.425  10.986  25.206  1.00  8.64          N   \nATOM    154  N   VAL A  20      11.044   4.381  24.383  1.00  8.64          N   \nATOM    155  CA  VAL A  20       9.629   4.231  24.706  1.00  8.64          C   \nATOM    156  C   VAL A  20       9.274   5.116  25.898  1.00  8.64          C   \nATOM    157  CB  VAL A  20       9.268   2.759  25.009  1.00  8.64          C   \nATOM    158  O   VAL A  20       9.977   5.115  26.911  1.00  8.64          O   \nATOM    159  CG1 VAL A  20       7.753   2.575  25.067  1.00  8.64          C   \nATOM    160  CG2 VAL A  20       9.882   1.833  23.960  1.00  8.64          C   \nATOM    161  N   SER A  21       8.650   6.317  25.693  1.00  8.64          N   \nATOM    162  CA  SER A  21       8.096   7.229  26.687  1.00  8.64          C   \nATOM    163  C   SER A  21       7.175   6.497  27.657  1.00  8.64          C   \nATOM    164  CB  SER A  21       7.332   8.365  26.005  1.00  8.64          C   \nATOM    165  O   SER A  21       6.372   5.657  27.245  1.00  8.64          O   \nATOM    166  OG  SER A  21       5.963   8.343  26.373  1.00  8.64          O   \nATOM    167  N   GLN A  22       7.597   6.311  28.856  1.00  8.64          N   \nATOM    168  CA  GLN A  22       6.871   5.820  30.022  1.00  8.64          C   \nATOM    169  C   GLN A  22       5.495   6.472  30.128  1.00  8.64          C   \nATOM    170  CB  GLN A  22       7.672   6.073  31.300  1.00  8.64          C   \nATOM    171  O   GLN A  22       4.544   5.852  30.609  1.00  8.64          O   \nATOM    172  CG  GLN A  22       8.650   4.958  31.644  1.00  8.64          C   \nATOM    173  CD  GLN A  22       9.489   5.270  32.869  1.00  8.64          C   \nATOM    174  NE2 GLN A  22      10.341   4.329  33.260  1.00  8.64          N   \nATOM    175  OE1 GLN A  22       9.372   6.349  33.460  1.00  8.64          O   \nATOM    176  N   SER A  23       5.264   7.531  29.349  1.00  8.64          N   \nATOM    177  CA  SER A  23       4.000   8.243  29.506  1.00  8.64          C   \nATOM    178  C   SER A  23       2.897   7.603  28.670  1.00  8.64          C   \nATOM    179  CB  SER A  23       4.160   9.713  29.115  1.00  8.64          C   \nATOM    180  O   SER A  23       1.719   7.671  29.029  1.00  8.64          O   \nATOM    181  OG  SER A  23       4.522   9.834  27.751  1.00  8.64          O   \nATOM    182  N   VAL A  24       3.264   6.700  27.791  1.00  8.64          N   \nATOM    183  CA  VAL A  24       2.305   6.038  26.913  1.00  8.64          C   \nATOM    184  C   VAL A  24       1.784   4.767  27.581  1.00  8.64          C   \nATOM    185  CB  VAL A  24       2.931   5.700  25.541  1.00  8.64          C   \nATOM    186  O   VAL A  24       0.599   4.443  27.474  1.00  8.64          O   \nATOM    187  CG1 VAL A  24       1.954   4.895  24.686  1.00  8.64          C   \nATOM    188  CG2 VAL A  24       3.350   6.979  24.818  1.00  8.64          C   \nATOM    189  N   ILE A  25       2.491   4.247  28.597  1.00  8.64          N   \nATOM    190  CA  ILE A  25       2.093   2.989  29.220  1.00  8.64          C   \nATOM    191  C   ILE A  25       1.071   3.261  30.322  1.00  8.64          C   \nATOM    192  CB  ILE A  25       3.311   2.231  29.793  1.00  8.64          C   \nATOM    193  O   ILE A  25       0.106   2.509  30.482  1.00  8.64          O   \nATOM    194  CG1 ILE A  25       4.253   1.802  28.662  1.00  8.64          C   \nATOM    195  CG2 ILE A  25       2.856   1.021  30.615  1.00  8.64          C   \nATOM    196  CD1 ILE A  25       5.548   1.162  29.144  1.00  8.64          C   \nATOM    197  N   LYS A  26       0.966   4.583  30.669  1.00  8.64          N   \nATOM    198  CA  LYS A  26       0.057   4.828  31.785  1.00  8.64          C   \nATOM    199  C   LYS A  26      -1.334   5.210  31.288  1.00  8.64          C   \nATOM    200  CB  LYS A  26       0.608   5.928  32.694  1.00  8.64          C   \nATOM    201  O   LYS A  26      -2.335   4.927  31.951  1.00  8.64          O   \nATOM    202  CG  LYS A  26       1.656   5.444  33.686  1.00  8.64          C   \nATOM    203  CD  LYS A  26       2.100   6.562  34.621  1.00  8.64          C   \nATOM    204  CE  LYS A  26       3.222   6.107  35.544  1.00  8.64          C   \nATOM    205  NZ  LYS A  26       3.671   7.205  36.452  1.00  8.64          N   \nATOM    206  N   SER A  27      -1.519   5.405  29.984  1.00  8.64          N   \nATOM    207  CA  SER A  27      -2.818   5.830  29.472  1.00  8.64          C   \nATOM    208  C   SER A  27      -3.593   4.654  28.886  1.00  8.64          C   \nATOM    209  CB  SER A  27      -2.647   6.918  28.412  1.00  8.64          C   \nATOM    210  O   SER A  27      -4.818   4.714  28.757  1.00  8.64          O   \nATOM    211  OG  SER A  27      -1.783   7.941  28.876  1.00  8.64          O   \nATOM    212  N   ILE A  28      -3.005   3.525  29.012  1.00  8.64          N   \nATOM    213  CA  ILE A  28      -3.699   2.421  28.358  1.00  8.64          C   \nATOM    214  C   ILE A  28      -4.341   1.519  29.410  1.00  8.64          C   \nATOM    215  CB  ILE A  28      -2.741   1.603  27.463  1.00  8.64          C   \nATOM    216  O   ILE A  28      -5.121   0.624  29.076  1.00  8.64          O   \nATOM    217  CG1 ILE A  28      -2.140   2.495  26.370  1.00  8.64          C   \nATOM    218  CG2 ILE A  28      -3.468   0.402  26.851  1.00  8.64          C   \nATOM    219  CD1 ILE A  28      -1.059   1.814  25.541  1.00  8.64          C   \nATOM    220  N   LYS A  29      -4.577   2.107  30.648  1.00  8.64          N   \nATOM    221  CA  LYS A  29      -5.233   1.333  31.698  1.00  8.64          C   \nATOM    222  C   LYS A  29      -6.750   1.358  31.533  1.00  8.64          C   \nATOM    223  CB  LYS A  29      -4.847   1.867  33.078  1.00  8.64          C   \nATOM    224  O   LYS A  29      -7.358   2.430  31.493  1.00  8.64          O   \nATOM    225  CG  LYS A  29      -3.666   1.147  33.712  1.00  8.64          C   \nATOM    226  CD  LYS A  29      -3.402   1.645  35.127  1.00  8.64          C   \nATOM    227  CE  LYS A  29      -2.190   0.960  35.745  1.00  8.64          C   \nATOM    228  NZ  LYS A  29      -1.924   1.448  37.131  1.00  8.64          N   \nATOM    229  N   GLY A  30      -7.229   1.083  30.294  1.00  8.64          N   \nATOM    230  CA  GLY A  30      -8.601   0.618  30.176  1.00  8.64          C   \nATOM    231  C   GLY A  30      -8.899  -0.029  28.837  1.00  8.64          C   \nATOM    232  O   GLY A  30      -9.937  -0.674  28.670  1.00  8.64          O   \nATOM    233  N   ILE A  31      -7.830  -0.266  28.050  1.00  8.64          N   \nATOM    234  CA  ILE A  31      -8.106  -0.892  26.762  1.00  8.64          C   \nATOM    235  C   ILE A  31      -7.458  -2.274  26.711  1.00  8.64          C   \nATOM    236  CB  ILE A  31      -7.601  -0.021  25.590  1.00  8.64          C   \nATOM    237  O   ILE A  31      -6.281  -2.428  27.045  1.00  8.64          O   \nATOM    238  CG1 ILE A  31      -8.334   1.326  25.572  1.00  8.64          C   \nATOM    239  CG2 ILE A  31      -7.773  -0.756  24.258  1.00  8.64          C   \nATOM    240  CD1 ILE A  31      -7.778   2.319  24.562  1.00  8.64          C   \nATOM    241  N   LYS A  32      -8.177  -3.230  27.032  1.00  8.64          N   \nATOM    242  CA  LYS A  32      -7.883  -4.648  26.851  1.00  8.64          C   \nATOM    243  C   LYS A  32      -7.261  -4.910  25.482  1.00  8.64          C   \nATOM    244  CB  LYS A  32      -9.152  -5.485  27.018  1.00  8.64          C   \nATOM    245  O   LYS A  32      -7.777  -4.449  24.461  1.00  8.64          O   \nATOM    246  CG  LYS A  32      -9.602  -5.645  28.463  1.00  8.64          C   \nATOM    247  CD  LYS A  32     -10.735  -6.656  28.587  1.00  8.64          C   \nATOM    248  CE  LYS A  32     -11.232  -6.767  30.022  1.00  8.64          C   \nATOM    249  NZ  LYS A  32     -12.323  -7.777  30.154  1.00  8.64          N   \nATOM    250  N   SER A  33      -5.945  -4.505  25.154  1.00  8.64          N   \nATOM    251  CA  SER A  33      -4.816  -4.797  24.277  1.00  8.64          C   \nATOM    252  C   SER A  33      -5.289  -5.219  22.890  1.00  8.64          C   \nATOM    253  CB  SER A  33      -3.937  -5.894  24.880  1.00  8.64          C   \nATOM    254  O   SER A  33      -6.134  -6.107  22.759  1.00  8.64          O   \nATOM    255  OG  SER A  33      -4.706  -7.046  25.181  1.00  8.64          O   \nATOM    256  N   LYS A  34      -5.506  -4.290  21.907  1.00  8.64          N   \nATOM    257  CA  LYS A  34      -5.176  -4.717  20.550  1.00  8.64          C   \nATOM    258  C   LYS A  34      -3.963  -3.963  20.015  1.00  8.64          C   \nATOM    259  CB  LYS A  34      -6.372  -4.514  19.618  1.00  8.64          C   \nATOM    260  O   LYS A  34      -3.833  -2.755  20.227  1.00  8.64          O   \nATOM    261  CG  LYS A  34      -7.490  -5.528  19.815  1.00  8.64          C   \nATOM    262  CD  LYS A  34      -8.616  -5.321  18.811  1.00  8.64          C   \nATOM    263  CE  LYS A  34      -9.773  -6.278  19.062  1.00  8.64          C   \nATOM    264  NZ  LYS A  34     -10.875  -6.087  18.072  1.00  8.64          N   \nATOM    265  N   HIS A  35      -2.824  -4.493  19.949  1.00  8.64          N   \nATOM    266  CA  HIS A  35      -1.491  -4.114  19.495  1.00  8.64          C   \nATOM    267  C   HIS A  35      -1.527  -3.581  18.066  1.00  8.64          C   \nATOM    268  CB  HIS A  35      -0.535  -5.304  19.588  1.00  8.64          C   \nATOM    269  O   HIS A  35      -2.122  -4.202  17.182  1.00  8.64          O   \nATOM    270  CG  HIS A  35      -0.328  -5.799  20.983  1.00  8.64          C   \nATOM    271  CD2 HIS A  35      -0.455  -7.038  21.515  1.00  8.64          C   \nATOM    272  ND1 HIS A  35       0.057  -4.973  22.017  1.00  8.64          N   \nATOM    273  CE1 HIS A  35       0.158  -5.684  23.127  1.00  8.64          C   \nATOM    274  NE2 HIS A  35      -0.147  -6.940  22.850  1.00  8.64          N   \nATOM    275  N   VAL A  36      -1.503  -2.286  17.829  1.00  8.64          N   \nATOM    276  CA  VAL A  36      -1.192  -1.701  16.529  1.00  8.64          C   \nATOM    277  C   VAL A  36       0.304  -1.410  16.437  1.00  8.64          C   \nATOM    278  CB  VAL A  36      -2.002  -0.410  16.279  1.00  8.64          C   \nATOM    279  O   VAL A  36       0.894  -0.861  17.371  1.00  8.64          O   \nATOM    280  CG1 VAL A  36      -1.660   0.188  14.915  1.00  8.64          C   \nATOM    281  CG2 VAL A  36      -3.500  -0.692  16.381  1.00  8.64          C   \nATOM    282  N   PHE A  37       1.020  -2.124  15.486  1.00  8.64          N   \nATOM    283  CA  PHE A  37       2.422  -1.855  15.187  1.00  8.64          C   \nATOM    284  C   PHE A  37       2.551  -0.928  13.985  1.00  8.64          C   \nATOM    285  CB  PHE A  37       3.177  -3.162  14.926  1.00  8.64          C   \nATOM    286  O   PHE A  37       1.807  -1.060  13.010  1.00  8.64          O   \nATOM    287  CG  PHE A  37       3.251  -4.071  16.124  1.00  8.64          C   \nATOM    288  CD1 PHE A  37       2.301  -5.066  16.318  1.00  8.64          C   \nATOM    289  CD2 PHE A  37       4.270  -3.928  17.057  1.00  8.64          C   \nATOM    290  CE1 PHE A  37       2.367  -5.908  17.426  1.00  8.64          C   \nATOM    291  CE2 PHE A  37       4.342  -4.766  18.166  1.00  8.64          C   \nATOM    292  CZ  PHE A  37       3.389  -5.755  18.349  1.00  8.64          C   \nATOM    293  N   GLU A  38       3.248   0.202  14.094  1.00  8.64          N   \nATOM    294  CA  GLU A  38       3.645   1.092  13.007  1.00  8.64          C   \nATOM    295  C   GLU A  38       5.086   0.830  12.578  1.00  8.64          C   \nATOM    296  CB  GLU A  38       3.477   2.556  13.421  1.00  8.64          C   \nATOM    297  O   GLU A  38       5.981   0.731  13.419  1.00  8.64          O   \nATOM    298  CG  GLU A  38       2.545   3.348  12.515  1.00  8.64          C   \nATOM    299  CD  GLU A  38       2.381   4.798  12.943  1.00  8.64          C   \nATOM    300  OE1 GLU A  38       1.724   5.575  12.214  1.00  8.64          O   \nATOM    301  OE2 GLU A  38       2.914   5.159  14.016  1.00  8.64          O   \nATOM    302  N   LEU A  39       5.280   0.263  11.288  1.00  8.64          N   \nATOM    303  CA  LEU A  39       6.615   0.024  10.751  1.00  8.64          C   \nATOM    304  C   LEU A  39       7.133   1.253  10.013  1.00  8.64          C   \nATOM    305  CB  LEU A  39       6.607  -1.185   9.811  1.00  8.64          C   \nATOM    306  O   LEU A  39       6.371   1.936   9.324  1.00  8.64          O   \nATOM    307  CG  LEU A  39       6.486  -2.558  10.474  1.00  8.64          C   \nATOM    308  CD1 LEU A  39       5.969  -3.586   9.473  1.00  8.64          C   \nATOM    309  CD2 LEU A  39       7.829  -2.994  11.050  1.00  8.64          C   \nATOM    310  N   PRO A  40       8.338   1.782  10.282  1.00  8.64          N   \nATOM    311  CA  PRO A  40       8.943   2.928   9.599  1.00  8.64          C   \nATOM    312  C   PRO A  40       9.200   2.662   8.117  1.00  8.64          C   \nATOM    313  CB  PRO A  40      10.259   3.133  10.353  1.00  8.64          C   \nATOM    314  O   PRO A  40       9.522   1.534   7.735  1.00  8.64          O   \nATOM    315  CG  PRO A  40      10.482   1.852  11.090  1.00  8.64          C   \nATOM    316  CD  PRO A  40       9.238   1.017  10.981  1.00  8.64          C   \nATOM    317  N   ILE A  41       8.660   3.312   7.012  1.00  8.64          N   \nATOM    318  CA  ILE A  41       8.626   3.183   5.560  1.00  8.64          C   \nATOM    319  C   ILE A  41       9.887   3.798   4.958  1.00  8.64          C   \nATOM    320  CB  ILE A  41       7.367   3.850   4.962  1.00  8.64          C   \nATOM    321  O   ILE A  41      10.222   4.950   5.244  1.00  8.64          O   \nATOM    322  CG1 ILE A  41       6.099   3.238   5.570  1.00  8.64          C   \nATOM    323  CG2 ILE A  41       7.360   3.722   3.436  1.00  8.64          C   \nATOM    324  CD1 ILE A  41       4.813   3.939   5.155  1.00  8.64          C   \nATOM    325  N   ASN A  42      10.941   3.063   4.710  1.00  8.64          N   \nATOM    326  CA  ASN A  42      11.934   3.552   3.759  1.00  8.64          C   \nATOM    327  C   ASN A  42      11.614   3.106   2.335  1.00  8.64          C   \nATOM    328  CB  ASN A  42      13.336   3.085   4.159  1.00  8.64          C   \nATOM    329  O   ASN A  42      10.806   2.198   2.131  1.00  8.64          O   \nATOM    330  CG  ASN A  42      13.525   1.591   3.986  1.00  8.64          C   \nATOM    331  ND2 ASN A  42      14.569   1.051   4.604  1.00  8.64          N   \nATOM    332  OD1 ASN A  42      12.741   0.928   3.303  1.00  8.64          O   \nATOM    333  N   ASP A  43      11.701   4.001   1.461  1.00  8.64          N   \nATOM    334  CA  ASP A  43      11.331   4.253   0.072  1.00  8.64          C   \nATOM    335  C   ASP A  43      11.757   3.096  -0.829  1.00  8.64          C   \nATOM    336  CB  ASP A  43      11.956   5.561  -0.421  1.00  8.64          C   \nATOM    337  O   ASP A  43      11.082   2.788  -1.813  1.00  8.64          O   \nATOM    338  CG  ASP A  43      11.313   6.793   0.191  1.00  8.64          C   \nATOM    339  OD1 ASP A  43      11.900   7.893   0.108  1.00  8.64          O   \nATOM    340  OD2 ASP A  43      10.210   6.661   0.764  1.00  8.64          O   \nATOM    341  N   LYS A  44      12.353   2.046  -0.514  1.00  8.64          N   \nATOM    342  CA  LYS A  44      12.727   0.989  -1.449  1.00  8.64          C   \nATOM    343  C   LYS A  44      11.978  -0.305  -1.142  1.00  8.64          C   \nATOM    344  CB  LYS A  44      14.236   0.744  -1.407  1.00  8.64          C   \nATOM    345  O   LYS A  44      11.810  -1.154  -2.021  1.00  8.64          O   \nATOM    346  CG  LYS A  44      15.059   1.832  -2.080  1.00  8.64          C   \nATOM    347  CD  LYS A  44      16.537   1.468  -2.124  1.00  8.64          C   \nATOM    348  CE  LYS A  44      17.370   2.584  -2.741  1.00  8.64          C   \nATOM    349  NZ  LYS A  44      18.820   2.229  -2.793  1.00  8.64          N   \nATOM    350  N   THR A  45      11.103  -0.291  -0.142  1.00  8.64          N   \nATOM    351  CA  THR A  45      10.454  -1.552   0.197  1.00  8.64          C   \nATOM    352  C   THR A  45       8.939  -1.437   0.054  1.00  8.64          C   \nATOM    353  CB  THR A  45      10.805  -1.993   1.630  1.00  8.64          C   \nATOM    354  O   THR A  45       8.223  -2.436   0.149  1.00  8.64          O   \nATOM    355  CG2 THR A  45      12.095  -2.806   1.656  1.00  8.64          C   \nATOM    356  OG1 THR A  45      10.968  -0.832   2.454  1.00  8.64          O   \nATOM    357  N   LYS A  46       8.412  -0.546  -0.642  1.00  8.64          N   \nATOM    358  CA  LYS A  46       6.961  -0.392  -0.700  1.00  8.64          C   \nATOM    359  C   LYS A  46       6.386  -1.066  -1.942  1.00  8.64          C   \nATOM    360  CB  LYS A  46       6.578   1.089  -0.682  1.00  8.64          C   \nATOM    361  O   LYS A  46       6.699  -0.675  -3.068  1.00  8.64          O   \nATOM    362  CG  LYS A  46       6.727   1.750   0.680  1.00  8.64          C   \nATOM    363  CD  LYS A  46       6.243   3.195   0.656  1.00  8.64          C   \nATOM    364  CE  LYS A  46       6.459   3.880   1.998  1.00  8.64          C   \nATOM    365  NZ  LYS A  46       6.003   5.302   1.974  1.00  8.64          N   \nATOM    366  N   ARG A  47       6.500  -2.491  -2.290  1.00  8.64          N   \nATOM    367  CA  ARG A  47       5.304  -2.979  -2.968  1.00  8.64          C   \nATOM    368  C   ARG A  47       5.112  -4.474  -2.731  1.00  8.64          C   \nATOM    369  CB  ARG A  47       5.382  -2.692  -4.469  1.00  8.64          C   \nATOM    370  O   ARG A  47       5.990  -5.276  -3.055  1.00  8.64          O   \nATOM    371  CG  ARG A  47       4.430  -1.603  -4.938  1.00  8.64          C   \nATOM    372  CD  ARG A  47       4.526  -1.379  -6.440  1.00  8.64          C   \nATOM    373  NE  ARG A  47       4.838   0.011  -6.759  1.00  8.64          N   \nATOM    374  NH1 ARG A  47       4.576  -0.237  -9.041  1.00  8.64          N   \nATOM    375  NH2 ARG A  47       5.152   1.801  -8.164  1.00  8.64          N   \nATOM    376  CZ  ARG A  47       4.854   0.522  -7.987  1.00  8.64          C   \nATOM    377  N   TYR A  48       4.776  -5.036  -1.672  1.00  8.64          N   \nATOM    378  CA  TYR A  48       4.245  -6.394  -1.657  1.00  8.64          C   \nATOM    379  C   TYR A  48       2.731  -6.390  -1.828  1.00  8.64          C   \nATOM    380  CB  TYR A  48       4.621  -7.104  -0.353  1.00  8.64          C   \nATOM    381  O   TYR A  48       2.027  -5.622  -1.168  1.00  8.64          O   \nATOM    382  CG  TYR A  48       6.098  -7.385  -0.219  1.00  8.64          C   \nATOM    383  CD1 TYR A  48       6.931  -6.518   0.484  1.00  8.64          C   \nATOM    384  CD2 TYR A  48       6.663  -8.518  -0.795  1.00  8.64          C   \nATOM    385  CE1 TYR A  48       8.293  -6.772   0.609  1.00  8.64          C   \nATOM    386  CE2 TYR A  48       8.024  -8.782  -0.677  1.00  8.64          C   \nATOM    387  OH  TYR A  48      10.177  -8.161   0.146  1.00  8.64          O   \nATOM    388  CZ  TYR A  48       8.829  -7.905   0.026  1.00  8.64          C   \nATOM    389  N   ILE A  49       2.115  -6.489  -3.067  1.00  8.64          N   \nATOM    390  CA  ILE A  49       0.852  -6.880  -3.684  1.00  8.64          C   \nATOM    391  C   ILE A  49       0.101  -7.837  -2.761  1.00  8.64          C   \nATOM    392  CB  ILE A  49       1.076  -7.534  -5.066  1.00  8.64          C   \nATOM    393  O   ILE A  49       0.588  -8.929  -2.459  1.00  8.64          O   \nATOM    394  CG1 ILE A  49       1.810  -6.567  -6.002  1.00  8.64          C   \nATOM    395  CG2 ILE A  49      -0.256  -7.981  -5.674  1.00  8.64          C   \nATOM    396  CD1 ILE A  49       2.101  -7.142  -7.381  1.00  8.64          C   \nATOM    397  N   LEU A  50      -0.593  -7.592  -1.660  1.00  8.64          N   \nATOM    398  CA  LEU A  50      -1.573  -8.173  -0.750  1.00  8.64          C   \nATOM    399  C   LEU A  50      -2.949  -8.245  -1.405  1.00  8.64          C   \nATOM    400  CB  LEU A  50      -1.653  -7.358   0.544  1.00  8.64          C   \nATOM    401  O   LEU A  50      -3.384  -7.289  -2.050  1.00  8.64          O   \nATOM    402  CG  LEU A  50      -0.484  -7.515   1.517  1.00  8.64          C   \nATOM    403  CD1 LEU A  50      -0.441  -6.339   2.488  1.00  8.64          C   \nATOM    404  CD2 LEU A  50      -0.591  -8.835   2.273  1.00  8.64          C   \nATOM    405  N   GLY A  51      -3.407  -9.384  -2.202  1.00  8.64          N   \nATOM    406  CA  GLY A  51      -4.655 -10.100  -1.989  1.00  8.64          C   \nATOM    407  C   GLY A  51      -5.574 -10.070  -3.195  1.00  8.64          C   \nATOM    408  O   GLY A  51      -6.476  -9.233  -3.274  1.00  8.64          O   \nATOM    409  N   ALA A  52      -5.228 -10.625  -4.456  1.00  8.64          N   \nATOM    410  CA  ALA A  52      -6.350 -10.631  -5.391  1.00  8.64          C   \nATOM    411  C   ALA A  52      -6.952 -12.027  -5.518  1.00  8.64          C   \nATOM    412  CB  ALA A  52      -5.905 -10.121  -6.760  1.00  8.64          C   \nATOM    413  O   ALA A  52      -6.245 -12.989  -5.829  1.00  8.64          O   \nATOM    414  N   THR A  53      -7.821 -12.550  -4.658  1.00  8.64          N   \nATOM    415  CA  THR A  53      -8.645 -13.723  -4.929  1.00  8.64          C   \nATOM    416  C   THR A  53      -9.877 -13.343  -5.745  1.00  8.64          C   \nATOM    417  CB  THR A  53      -9.083 -14.411  -3.622  1.00  8.64          C   \nATOM    418  O   THR A  53     -10.285 -12.180  -5.756  1.00  8.64          O   \nATOM    419  CG2 THR A  53      -7.877 -14.908  -2.831  1.00  8.64          C   \nATOM    420  OG1 THR A  53      -9.815 -13.477  -2.820  1.00  8.64          O   \nATOM    421  N   GLU A  54     -10.028 -13.989  -6.922  1.00  8.64          N   \nATOM    422  CA  GLU A  54     -11.170 -13.968  -7.831  1.00  8.64          C   \nATOM    423  C   GLU A  54     -12.473 -13.725  -7.074  1.00  8.64          C   \nATOM    424  CB  GLU A  54     -11.256 -15.279  -8.618  1.00  8.64          C   \nATOM    425  O   GLU A  54     -13.399 -13.109  -7.604  1.00  8.64          O   \nATOM    426  CG  GLU A  54     -10.288 -15.357  -9.789  1.00  8.64          C   \nATOM    427  CD  GLU A  54     -10.430 -16.635 -10.601  1.00  8.64          C   \nATOM    428  OE1 GLU A  54      -9.704 -16.798 -11.608  1.00  8.64          O   \nATOM    429  OE2 GLU A  54     -11.276 -17.478 -10.228  1.00  8.64          O   \nATOM    430  N   THR A  55     -12.360 -13.799  -5.890  1.00  8.64          N   \nATOM    431  CA  THR A  55     -13.448 -13.571  -4.946  1.00  8.64          C   \nATOM    432  C   THR A  55     -13.101 -12.439  -3.983  1.00  8.64          C   \nATOM    433  CB  THR A  55     -13.771 -14.847  -4.146  1.00  8.64          C   \nATOM    434  O   THR A  55     -11.941 -12.282  -3.594  1.00  8.64          O   \nATOM    435  CG2 THR A  55     -14.391 -15.915  -5.041  1.00  8.64          C   \nATOM    436  OG1 THR A  55     -12.563 -15.363  -3.573  1.00  8.64          O   \nATOM    437  N   LYS A  56     -13.303 -11.292  -4.478  1.00  8.64          N   \nATOM    438  CA  LYS A  56     -13.121  -9.990  -3.842  1.00  8.64          C   \nATOM    439  C   LYS A  56     -12.513 -10.138  -2.450  1.00  8.64          C   \nATOM    440  CB  LYS A  56     -14.454  -9.244  -3.755  1.00  8.64          C   \nATOM    441  O   LYS A  56     -13.231 -10.124  -1.449  1.00  8.64          O   \nATOM    442  CG  LYS A  56     -15.022  -8.833  -5.105  1.00  8.64          C   \nATOM    443  CD  LYS A  56     -16.241  -7.932  -4.948  1.00  8.64          C   \nATOM    444  CE  LYS A  56     -16.839  -7.558  -6.298  1.00  8.64          C   \nATOM    445  NZ  LYS A  56     -18.009  -6.643  -6.150  1.00  8.64          N   \nATOM    446  N   GLU A  57     -11.444 -10.923  -2.365  1.00  8.64          N   \nATOM    447  CA  GLU A  57     -10.922 -10.869  -1.003  1.00  8.64          C   \nATOM    448  C   GLU A  57      -9.945  -9.710  -0.832  1.00  8.64          C   \nATOM    449  CB  GLU A  57     -10.241 -12.190  -0.635  1.00  8.64          C   \nATOM    450  O   GLU A  57      -9.129  -9.443  -1.717  1.00  8.64          O   \nATOM    451  CG  GLU A  57     -11.101 -13.108   0.221  1.00  8.64          C   \nATOM    452  CD  GLU A  57     -10.378 -14.373   0.656  1.00  8.64          C   \nATOM    453  OE1 GLU A  57     -10.943 -15.149   1.461  1.00  8.64          O   \nATOM    454  OE2 GLU A  57      -9.238 -14.590   0.190  1.00  8.64          O   \nATOM    455  N   GLU A  58     -10.407  -8.718  -0.201  1.00  8.64          N   \nATOM    456  CA  GLU A  58      -9.599  -7.616   0.312  1.00  8.64          C   \nATOM    457  C   GLU A  58      -8.294  -8.124   0.918  1.00  8.64          C   \nATOM    458  CB  GLU A  58     -10.384  -6.812   1.352  1.00  8.64          C   \nATOM    459  O   GLU A  58      -8.299  -9.054   1.728  1.00  8.64          O   \nATOM    460  CG  GLU A  58     -10.114  -5.315   1.303  1.00  8.64          C   \nATOM    461  CD  GLU A  58     -10.947  -4.523   2.298  1.00  8.64          C   \nATOM    462  OE1 GLU A  58     -10.733  -3.296   2.428  1.00  8.64          O   \nATOM    463  OE2 GLU A  58     -11.819  -5.134   2.955  1.00  8.64          O   \nATOM    464  N   VAL A  59      -7.183  -8.070   0.289  1.00  6.72          N   \nATOM    465  CA  VAL A  59      -5.863  -8.557   0.675  1.00  6.72          C   \nATOM    466  C   VAL A  59      -5.151  -7.505   1.523  1.00  6.72          C   \nATOM    467  CB  VAL A  59      -5.006  -8.915  -0.560  1.00  6.72          C   \nATOM    468  O   VAL A  59      -4.402  -7.842   2.442  1.00  6.72          O   \nATOM    469  CG1 VAL A  59      -3.820  -9.790  -0.159  1.00  6.72          C   \nATOM    470  CG2 VAL A  59      -5.860  -9.616  -1.615  1.00  6.72          C   \nATOM    471  N   LEU A  60      -5.923  -6.877   2.559  1.00  6.72          N   \nATOM    472  CA  LEU A  60      -5.509  -6.065   3.699  1.00  6.72          C   \nATOM    473  C   LEU A  60      -5.287  -4.615   3.281  1.00  6.72          C   \nATOM    474  CB  LEU A  60      -4.231  -6.631   4.324  1.00  6.72          C   \nATOM    475  O   LEU A  60      -4.724  -4.351   2.216  1.00  6.72          O   \nATOM    476  CG  LEU A  60      -4.398  -7.870   5.205  1.00  6.72          C   \nATOM    477  CD1 LEU A  60      -3.064  -8.591   5.363  1.00  6.72          C   \nATOM    478  CD2 LEU A  60      -4.969  -7.486   6.565  1.00  6.72          C   \nATOM    479  N   PRO A  61      -6.061  -3.706   3.745  1.00  6.72          N   \nATOM    480  CA  PRO A  61      -5.827  -2.294   3.434  1.00  6.72          C   \nATOM    481  C   PRO A  61      -4.391  -1.859   3.717  1.00  6.72          C   \nATOM    482  CB  PRO A  61      -6.810  -1.563   4.353  1.00  6.72          C   \nATOM    483  O   PRO A  61      -3.782  -2.317   4.687  1.00  6.72          O   \nATOM    484  CG  PRO A  61      -7.183  -2.571   5.392  1.00  6.72          C   \nATOM    485  CD  PRO A  61      -6.789  -3.933   4.898  1.00  6.72          C   \nATOM    486  N   ASN A  62      -3.671  -1.566   2.620  1.00  6.72          N   \nATOM    487  CA  ASN A  62      -2.420  -0.834   2.785  1.00  6.72          C   \nATOM    488  C   ASN A  62      -2.630   0.672   2.655  1.00  6.72          C   \nATOM    489  CB  ASN A  62      -1.379  -1.315   1.772  1.00  6.72          C   \nATOM    490  O   ASN A  62      -3.578   1.117   2.004  1.00  6.72          O   \nATOM    491  CG  ASN A  62      -0.729  -2.622   2.178  1.00  6.72          C   \nATOM    492  ND2 ASN A  62      -0.250  -3.376   1.195  1.00  6.72          N   \nATOM    493  OD1 ASN A  62      -0.659  -2.953   3.364  1.00  6.72          O   \nATOM    494  N   TYR A  63      -2.223   1.347   3.620  1.00  6.72          N   \nATOM    495  CA  TYR A  63      -2.253   2.806   3.627  1.00  6.72          C   \nATOM    496  C   TYR A  63      -0.969   3.381   3.043  1.00  6.72          C   \nATOM    497  CB  TYR A  63      -2.461   3.332   5.050  1.00  6.72          C   \nATOM    498  O   TYR A  63       0.099   2.774   3.157  1.00  6.72          O   \nATOM    499  CG  TYR A  63      -3.732   2.841   5.700  1.00  6.72          C   \nATOM    500  CD1 TYR A  63      -3.747   1.663   6.442  1.00  6.72          C   \nATOM    501  CD2 TYR A  63      -4.920   3.553   5.571  1.00  6.72          C   \nATOM    502  CE1 TYR A  63      -4.917   1.205   7.041  1.00  6.72          C   \nATOM    503  CE2 TYR A  63      -6.095   3.105   6.166  1.00  6.72          C   \nATOM    504  OH  TYR A  63      -7.244   1.484   7.488  1.00  6.72          O   \nATOM    505  CZ  TYR A  63      -6.083   1.932   6.898  1.00  6.72          C   \nATOM    506  N   VAL A  64      -1.142   4.342   2.173  1.00  4.66          N   \nATOM    507  CA  VAL A  64      -0.000   5.090   1.658  1.00  4.66          C   \nATOM    508  C   VAL A  64      -0.129   6.561   2.046  1.00  4.66          C   \nATOM    509  CB  VAL A  64       0.125   4.951   0.125  1.00  4.66          C   \nATOM    510  O   VAL A  64      -1.219   7.133   1.982  1.00  4.66          O   \nATOM    511  CG1 VAL A  64      -1.005   5.701  -0.579  1.00  4.66          C   \nATOM    512  CG2 VAL A  64       1.485   5.462  -0.348  1.00  4.66          C   \nATOM    513  N   LYS A  65       0.916   7.003   2.673  1.00  6.72          N   \nATOM    514  CA  LYS A  65       0.982   8.432   2.966  1.00  6.72          C   \nATOM    515  C   LYS A  65       1.692   9.190   1.848  1.00  6.72          C   \nATOM    516  CB  LYS A  65       1.693   8.674   4.298  1.00  6.72          C   \nATOM    517  O   LYS A  65       2.804   8.830   1.455  1.00  6.72          O   \nATOM    518  CG  LYS A  65       1.604  10.110   4.795  1.00  6.72          C   \nATOM    519  CD  LYS A  65       2.207  10.258   6.186  1.00  6.72          C   \nATOM    520  CE  LYS A  65       2.153  11.701   6.669  1.00  6.72          C   \nATOM    521  NZ  LYS A  65       2.726  11.848   8.040  1.00  6.72          N   \nATOM    522  N   VAL A  66       1.057  10.179   1.205  1.00  6.72          N   \nATOM    523  CA  VAL A  66       1.588  11.120   0.224  1.00  6.72          C   \nATOM    524  C   VAL A  66       1.485  12.544   0.766  1.00  6.72          C   \nATOM    525  CB  VAL A  66       0.847  11.009  -1.127  1.00  6.72          C   \nATOM    526  O   VAL A  66       0.389  13.105   0.851  1.00  6.72          O   \nATOM    527  CG1 VAL A  66       1.477  11.935  -2.166  1.00  6.72          C   \nATOM    528  CG2 VAL A  66       0.854   9.564  -1.622  1.00  6.72          C   \nATOM    529  N   GLY A  67       2.645  13.103   1.210  1.00  6.72          N   \nATOM    530  CA  GLY A  67       2.556  14.375   1.909  1.00  6.72          C   \nATOM    531  C   GLY A  67       1.847  14.273   3.247  1.00  6.72          C   \nATOM    532  O   GLY A  67       2.248  13.488   4.109  1.00  6.72          O   \nATOM    533  N   SER A  68       0.772  15.228   3.461  1.00  6.72          N   \nATOM    534  CA  SER A  68      -0.022  15.225   4.685  1.00  6.72          C   \nATOM    535  C   SER A  68      -1.250  14.332   4.545  1.00  6.72          C   \nATOM    536  CB  SER A  68      -0.453  16.647   5.048  1.00  6.72          C   \nATOM    537  O   SER A  68      -2.061  14.234   5.469  1.00  6.72          O   \nATOM    538  OG  SER A  68      -1.210  17.226   3.999  1.00  6.72          O   \nATOM    539  N   ASP A  69      -1.295  13.620   3.451  1.00  6.72          N   \nATOM    540  CA  ASP A  69      -2.507  12.844   3.203  1.00  6.72          C   \nATOM    541  C   ASP A  69      -2.237  11.347   3.332  1.00  6.72          C   \nATOM    542  CB  ASP A  69      -3.071  13.160   1.816  1.00  6.72          C   \nATOM    543  O   ASP A  69      -1.146  10.877   3.002  1.00  6.72          O   \nATOM    544  CG  ASP A  69      -3.522  14.603   1.673  1.00  6.72          C   \nATOM    545  OD1 ASP A  69      -3.312  15.204   0.598  1.00  6.72          O   \nATOM    546  OD2 ASP A  69      -4.090  15.144   2.646  1.00  6.72          O   \nATOM    547  N   LEU A  70      -3.211  10.550   3.934  1.00  4.66          N   \nATOM    548  CA  LEU A  70      -3.196   9.096   4.057  1.00  4.66          C   \nATOM    549  C   LEU A  70      -4.202   8.459   3.105  1.00  4.66          C   \nATOM    550  CB  LEU A  70      -3.502   8.677   5.498  1.00  4.66          C   \nATOM    551  O   LEU A  70      -5.357   8.886   3.039  1.00  4.66          O   \nATOM    552  CG  LEU A  70      -3.258   7.207   5.842  1.00  4.66          C   \nATOM    553  CD1 LEU A  70      -1.767   6.890   5.788  1.00  4.66          C   \nATOM    554  CD2 LEU A  70      -3.830   6.877   7.216  1.00  4.66          C   \nATOM    555  N   TYR A  71      -3.655   7.568   2.260  1.00  4.66          N   \nATOM    556  CA  TYR A  71      -4.497   6.862   1.300  1.00  4.66          C   \nATOM    557  C   TYR A  71      -4.630   5.390   1.671  1.00  4.66          C   \nATOM    558  CB  TYR A  71      -3.926   6.994  -0.115  1.00  4.66          C   \nATOM    559  O   TYR A  71      -3.674   4.774   2.148  1.00  4.66          O   \nATOM    560  CG  TYR A  71      -3.900   8.412  -0.629  1.00  4.66          C   \nATOM    561  CD1 TYR A  71      -2.852   9.272  -0.307  1.00  4.66          C   \nATOM    562  CD2 TYR A  71      -4.923   8.897  -1.437  1.00  4.66          C   \nATOM    563  CE1 TYR A  71      -2.824  10.581  -0.777  1.00  4.66          C   \nATOM    564  CE2 TYR A  71      -4.906  10.204  -1.913  1.00  4.66          C   \nATOM    565  OH  TYR A  71      -3.832  12.332  -2.046  1.00  4.66          O   \nATOM    566  CZ  TYR A  71      -3.854  11.037  -1.578  1.00  4.66          C   \nATOM    567  N   ARG A  72      -5.791   4.900   1.584  1.00  4.66          N   \nATOM    568  CA  ARG A  72      -6.044   3.465   1.655  1.00  4.66          C   \nATOM    569  C   ARG A  72      -5.981   2.829   0.270  1.00  4.66          C   \nATOM    570  CB  ARG A  72      -7.406   3.190   2.296  1.00  4.66          C   \nATOM    571  O   ARG A  72      -6.604   3.321  -0.674  1.00  4.66          O   \nATOM    572  CG  ARG A  72      -7.679   1.717   2.555  1.00  4.66          C   \nATOM    573  CD  ARG A  72      -9.040   1.500   3.201  1.00  4.66          C   \nATOM    574  NE  ARG A  72      -9.274   0.091   3.505  1.00  4.66          N   \nATOM    575  NH1 ARG A  72     -11.472   0.383   4.153  1.00  4.66          N   \nATOM    576  NH2 ARG A  72     -10.528  -1.705   4.194  1.00  4.66          N   \nATOM    577  CZ  ARG A  72     -10.424  -0.407   3.950  1.00  4.66          C   \nATOM    578  N   LEU A  73      -5.092   1.875   0.180  1.00  4.66          N   \nATOM    579  CA  LEU A  73      -4.937   1.157  -1.080  1.00  4.66          C   \nATOM    580  C   LEU A  73      -5.727  -0.147  -1.064  1.00  4.66          C   \nATOM    581  CB  LEU A  73      -3.458   0.868  -1.354  1.00  4.66          C   \nATOM    582  O   LEU A  73      -5.700  -0.882  -0.074  1.00  4.66          O   \nATOM    583  CG  LEU A  73      -2.548   2.087  -1.518  1.00  4.66          C   \nATOM    584  CD1 LEU A  73      -1.084   1.663  -1.481  1.00  4.66          C   \nATOM    585  CD2 LEU A  73      -2.866   2.820  -2.817  1.00  4.66          C   \nATOM    586  N   LYS A  74      -6.458  -0.297  -2.040  1.00  4.66          N   \nATOM    587  CA  LYS A  74      -7.147  -1.567  -2.251  1.00  4.66          C   \nATOM    588  C   LYS A  74      -6.751  -2.192  -3.586  1.00  4.66          C   \nATOM    589  CB  LYS A  74      -8.662  -1.371  -2.193  1.00  4.66          C   \nATOM    590  O   LYS A  74      -6.697  -1.504  -4.608  1.00  4.66          O   \nATOM    591  CG  LYS A  74      -9.189  -1.022  -0.809  1.00  4.66          C   \nATOM    592  CD  LYS A  74     -10.710  -0.932  -0.796  1.00  4.66          C   \nATOM    593  CE  LYS A  74     -11.234  -0.515   0.572  1.00  4.66          C   \nATOM    594  NZ  LYS A  74     -12.725  -0.424   0.589  1.00  4.66          N   \nATOM    595  N   ALA A  75      -6.218  -3.399  -3.444  1.00  4.66          N   \nATOM    596  CA  ALA A  75      -5.851  -4.111  -4.666  1.00  4.66          C   \nATOM    597  C   ALA A  75      -6.823  -5.253  -4.948  1.00  4.66          C   \nATOM    598  CB  ALA A  75      -4.424  -4.644  -4.562  1.00  4.66          C   \nATOM    599  O   ALA A  75      -7.332  -5.887  -4.021  1.00  4.66          O   \nATOM    600  N   TYR A  76      -7.207  -5.295  -6.175  1.00  6.72          N   \nATOM    601  CA  TYR A  76      -8.028  -6.438  -6.558  1.00  6.72          C   \nATOM    602  C   TYR A  76      -7.576  -7.011  -7.896  1.00  6.72          C   \nATOM    603  CB  TYR A  76      -9.505  -6.039  -6.633  1.00  6.72          C   \nATOM    604  O   TYR A  76      -6.891  -6.335  -8.668  1.00  6.72          O   \nATOM    605  CG  TYR A  76      -9.757  -4.799  -7.457  1.00  6.72          C   \nATOM    606  CD1 TYR A  76     -10.045  -4.889  -8.817  1.00  6.72          C   \nATOM    607  CD2 TYR A  76      -9.707  -3.536  -6.878  1.00  6.72          C   \nATOM    608  CE1 TYR A  76     -10.276  -3.750  -9.580  1.00  6.72          C   \nATOM    609  CE2 TYR A  76      -9.937  -2.389  -7.631  1.00  6.72          C   \nATOM    610  OH  TYR A  76     -10.448  -1.375  -9.730  1.00  6.72          O   \nATOM    611  CZ  TYR A  76     -10.220  -2.506  -8.979  1.00  6.72          C   \nATOM    612  N   ARG A  77      -7.735  -8.365  -8.035  1.00  6.72          N   \nATOM    613  CA  ARG A  77      -7.400  -9.083  -9.261  1.00  6.72          C   \nATOM    614  C   ARG A  77      -8.658  -9.466 -10.033  1.00  6.72          C   \nATOM    615  CB  ARG A  77      -6.578 -10.335  -8.944  1.00  6.72          C   \nATOM    616  O   ARG A  77      -9.624  -9.964  -9.449  1.00  6.72          O   \nATOM    617  CG  ARG A  77      -6.025 -11.036 -10.174  1.00  6.72          C   \nATOM    618  CD  ARG A  77      -5.161 -12.233  -9.800  1.00  6.72          C   \nATOM    619  NE  ARG A  77      -4.366 -12.698 -10.933  1.00  6.72          N   \nATOM    620  NH1 ARG A  77      -3.944 -14.788 -10.043  1.00  6.72          N   \nATOM    621  NH2 ARG A  77      -3.103 -14.221 -12.098  1.00  6.72          N   \nATOM    622  CZ  ARG A  77      -3.806 -13.901 -11.022  1.00  6.72          C   \nATOM    623  N   GLU A  78      -8.703  -8.968 -11.357  1.00  6.72          N   \nATOM    624  CA  GLU A  78      -9.710  -9.433 -12.306  1.00  6.72          C   \nATOM    625  C   GLU A  78      -9.072 -10.231 -13.440  1.00  6.72          C   \nATOM    626  CB  GLU A  78     -10.500  -8.252 -12.875  1.00  6.72          C   \nATOM    627  O   GLU A  78      -7.847 -10.344 -13.513  1.00  6.72          O   \nATOM    628  CG  GLU A  78     -11.352  -7.528 -11.842  1.00  6.72          C   \nATOM    629  CD  GLU A  78     -12.234  -6.446 -12.444  1.00  6.72          C   \nATOM    630  OE1 GLU A  78     -12.957  -5.760 -11.686  1.00  6.72          O   \nATOM    631  OE2 GLU A  78     -12.203  -6.283 -13.684  1.00  6.72          O   \nATOM    632  N   LYS A  79      -9.991 -10.926 -14.239  1.00  6.72          N   \nATOM    633  CA  LYS A  79      -9.539 -11.713 -15.383  1.00  6.72          C   \nATOM    634  C   LYS A  79      -8.611 -10.898 -16.279  1.00  6.72          C   \nATOM    635  CB  LYS A  79     -10.735 -12.221 -16.191  1.00  6.72          C   \nATOM    636  O   LYS A  79      -7.610 -11.415 -16.778  1.00  6.72          O   \nATOM    637  CG  LYS A  79     -10.419 -13.415 -17.079  1.00  6.72          C   \nATOM    638  CD  LYS A  79     -11.665 -13.928 -17.790  1.00  6.72          C   \nATOM    639  CE  LYS A  79     -11.329 -15.033 -18.782  1.00  6.72          C   \nATOM    640  NZ  LYS A  79     -12.556 -15.601 -19.415  1.00  6.72          N   \nATOM    641  N   SER A  80      -8.775  -9.596 -16.232  1.00  6.72          N   \nATOM    642  CA  SER A  80      -8.111  -8.740 -17.209  1.00  6.72          C   \nATOM    643  C   SER A  80      -6.887  -8.057 -16.606  1.00  6.72          C   \nATOM    644  CB  SER A  80      -9.080  -7.685 -17.745  1.00  6.72          C   \nATOM    645  O   SER A  80      -6.072  -7.482 -17.329  1.00  6.72          O   \nATOM    646  OG  SER A  80      -9.634  -6.926 -16.684  1.00  6.72          O   \nATOM    647  N   GLY A  81      -6.705  -8.234 -15.324  1.00  6.72          N   \nATOM    648  CA  GLY A  81      -5.576  -7.527 -14.740  1.00  6.72          C   \nATOM    649  C   GLY A  81      -5.757  -7.232 -13.263  1.00  6.72          C   \nATOM    650  O   GLY A  81      -6.659  -7.775 -12.622  1.00  6.72          O   \nATOM    651  N   VAL A  82      -4.698  -6.651 -12.655  1.00  6.72          N   \nATOM    652  CA  VAL A  82      -4.661  -6.238 -11.256  1.00  6.72          C   \nATOM    653  C   VAL A  82      -4.972  -4.747 -11.149  1.00  6.72          C   \nATOM    654  CB  VAL A  82      -3.292  -6.545 -10.609  1.00  6.72          C   \nATOM    655  O   VAL A  82      -4.465  -3.943 -11.935  1.00  6.72          O   \nATOM    656  CG1 VAL A  82      -3.263  -6.076  -9.156  1.00  6.72          C   \nATOM    657  CG2 VAL A  82      -2.983  -8.039 -10.698  1.00  6.72          C   \nATOM    658  N   TYR A  83      -5.928  -4.428 -10.292  1.00  6.72          N   \nATOM    659  CA  TYR A  83      -6.336  -3.045 -10.073  1.00  6.72          C   \nATOM    660  C   TYR A  83      -5.965  -2.583  -8.668  1.00  6.72          C   \nATOM    661  CB  TYR A  83      -7.843  -2.888 -10.293  1.00  6.72          C   \nATOM    662  O   TYR A  83      -5.976  -3.376  -7.724  1.00  6.72          O   \nATOM    663  CG  TYR A  83      -8.298  -3.276 -11.679  1.00  6.72          C   \nATOM    664  CD1 TYR A  83      -8.526  -4.610 -12.011  1.00  6.72          C   \nATOM    665  CD2 TYR A  83      -8.499  -2.311 -12.660  1.00  6.72          C   \nATOM    666  CE1 TYR A  83      -8.942  -4.973 -13.287  1.00  6.72          C   \nATOM    667  CE2 TYR A  83      -8.916  -2.662 -13.940  1.00  6.72          C   \nATOM    668  OH  TYR A  83      -9.548  -4.347 -15.509  1.00  6.72          O   \nATOM    669  CZ  TYR A  83      -9.135  -3.993 -14.243  1.00  6.72          C   \nATOM    670  N   VAL A  84      -5.503  -1.346  -8.569  1.00  4.66          N   \nATOM    671  CA  VAL A  84      -5.269  -0.727  -7.268  1.00  4.66          C   \nATOM    672  C   VAL A  84      -6.170   0.496  -7.109  1.00  4.66          C   \nATOM    673  CB  VAL A  84      -3.788  -0.325  -7.089  1.00  4.66          C   \nATOM    674  O   VAL A  84      -6.240   1.343  -8.002  1.00  4.66          O   \nATOM    675  CG1 VAL A  84      -3.573   0.352  -5.737  1.00  4.66          C   \nATOM    676  CG2 VAL A  84      -2.884  -1.549  -7.227  1.00  4.66          C   \nATOM    677  N   ARG A  85      -6.913   0.488  -6.095  1.00  6.72          N   \nATOM    678  CA  ARG A  85      -7.754   1.633  -5.763  1.00  6.72          C   \nATOM    679  C   ARG A  85      -7.206   2.383  -4.553  1.00  6.72          C   \nATOM    680  CB  ARG A  85      -9.192   1.183  -5.492  1.00  6.72          C   \nATOM    681  O   ARG A  85      -6.730   1.766  -3.597  1.00  6.72          O   \nATOM    682  CG  ARG A  85     -10.184   2.329  -5.379  1.00  6.72          C   \nATOM    683  CD  ARG A  85     -11.596   1.828  -5.108  1.00  6.72          C   \nATOM    684  NE  ARG A  85     -12.400   1.796  -6.326  1.00  6.72          N   \nATOM    685  NH1 ARG A  85     -14.250   0.839  -5.327  1.00  6.72          N   \nATOM    686  NH2 ARG A  85     -14.283   1.347  -7.562  1.00  6.72          N   \nATOM    687  CZ  ARG A  85     -13.643   1.327  -6.402  1.00  6.72          C   \nATOM    688  N   THR A  86      -7.071   3.732  -4.691  1.00  6.72          N   \nATOM    689  CA  THR A  86      -6.621   4.528  -3.555  1.00  6.72          C   \nATOM    690  C   THR A  86      -7.733   5.453  -3.068  1.00  6.72          C   \nATOM    691  CB  THR A  86      -5.376   5.361  -3.914  1.00  6.72          C   \nATOM    692  O   THR A  86      -8.527   5.952  -3.868  1.00  6.72          O   \nATOM    693  CG2 THR A  86      -4.246   4.471  -4.420  1.00  6.72          C   \nATOM    694  OG1 THR A  86      -5.719   6.306  -4.935  1.00  6.72          O   \nATOM    695  N   ASN A  87      -7.936   5.475  -1.707  1.00  6.72          N   \nATOM    696  CA  ASN A  87      -8.831   6.444  -1.084  1.00  6.72          C   \nATOM    697  C   ASN A  87      -8.087   7.347  -0.105  1.00  6.72          C   \nATOM    698  CB  ASN A  87      -9.985   5.730  -0.376  1.00  6.72          C   \nATOM    699  O   ASN A  87      -7.297   6.868   0.711  1.00  6.72          O   \nATOM    700  CG  ASN A  87     -10.918   5.027  -1.342  1.00  6.72          C   \nATOM    701  ND2 ASN A  87     -11.709   4.093  -0.828  1.00  6.72          N   \nATOM    702  OD1 ASN A  87     -10.927   5.321  -2.540  1.00  6.72          O   \nATOM    703  N   LYS A  88      -8.092   8.633  -0.265  1.00  6.72          N   \nATOM    704  CA  LYS A  88      -7.558   9.565   0.724  1.00  6.72          C   \nATOM    705  C   LYS A  88      -8.305   9.448   2.049  1.00  6.72          C   \nATOM    706  CB  LYS A  88      -7.634  11.001   0.204  1.00  6.72          C   \nATOM    707  O   LYS A  88      -9.536   9.505   2.081  1.00  6.72          O   \nATOM    708  CG  LYS A  88      -6.902  12.014   1.072  1.00  6.72          C   \nATOM    709  CD  LYS A  88      -6.972  13.415   0.478  1.00  6.72          C   \nATOM    710  CE  LYS A  88      -6.293  14.439   1.377  1.00  6.72          C   \nATOM    711  NZ  LYS A  88      -6.372  15.816   0.806  1.00  6.72          N   \nATOM    712  N   LEU A  89      -7.493   9.040   3.089  1.00  6.72          N   \nATOM    713  CA  LEU A  89      -8.056   8.925   4.430  1.00  6.72          C   \nATOM    714  C   LEU A  89      -8.211  10.298   5.074  1.00  6.72          C   \nATOM    715  CB  LEU A  89      -7.174   8.033   5.307  1.00  6.72          C   \nATOM    716  O   LEU A  89      -7.367  11.177   4.884  1.00  6.72          O   \nATOM    717  CG  LEU A  89      -7.197   6.537   4.993  1.00  6.72          C   \nATOM    718  CD1 LEU A  89      -6.028   5.834   5.676  1.00  6.72          C   \nATOM    719  CD2 LEU A  89      -8.523   5.920   5.422  1.00  6.72          C   \nATOM    720  N   GLY A  90      -9.340  10.708   5.578  1.00  6.72          N   \nATOM    721  CA  GLY A  90      -9.715  11.894   6.333  1.00  6.72          C   \nATOM    722  C   GLY A  90     -10.588  12.851   5.544  1.00  6.72          C   \nATOM    723  O   GLY A  90     -11.001  13.892   6.061  1.00  6.72          O   \nATOM    724  N   PHE A  91     -10.821  12.471   4.312  1.00  8.64          N   \nATOM    725  CA  PHE A  91     -11.769  13.293   3.569  1.00  8.64          C   \nATOM    726  C   PHE A  91     -12.999  12.482   3.179  1.00  8.64          C   \nATOM    727  CB  PHE A  91     -11.109  13.881   2.318  1.00  8.64          C   \nATOM    728  O   PHE A  91     -12.889  11.479   2.471  1.00  8.64          O   \nATOM    729  CG  PHE A  91     -10.275  15.103   2.589  1.00  8.64          C   \nATOM    730  CD1 PHE A  91      -8.918  14.989   2.865  1.00  8.64          C   \nATOM    731  CD2 PHE A  91     -10.848  16.368   2.568  1.00  8.64          C   \nATOM    732  CE1 PHE A  91      -8.143  16.119   3.117  1.00  8.64          C   \nATOM    733  CE2 PHE A  91     -10.081  17.502   2.818  1.00  8.64          C   \nATOM    734  CZ  PHE A  91      -8.729  17.376   3.093  1.00  8.64          C   \nATOM    735  N   GLU A  92     -13.879  12.165   4.125  1.00  8.64          N   \nATOM    736  CA  GLU A  92     -15.112  11.423   3.881  1.00  8.64          C   \nATOM    737  C   GLU A  92     -16.103  12.251   3.067  1.00  8.64          C   \nATOM    738  CB  GLU A  92     -15.750  10.990   5.203  1.00  8.64          C   \nATOM    739  O   GLU A  92     -16.591  13.281   3.535  1.00  8.64          O   \nATOM    740  CG  GLU A  92     -15.244   9.651   5.721  1.00  8.64          C   \nATOM    741  CD  GLU A  92     -15.990   9.164   6.954  1.00  8.64          C   \nATOM    742  OE1 GLU A  92     -15.708   8.041   7.429  1.00  8.64          O   \nATOM    743  OE2 GLU A  92     -16.864   9.911   7.447  1.00  8.64          O   \nATOM    744  N   ASP A  93     -15.801  12.461   1.827  1.00  8.64          N   \nATOM    745  CA  ASP A  93     -17.029  12.844   1.137  1.00  8.64          C   \nATOM    746  C   ASP A  93     -17.790  11.614   0.648  1.00  8.64          C   \nATOM    747  CB  ASP A  93     -16.717  13.772  -0.039  1.00  8.64          C   \nATOM    748  O   ASP A  93     -17.320  10.899  -0.240  1.00  8.64          O   \nATOM    749  CG  ASP A  93     -17.958  14.419  -0.628  1.00  8.64          C   \nATOM    750  OD1 ASP A  93     -17.828  15.359  -1.442  1.00  8.64          O   \nATOM    751  OD2 ASP A  93     -19.076  13.986  -0.274  1.00  8.64          O   \nATOM    752  N   PRO A  94     -18.711  11.191   1.508  1.00  8.64          N   \nATOM    753  CA  PRO A  94     -19.501  10.003   1.175  1.00  8.64          C   \nATOM    754  C   PRO A  94     -20.029  10.028  -0.257  1.00  8.64          C   \nATOM    755  CB  PRO A  94     -20.652  10.050   2.183  1.00  8.64          C   \nATOM    756  O   PRO A  94     -20.234   8.972  -0.862  1.00  8.64          O   \nATOM    757  CG  PRO A  94     -20.438  11.316   2.948  1.00  8.64          C   \nATOM    758  CD  PRO A  94     -19.181  11.969   2.449  1.00  8.64          C   \nATOM    759  N   LYS A  95     -19.825  11.145  -1.002  1.00  8.64          N   \nATOM    760  CA  LYS A  95     -20.410  11.170  -2.340  1.00  8.64          C   \nATOM    761  C   LYS A  95     -19.342  11.416  -3.402  1.00  8.64          C   \nATOM    762  CB  LYS A  95     -21.496  12.243  -2.431  1.00  8.64          C   \nATOM    763  O   LYS A  95     -19.636  11.407  -4.599  1.00  8.64          O   \nATOM    764  CG  LYS A  95     -22.740  11.936  -1.610  1.00  8.64          C   \nATOM    765  CD  LYS A  95     -23.832  12.972  -1.841  1.00  8.64          C   \nATOM    766  CE  LYS A  95     -25.054  12.701  -0.973  1.00  8.64          C   \nATOM    767  NZ  LYS A  95     -26.134  13.705  -1.208  1.00  8.64          N   \nATOM    768  N   SER A  96     -18.077  11.513  -2.983  1.00  8.64          N   \nATOM    769  CA  SER A  96     -17.157  11.939  -4.032  1.00  8.64          C   \nATOM    770  C   SER A  96     -16.418  10.749  -4.635  1.00  8.64          C   \nATOM    771  CB  SER A  96     -16.149  12.950  -3.483  1.00  8.64          C   \nATOM    772  O   SER A  96     -15.813   9.955  -3.912  1.00  8.64          O   \nATOM    773  OG  SER A  96     -14.940  12.907  -4.222  1.00  8.64          O   \nATOM    774  N   PHE A  97     -16.938  10.059  -5.545  1.00  8.64          N   \nATOM    775  CA  PHE A  97     -16.265   9.188  -6.501  1.00  8.64          C   \nATOM    776  C   PHE A  97     -14.975   9.827  -7.000  1.00  8.64          C   \nATOM    777  CB  PHE A  97     -17.186   8.871  -7.683  1.00  8.64          C   \nATOM    778  O   PHE A  97     -14.111   9.144  -7.554  1.00  8.64          O   \nATOM    779  CG  PHE A  97     -18.358   7.998  -7.322  1.00  8.64          C   \nATOM    780  CD1 PHE A  97     -19.593   8.558  -7.018  1.00  8.64          C   \nATOM    781  CD2 PHE A  97     -18.224   6.616  -7.288  1.00  8.64          C   \nATOM    782  CE1 PHE A  97     -20.679   7.752  -6.684  1.00  8.64          C   \nATOM    783  CE2 PHE A  97     -19.305   5.804  -6.955  1.00  8.64          C   \nATOM    784  CZ  PHE A  97     -20.531   6.375  -6.652  1.00  8.64          C   \nATOM    785  N   LEU A  98     -14.602  11.045  -6.442  1.00  8.64          N   \nATOM    786  CA  LEU A  98     -13.538  11.768  -7.129  1.00  8.64          C   \nATOM    787  C   LEU A  98     -12.193  11.530  -6.451  1.00  8.64          C   \nATOM    788  CB  LEU A  98     -13.845  13.267  -7.166  1.00  8.64          C   \nATOM    789  O   LEU A  98     -11.141  11.781  -7.043  1.00  8.64          O   \nATOM    790  CG  LEU A  98     -14.980  13.704  -8.094  1.00  8.64          C   \nATOM    791  CD1 LEU A  98     -15.347  15.161  -7.833  1.00  8.64          C   \nATOM    792  CD2 LEU A  98     -14.586  13.500  -9.553  1.00  8.64          C   \nATOM    793  N   SER A  99     -12.192  10.556  -5.446  1.00  8.64          N   \nATOM    794  CA  SER A  99     -10.815  10.410  -4.984  1.00  8.64          C   \nATOM    795  C   SER A  99     -10.321   8.979  -5.164  1.00  8.64          C   \nATOM    796  CB  SER A  99     -10.696  10.819  -3.515  1.00  8.64          C   \nATOM    797  O   SER A  99      -9.273   8.607  -4.630  1.00  8.64          O   \nATOM    798  OG  SER A  99     -11.600  10.080  -2.712  1.00  8.64          O   \nATOM    799  N   ILE A 100     -11.121   8.337  -6.116  1.00  6.72          N   \nATOM    800  CA  ILE A 100     -10.638   6.974  -6.304  1.00  6.72          C   \nATOM    801  C   ILE A 100      -9.891   6.870  -7.632  1.00  6.72          C   \nATOM    802  CB  ILE A 100     -11.796   5.953  -6.259  1.00  6.72          C   \nATOM    803  O   ILE A 100     -10.389   7.318  -8.668  1.00  6.72          O   \nATOM    804  CG1 ILE A 100     -12.507   6.010  -4.902  1.00  6.72          C   \nATOM    805  CG2 ILE A 100     -11.282   4.539  -6.549  1.00  6.72          C   \nATOM    806  CD1 ILE A 100     -13.793   5.197  -4.841  1.00  6.72          C   \nATOM    807  N   LYS A 101      -8.620   6.701  -7.581  1.00  6.72          N   \nATOM    808  CA  LYS A 101      -7.845   6.403  -8.782  1.00  6.72          C   \nATOM    809  C   LYS A 101      -7.608   4.902  -8.924  1.00  6.72          C   \nATOM    810  CB  LYS A 101      -6.507   7.144  -8.756  1.00  6.72          C   \nATOM    811  O   LYS A 101      -7.289   4.223  -7.946  1.00  6.72          O   \nATOM    812  CG  LYS A 101      -6.629   8.647  -8.958  1.00  6.72          C   \nATOM    813  CD  LYS A 101      -5.263   9.304  -9.110  1.00  6.72          C   \nATOM    814  CE  LYS A 101      -5.380  10.815  -9.257  1.00  6.72          C   \nATOM    815  NZ  LYS A 101      -4.046  11.459  -9.443  1.00  6.72          N   \nATOM    816  N   GLU A 102      -8.161   4.357  -9.913  1.00  8.64          N   \nATOM    817  CA  GLU A 102      -7.946   2.952 -10.245  1.00  8.64          C   \nATOM    818  C   GLU A 102      -6.847   2.794 -11.292  1.00  8.64          C   \nATOM    819  CB  GLU A 102      -9.244   2.312 -10.744  1.00  8.64          C   \nATOM    820  O   GLU A 102      -6.808   3.537 -12.275  1.00  8.64          O   \nATOM    821  CG  GLU A 102      -9.192   0.793 -10.818  1.00  8.64          C   \nATOM    822  CD  GLU A 102     -10.515   0.167 -11.229  1.00  8.64          C   \nATOM    823  OE1 GLU A 102     -10.588  -0.435 -12.325  1.00  8.64          O   \nATOM    824  OE2 GLU A 102     -11.488   0.280 -10.449  1.00  8.64          O   \nATOM    825  N   TYR A 103      -5.920   1.999 -10.999  1.00  6.72          N   \nATOM    826  CA  TYR A 103      -4.857   1.671 -11.943  1.00  6.72          C   \nATOM    827  C   TYR A 103      -5.001   0.241 -12.451  1.00  6.72          C   \nATOM    828  CB  TYR A 103      -3.483   1.857 -11.292  1.00  6.72          C   \nATOM    829  O   TYR A 103      -5.256  -0.679 -11.670  1.00  6.72          O   \nATOM    830  CG  TYR A 103      -3.244   3.253 -10.767  1.00  6.72          C   \nATOM    831  CD1 TYR A 103      -3.589   3.595  -9.462  1.00  6.72          C   \nATOM    832  CD2 TYR A 103      -2.676   4.231 -11.576  1.00  6.72          C   \nATOM    833  CE1 TYR A 103      -3.372   4.880  -8.975  1.00  6.72          C   \nATOM    834  CE2 TYR A 103      -2.455   5.519 -11.100  1.00  6.72          C   \nATOM    835  OH  TYR A 103      -2.589   7.107  -9.323  1.00  6.72          O   \nATOM    836  CZ  TYR A 103      -2.805   5.833  -9.800  1.00  6.72          C   \nATOM    837  N   LYS A 104      -5.083  -0.004 -13.802  1.00  8.64          N   \nATOM    838  CA  LYS A 104      -5.140  -1.339 -14.393  1.00  8.64          C   \nATOM    839  C   LYS A 104      -3.759  -1.796 -14.852  1.00  8.64          C   \nATOM    840  CB  LYS A 104      -6.119  -1.364 -15.568  1.00  8.64          C   \nATOM    841  O   LYS A 104      -3.042  -1.048 -15.520  1.00  8.64          O   \nATOM    842  CG  LYS A 104      -6.341  -2.749 -16.158  1.00  8.64          C   \nATOM    843  CD  LYS A 104      -7.313  -2.708 -17.331  1.00  8.64          C   \nATOM    844  CE  LYS A 104      -7.429  -4.065 -18.010  1.00  8.64          C   \nATOM    845  NZ  LYS A 104      -8.354  -4.022 -19.181  1.00  8.64          N   \nATOM    846  N   PHE A 105      -3.346  -2.868 -14.276  1.00  8.64          N   \nATOM    847  CA  PHE A 105      -2.144  -3.522 -14.782  1.00  8.64          C   \nATOM    848  C   PHE A 105      -2.504  -4.749 -15.611  1.00  8.64          C   \nATOM    849  CB  PHE A 105      -1.221  -3.921 -13.626  1.00  8.64          C   \nATOM    850  O   PHE A 105      -3.367  -5.537 -15.220  1.00  8.64          O   \nATOM    851  CG  PHE A 105      -0.739  -2.756 -12.804  1.00  8.64          C   \nATOM    852  CD1 PHE A 105      -1.429  -2.357 -11.666  1.00  8.64          C   \nATOM    853  CD2 PHE A 105       0.405  -2.059 -13.171  1.00  8.64          C   \nATOM    854  CE1 PHE A 105      -0.985  -1.279 -10.904  1.00  8.64          C   \nATOM    855  CE2 PHE A 105       0.855  -0.981 -12.414  1.00  8.64          C   \nATOM    856  CZ  PHE A 105       0.158  -0.592 -11.282  1.00  8.64          C   \nATOM    857  N   GLY A 106      -2.172  -4.885 -16.945  1.00  8.64          N   \nATOM    858  CA  GLY A 106      -2.470  -5.978 -17.858  1.00  8.64          C   \nATOM    859  C   GLY A 106      -1.496  -7.136 -17.740  1.00  8.64          C   \nATOM    860  O   GLY A 106      -0.364  -6.957 -17.287  1.00  8.64          O   \nATOM    861  N   THR A 107      -1.964  -8.404 -17.592  1.00  8.64          N   \nATOM    862  CA  THR A 107      -1.518  -9.786 -17.454  1.00  8.64          C   \nATOM    863  C   THR A 107      -0.972 -10.313 -18.777  1.00  8.64          C   \nATOM    864  CB  THR A 107      -2.662 -10.696 -16.969  1.00  8.64          C   \nATOM    865  O   THR A 107      -0.155 -11.237 -18.794  1.00  8.64          O   \nATOM    866  CG2 THR A 107      -2.988 -10.435 -15.502  1.00  8.64          C   \nATOM    867  OG1 THR A 107      -3.831 -10.446 -17.758  1.00  8.64          O   \nATOM    868  N   ARG A 108      -0.421  -9.500 -19.707  1.00  8.64          N   \nATOM    869  CA  ARG A 108       0.415 -10.048 -20.770  1.00  8.64          C   \nATOM    870  C   ARG A 108       0.370  -9.165 -22.012  1.00  8.64          C   \nATOM    871  CB  ARG A 108      -0.025 -11.471 -21.121  1.00  8.64          C   \nATOM    872  O   ARG A 108       1.162  -9.347 -22.939  1.00  8.64          O   \nATOM    873  CG  ARG A 108       0.888 -12.553 -20.567  1.00  8.64          C   \nATOM    874  CD  ARG A 108       0.437 -13.943 -20.992  1.00  8.64          C   \nATOM    875  NE  ARG A 108       1.440 -14.956 -20.674  1.00  8.64          N   \nATOM    876  NH1 ARG A 108       0.214 -16.728 -21.506  1.00  8.64          N   \nATOM    877  NH2 ARG A 108       2.286 -17.089 -20.593  1.00  8.64          N   \nATOM    878  CZ  ARG A 108       1.311 -16.255 -20.925  1.00  8.64          C   \nATOM    879  N   THR A 109       0.007  -7.906 -21.921  1.00  8.64          N   \nATOM    880  CA  THR A 109       0.199  -7.193 -23.179  1.00  8.64          C   \nATOM    881  C   THR A 109       0.557  -5.731 -22.923  1.00  8.64          C   \nATOM    882  CB  THR A 109      -1.060  -7.269 -24.063  1.00  8.64          C   \nATOM    883  O   THR A 109      -0.113  -5.050 -22.143  1.00  8.64          O   \nATOM    884  CG2 THR A 109      -1.194  -8.643 -24.711  1.00  8.64          C   \nATOM    885  OG1 THR A 109      -2.218  -7.018 -23.257  1.00  8.64          O   \nATOM    886  N   GLY A 110       1.725  -5.448 -22.409  1.00  8.64          N   \nATOM    887  CA  GLY A 110       2.620  -4.305 -22.494  1.00  8.64          C   \nATOM    888  C   GLY A 110       1.933  -3.044 -22.984  1.00  8.64          C   \nATOM    889  O   GLY A 110       1.499  -2.976 -24.136  1.00  8.64          O   \nATOM    890  N   GLY A 111       0.749  -2.551 -22.421  1.00  8.64          N   \nATOM    891  CA  GLY A 111       0.179  -1.258 -22.766  1.00  8.64          C   \nATOM    892  C   GLY A 111       1.093  -0.094 -22.431  1.00  8.64          C   \nATOM    893  O   GLY A 111       1.993  -0.225 -21.598  1.00  8.64          O   \nATOM    894  N   ASN A 112       1.646   0.666 -23.583  1.00  8.64          N   \nATOM    895  CA  ASN A 112       2.351   1.904 -23.896  1.00  8.64          C   \nATOM    896  C   ASN A 112       2.500   2.792 -22.664  1.00  8.64          C   \nATOM    897  CB  ASN A 112       1.633   2.664 -25.014  1.00  8.64          C   \nATOM    898  O   ASN A 112       1.528   3.028 -21.943  1.00  8.64          O   \nATOM    899  CG  ASN A 112       1.795   2.002 -26.368  1.00  8.64          C   \nATOM    900  ND2 ASN A 112       0.868   2.277 -27.278  1.00  8.64          N   \nATOM    901  OD1 ASN A 112       2.746   1.248 -26.594  1.00  8.64          O   \nATOM    902  N   PHE A 113       3.510   2.618 -21.947  1.00  8.64          N   \nATOM    903  CA  PHE A 113       4.082   3.644 -21.083  1.00  8.64          C   \nATOM    904  C   PHE A 113       4.194   4.972 -21.821  1.00  8.64          C   \nATOM    905  CB  PHE A 113       5.459   3.211 -20.570  1.00  8.64          C   \nATOM    906  O   PHE A 113       4.651   5.016 -22.966  1.00  8.64          O   \nATOM    907  CG  PHE A 113       5.526   3.047 -19.075  1.00  8.64          C   \nATOM    908  CD1 PHE A 113       5.224   1.827 -18.482  1.00  8.64          C   \nATOM    909  CD2 PHE A 113       5.890   4.113 -18.264  1.00  8.64          C   \nATOM    910  CE1 PHE A 113       5.285   1.672 -17.099  1.00  8.64          C   \nATOM    911  CE2 PHE A 113       5.953   3.966 -16.881  1.00  8.64          C   \nATOM    912  CZ  PHE A 113       5.649   2.745 -16.300  1.00  8.64          C   \nATOM    913  N   THR A 114       3.305   5.791 -21.704  1.00  8.64          N   \nATOM    914  CA  THR A 114       3.524   7.113 -22.280  1.00  8.64          C   \nATOM    915  C   THR A 114       4.409   7.959 -21.369  1.00  8.64          C   \nATOM    916  CB  THR A 114       2.190   7.843 -22.526  1.00  8.64          C   \nATOM    917  O   THR A 114       4.850   9.044 -21.756  1.00  8.64          O   \nATOM    918  CG2 THR A 114       1.348   7.113 -23.568  1.00  8.64          C   \nATOM    919  OG1 THR A 114       1.456   7.913 -21.298  1.00  8.64          O   \nATOM    920  N   GLY A 115       5.268   7.248 -20.677  1.00  8.64          N   \nATOM    921  CA  GLY A 115       6.263   8.086 -20.027  1.00  8.64          C   \nATOM    922  C   GLY A 115       7.507   7.322 -19.614  1.00  8.64          C   \nATOM    923  O   GLY A 115       7.525   6.090 -19.647  1.00  8.64          O   \nATOM    924  N   GLU A 116       8.641   7.657 -20.084  1.00  8.64          N   \nATOM    925  CA  GLU A 116       9.970   7.216 -19.672  1.00  8.64          C   \nATOM    926  C   GLU A 116      10.120   7.260 -18.154  1.00  8.64          C   \nATOM    927  CB  GLU A 116      11.051   8.077 -20.332  1.00  8.64          C   \nATOM    928  O   GLU A 116       9.646   8.194 -17.505  1.00  8.64          O   \nATOM    929  CG  GLU A 116      11.400   7.645 -21.749  1.00  8.64          C   \nATOM    930  CD  GLU A 116      12.569   8.417 -22.341  1.00  8.64          C   \nATOM    931  OE1 GLU A 116      12.995   8.099 -23.474  1.00  8.64          O   \nATOM    932  OE2 GLU A 116      13.062   9.347 -21.665  1.00  8.64          O   \nATOM    933  N   LEU A 117      10.088   5.989 -17.564  1.00  8.64          N   \nATOM    934  CA  LEU A 117      10.578   5.973 -16.190  1.00  8.64          C   \nATOM    935  C   LEU A 117      12.036   6.415 -16.127  1.00  8.64          C   \nATOM    936  CB  LEU A 117      10.430   4.575 -15.584  1.00  8.64          C   \nATOM    937  O   LEU A 117      12.809   6.155 -17.053  1.00  8.64          O   \nATOM    938  CG  LEU A 117       9.001   4.097 -15.323  1.00  8.64          C   \nATOM    939  CD1 LEU A 117       8.989   2.601 -15.025  1.00  8.64          C   \nATOM    940  CD2 LEU A 117       8.376   4.881 -14.175  1.00  8.64          C   \nATOM    941  N   THR A 118      12.196   7.278 -15.327  1.00  8.64          N   \nATOM    942  CA  THR A 118      13.590   7.626 -15.076  1.00  8.64          C   \nATOM    943  C   THR A 118      14.353   6.432 -14.511  1.00  8.64          C   \nATOM    944  CB  THR A 118      13.702   8.816 -14.105  1.00  8.64          C   \nATOM    945  O   THR A 118      13.747   5.457 -14.061  1.00  8.64          O   \nATOM    946  CG2 THR A 118      12.896  10.011 -14.604  1.00  8.64          C   \nATOM    947  OG1 THR A 118      13.207   8.424 -12.818  1.00  8.64          O   \nATOM    948  N   LYS A 119      15.698   6.199 -14.938  1.00  8.64          N   \nATOM    949  CA  LYS A 119      16.574   5.167 -14.391  1.00  8.64          C   \nATOM    950  C   LYS A 119      16.371   5.015 -12.886  1.00  8.64          C   \nATOM    951  CB  LYS A 119      18.038   5.489 -14.693  1.00  8.64          C   \nATOM    952  O   LYS A 119      16.303   3.897 -12.373  1.00  8.64          O   \nATOM    953  CG  LYS A 119      18.973   4.296 -14.566  1.00  8.64          C   \nATOM    954  CD  LYS A 119      20.389   4.646 -15.006  1.00  8.64          C   \nATOM    955  CE  LYS A 119      21.344   3.477 -14.803  1.00  8.64          C   \nATOM    956  NZ  LYS A 119      22.724   3.802 -15.272  1.00  8.64          N   \nATOM    957  N   GLN A 120      16.211   6.129 -12.176  1.00  8.64          N   \nATOM    958  CA  GLN A 120      16.025   6.126 -10.729  1.00  8.64          C   \nATOM    959  C   GLN A 120      14.683   5.507 -10.349  1.00  8.64          C   \nATOM    960  CB  GLN A 120      16.124   7.547 -10.171  1.00  8.64          C   \nATOM    961  O   GLN A 120      14.600   4.729  -9.396  1.00  8.64          O   \nATOM    962  CG  GLN A 120      17.540   7.960  -9.792  1.00  8.64          C   \nATOM    963  CD  GLN A 120      17.891   9.357 -10.270  1.00  8.64          C   \nATOM    964  NE2 GLN A 120      19.145   9.751 -10.077  1.00  8.64          N   \nATOM    965  OE1 GLN A 120      17.043  10.074 -10.809  1.00  8.64          O   \nATOM    966  N   GLU A 121      13.628   5.733 -11.076  1.00  8.64          N   \nATOM    967  CA  GLU A 121      12.298   5.200 -10.795  1.00  8.64          C   \nATOM    968  C   GLU A 121      12.253   3.689 -11.006  1.00  8.64          C   \nATOM    969  CB  GLU A 121      11.248   5.885 -11.674  1.00  8.64          C   \nATOM    970  O   GLU A 121      11.648   2.965 -10.213  1.00  8.64          O   \nATOM    971  CG  GLU A 121      10.953   7.323 -11.272  1.00  8.64          C   \nATOM    972  CD  GLU A 121      10.094   8.064 -12.284  1.00  8.64          C   \nATOM    973  OE1 GLU A 121       9.364   9.002 -11.889  1.00  8.64          O   \nATOM    974  OE2 GLU A 121      10.149   7.704 -13.481  1.00  8.64          O   \nATOM    975  N   LEU A 122      12.979   3.340 -12.063  1.00  8.64          N   \nATOM    976  CA  LEU A 122      13.046   1.913 -12.359  1.00  8.64          C   \nATOM    977  C   LEU A 122      13.813   1.168 -11.272  1.00  8.64          C   \nATOM    978  CB  LEU A 122      13.709   1.678 -13.719  1.00  8.64          C   \nATOM    979  O   LEU A 122      13.397   0.090 -10.840  1.00  8.64          O   \nATOM    980  CG  LEU A 122      12.936   0.805 -14.709  1.00  8.64          C   \nATOM    981  CD1 LEU A 122      12.751   1.540 -16.032  1.00  8.64          C   \nATOM    982  CD2 LEU A 122      13.653  -0.523 -14.925  1.00  8.64          C   \nATOM    983  N   VAL A 123      14.840   1.780 -10.710  1.00  8.64          N   \nATOM    984  CA  VAL A 123      15.653   1.191  -9.651  1.00  8.64          C   \nATOM    985  C   VAL A 123      14.832   1.085  -8.368  1.00  8.64          C   \nATOM    986  CB  VAL A 123      16.936   2.013  -9.397  1.00  8.64          C   \nATOM    987  O   VAL A 123      14.826   0.040  -7.712  1.00  8.64          O   \nATOM    988  CG1 VAL A 123      17.646   1.529  -8.134  1.00  8.64          C   \nATOM    989  CG2 VAL A 123      17.870   1.931 -10.603  1.00  8.64          C   \nATOM    990  N   TYR A 124      14.059   2.039  -8.098  1.00  8.64          N   \nATOM    991  CA  TYR A 124      13.254   2.069  -6.881  1.00  8.64          C   \nATOM    992  C   TYR A 124      12.121   1.051  -6.952  1.00  8.64          C   \nATOM    993  CB  TYR A 124      12.683   3.471  -6.649  1.00  8.64          C   \nATOM    994  O   TYR A 124      11.855   0.342  -5.979  1.00  8.64          O   \nATOM    995  CG  TYR A 124      13.673   4.438  -6.047  1.00  8.64          C   \nATOM    996  CD1 TYR A 124      13.975   5.640  -6.682  1.00  8.64          C   \nATOM    997  CD2 TYR A 124      14.309   4.151  -4.844  1.00  8.64          C   \nATOM    998  CE1 TYR A 124      14.889   6.534  -6.133  1.00  8.64          C   \nATOM    999  CE2 TYR A 124      15.225   5.037  -4.286  1.00  8.64          C   \nATOM   1000  OH  TYR A 124      16.413   7.105  -4.387  1.00  8.64          O   \nATOM   1001  CZ  TYR A 124      15.507   6.224  -4.936  1.00  8.64          C   \nATOM   1002  N   THR A 125      11.428   1.001  -8.096  1.00  6.72          N   \nATOM   1003  CA  THR A 125      10.313   0.078  -8.276  1.00  6.72          C   \nATOM   1004  C   THR A 125      10.789  -1.369  -8.188  1.00  6.72          C   \nATOM   1005  CB  THR A 125       9.609   0.308  -9.626  1.00  6.72          C   \nATOM   1006  O   THR A 125      10.169  -2.192  -7.510  1.00  6.72          O   \nATOM   1007  CG2 THR A 125       8.382  -0.585  -9.767  1.00  6.72          C   \nATOM   1008  OG1 THR A 125       9.202   1.679  -9.718  1.00  6.72          O   \nATOM   1009  N   ASN A 126      11.985  -1.576  -8.827  1.00  8.64          N   \nATOM   1010  CA  ASN A 126      12.563  -2.916  -8.803  1.00  8.64          C   \nATOM   1011  C   ASN A 126      13.002  -3.311  -7.396  1.00  8.64          C   \nATOM   1012  CB  ASN A 126      13.742  -3.009  -9.773  1.00  8.64          C   \nATOM   1013  O   ASN A 126      12.771  -4.442  -6.965  1.00  8.64          O   \nATOM   1014  CG  ASN A 126      13.310  -3.334 -11.189  1.00  8.64          C   \nATOM   1015  ND2 ASN A 126      14.170  -3.035 -12.156  1.00  8.64          N   \nATOM   1016  OD1 ASN A 126      12.211  -3.848 -11.413  1.00  8.64          O   \nATOM   1017  N   GLN A 127      13.590  -2.342  -6.627  1.00  8.64          N   \nATOM   1018  CA  GLN A 127      14.004  -2.576  -5.247  1.00  8.64          C   \nATOM   1019  C   GLN A 127      12.798  -2.827  -4.346  1.00  8.64          C   \nATOM   1020  CB  GLN A 127      14.814  -1.390  -4.721  1.00  8.64          C   \nATOM   1021  O   GLN A 127      12.824  -3.725  -3.501  1.00  8.64          O   \nATOM   1022  CG  GLN A 127      16.303  -1.478  -5.029  1.00  8.64          C   \nATOM   1023  CD  GLN A 127      17.083  -0.291  -4.496  1.00  8.64          C   \nATOM   1024  NE2 GLN A 127      18.405  -0.421  -4.454  1.00  8.64          N   \nATOM   1025  OE1 GLN A 127      16.503   0.734  -4.125  1.00  8.64          O   \nATOM   1026  N   TRP A 128      11.824  -2.167  -4.535  1.00  6.72          N   \nATOM   1027  CA  TRP A 128      10.602  -2.286  -3.746  1.00  6.72          C   \nATOM   1028  C   TRP A 128       9.926  -3.632  -3.989  1.00  6.72          C   \nATOM   1029  CB  TRP A 128       9.634  -1.147  -4.077  1.00  6.72          C   \nATOM   1030  O   TRP A 128       9.562  -4.331  -3.040  1.00  6.72          O   \nATOM   1031  CG  TRP A 128       8.375  -1.162  -3.264  1.00  6.72          C   \nATOM   1032  CD1 TRP A 128       8.207  -0.675  -1.997  1.00  6.72          C   \nATOM   1033  CD2 TRP A 128       7.108  -1.696  -3.661  1.00  6.72          C   \nATOM   1034  CE2 TRP A 128       6.216  -1.497  -2.584  1.00  6.72          C   \nATOM   1035  CE3 TRP A 128       6.641  -2.322  -4.824  1.00  6.72          C   \nATOM   1036  NE1 TRP A 128       6.910  -0.874  -1.583  1.00  6.72          N   \nATOM   1037  CH2 TRP A 128       4.449  -2.515  -3.786  1.00  6.72          C   \nATOM   1038  CZ2 TRP A 128       4.880  -1.904  -2.637  1.00  6.72          C   \nATOM   1039  CZ3 TRP A 128       5.311  -2.726  -4.874  1.00  6.72          C   \nATOM   1040  N   VAL A 129       9.837  -4.041  -5.286  1.00  6.72          N   \nATOM   1041  CA  VAL A 129       9.170  -5.280  -5.670  1.00  6.72          C   \nATOM   1042  C   VAL A 129       9.963  -6.477  -5.149  1.00  6.72          C   \nATOM   1043  CB  VAL A 129       8.999  -5.381  -7.203  1.00  6.72          C   \nATOM   1044  O   VAL A 129       9.389  -7.411  -4.585  1.00  6.72          O   \nATOM   1045  CG1 VAL A 129       8.505  -6.771  -7.600  1.00  6.72          C   \nATOM   1046  CG2 VAL A 129       8.036  -4.306  -7.703  1.00  6.72          C   \nATOM   1047  N   ASN A 130      11.351  -6.333  -5.277  1.00  8.64          N   \nATOM   1048  CA  ASN A 130      12.247  -7.407  -4.861  1.00  8.64          C   \nATOM   1049  C   ASN A 130      12.259  -7.571  -3.344  1.00  8.64          C   \nATOM   1050  CB  ASN A 130      13.664  -7.155  -5.379  1.00  8.64          C   \nATOM   1051  O   ASN A 130      12.263  -8.695  -2.837  1.00  8.64          O   \nATOM   1052  CG  ASN A 130      13.854  -7.617  -6.810  1.00  8.64          C   \nATOM   1053  ND2 ASN A 130      14.863  -7.073  -7.481  1.00  8.64          N   \nATOM   1054  OD1 ASN A 130      13.100  -8.457  -7.309  1.00  8.64          O   \nATOM   1055  N   GLU A 131      12.069  -6.443  -2.521  1.00  8.64          N   \nATOM   1056  CA  GLU A 131      12.094  -6.449  -1.061  1.00  8.64          C   \nATOM   1057  C   GLU A 131      10.759  -6.913  -0.488  1.00  8.64          C   \nATOM   1058  CB  GLU A 131      12.442  -5.058  -0.524  1.00  8.64          C   \nATOM   1059  O   GLU A 131      10.721  -7.591   0.541  1.00  8.64          O   \nATOM   1060  CG  GLU A 131      13.913  -4.694  -0.665  1.00  8.64          C   \nATOM   1061  CD  GLU A 131      14.234  -3.292  -0.171  1.00  8.64          C   \nATOM   1062  OE1 GLU A 131      15.414  -2.879  -0.244  1.00  8.64          O   \nATOM   1063  OE2 GLU A 131      13.299  -2.603   0.293  1.00  8.64          O   \nATOM   1064  N   ASN A 132       9.736  -6.720  -1.184  1.00  8.64          N   \nATOM   1065  CA  ASN A 132       8.429  -6.916  -0.566  1.00  8.64          C   \nATOM   1066  C   ASN A 132       7.786  -8.224  -1.016  1.00  8.64          C   \nATOM   1067  CB  ASN A 132       7.506  -5.736  -0.876  1.00  8.64          C   \nATOM   1068  O   ASN A 132       7.067  -8.865  -0.247  1.00  8.64          O   \nATOM   1069  CG  ASN A 132       7.833  -4.505  -0.054  1.00  8.64          C   \nATOM   1070  ND2 ASN A 132       8.463  -3.521  -0.684  1.00  8.64          N   \nATOM   1071  OD1 ASN A 132       7.524  -4.440   1.139  1.00  8.64          O   \nATOM   1072  N   ILE A 133       8.282  -8.675  -2.231  1.00  8.64          N   \nATOM   1073  CA  ILE A 133       7.755  -9.943  -2.723  1.00  8.64          C   \nATOM   1074  C   ILE A 133       8.504 -11.102  -2.068  1.00  8.64          C   \nATOM   1075  CB  ILE A 133       7.858 -10.039  -4.261  1.00  8.64          C   \nATOM   1076  O   ILE A 133       7.902 -12.121  -1.721  1.00  8.64          O   \nATOM   1077  CG1 ILE A 133       6.915  -9.029  -4.924  1.00  8.64          C   \nATOM   1078  CG2 ILE A 133       7.555 -11.464  -4.735  1.00  8.64          C   \nATOM   1079  CD1 ILE A 133       7.015  -8.993  -6.443  1.00  8.64          C   \nATOM   1080  N   THR A 134       9.730 -10.791  -1.686  1.00  8.64          N   \nATOM   1081  CA  THR A 134      10.543 -11.821  -1.050  1.00  8.64          C   \nATOM   1082  C   THR A 134      10.104 -12.041   0.394  1.00  8.64          C   \nATOM   1083  CB  THR A 134      12.038 -11.453  -1.085  1.00  8.64          C   \nATOM   1084  O   THR A 134      10.048 -13.179   0.865  1.00  8.64          O   \nATOM   1085  CG2 THR A 134      12.910 -12.668  -0.785  1.00  8.64          C   \nATOM   1086  OG1 THR A 134      12.370 -10.951  -2.386  1.00  8.64          O   \nATOM   1087  N   LEU A 135       9.481 -11.013   1.084  1.00  8.64          N   \nATOM   1088  CA  LEU A 135       9.061 -11.103   2.479  1.00  8.64          C   \nATOM   1089  C   LEU A 135       7.653 -11.678   2.586  1.00  8.64          C   \nATOM   1090  CB  LEU A 135       9.114  -9.726   3.145  1.00  8.64          C   \nATOM   1091  O   LEU A 135       7.369 -12.474   3.484  1.00  8.64          O   \nATOM   1092  CG  LEU A 135      10.480  -9.278   3.668  1.00  8.64          C   \nATOM   1093  CD1 LEU A 135      10.532  -7.758   3.780  1.00  8.64          C   \nATOM   1094  CD2 LEU A 135      10.777  -9.929   5.014  1.00  8.64          C   \nATOM   1095  N   ALA A 136       6.896 -11.485   1.503  1.00  8.64          N   \nATOM   1096  CA  ALA A 136       5.482 -11.826   1.637  1.00  8.64          C   \nATOM   1097  C   ALA A 136       5.208 -13.240   1.133  1.00  8.64          C   \nATOM   1098  CB  ALA A 136       4.618 -10.818   0.882  1.00  8.64          C   \nATOM   1099  O   ALA A 136       4.289 -13.909   1.611  1.00  8.64          O   \nATOM   1100  N   ASN A 137       6.194 -13.758   0.415  1.00  8.64          N   \nATOM   1101  CA  ASN A 137       6.057 -15.090  -0.164  1.00  8.64          C   \nATOM   1102  C   ASN A 137       6.849 -16.128   0.626  1.00  8.64          C   \nATOM   1103  CB  ASN A 137       6.499 -15.087  -1.629  1.00  8.64          C   \nATOM   1104  O   ASN A 137       8.055 -15.975   0.826  1.00  8.64          O   \nATOM   1105  CG  ASN A 137       5.464 -14.473  -2.550  1.00  8.64          C   \nATOM   1106  ND2 ASN A 137       5.908 -13.993  -3.705  1.00  8.64          N   \nATOM   1107  OD1 ASN A 137       4.274 -14.431  -2.226  1.00  8.64          O   \nATOM   1108  N   GLY A 138       6.587 -16.377   1.995  1.00  8.64          N   \nATOM   1109  CA  GLY A 138       6.876 -17.550   2.803  1.00  8.64          C   \nATOM   1110  C   GLY A 138       7.966 -18.427   2.215  1.00  8.64          C   \nATOM   1111  O   GLY A 138       8.031 -19.623   2.504  1.00  8.64          O   \nATOM   1112  N   TYR A 139       9.137 -17.824   1.543  1.00  8.64          N   \nATOM   1113  CA  TYR A 139      10.214 -18.693   1.080  1.00  8.64          C   \nATOM   1114  C   TYR A 139      11.083 -19.153   2.245  1.00  8.64          C   \nATOM   1115  CB  TYR A 139      11.076 -17.973   0.039  1.00  8.64          C   \nATOM   1116  O   TYR A 139      11.385 -18.370   3.149  1.00  8.64          O   \nATOM   1117  CG  TYR A 139      10.546 -18.087  -1.370  1.00  8.64          C   \nATOM   1118  CD1 TYR A 139       9.749 -17.085  -1.919  1.00  8.64          C   \nATOM   1119  CD2 TYR A 139      10.841 -19.197  -2.155  1.00  8.64          C   \nATOM   1120  CE1 TYR A 139       9.257 -17.187  -3.216  1.00  8.64          C   \nATOM   1121  CE2 TYR A 139      10.355 -19.309  -3.454  1.00  8.64          C   \nATOM   1122  OH  TYR A 139       9.082 -18.406  -5.260  1.00  8.64          O   \nATOM   1123  CZ  TYR A 139       9.566 -18.300  -3.975  1.00  8.64          C   \nATOM   1124  N   ILE A 140      10.744 -20.317   2.913  1.00  8.64          N   \nATOM   1125  CA  ILE A 140      11.618 -21.208   3.668  1.00  8.64          C   \nATOM   1126  C   ILE A 140      13.062 -21.031   3.204  1.00  8.64          C   \nATOM   1127  CB  ILE A 140      11.185 -22.684   3.518  1.00  8.64          C   \nATOM   1128  O   ILE A 140      13.364 -21.194   2.020  1.00  8.64          O   \nATOM   1129  CG1 ILE A 140       9.748 -22.872   4.019  1.00  8.64          C   \nATOM   1130  CG2 ILE A 140      12.150 -23.609   4.265  1.00  8.64          C   \nATOM   1131  CD1 ILE A 140       9.252 -24.310   3.951  1.00  8.64          C   \nATOM   1132  N   SER A 141      13.713 -20.010   3.556  1.00  8.64          N   \nATOM   1133  CA  SER A 141      15.171 -20.025   3.497  1.00  8.64          C   \nATOM   1134  C   SER A 141      15.734 -21.319   4.073  1.00  8.64          C   \nATOM   1135  CB  SER A 141      15.750 -18.827   4.252  1.00  8.64          C   \nATOM   1136  O   SER A 141      15.479 -21.652   5.233  1.00  8.64          O   \nATOM   1137  OG  SER A 141      17.145 -18.982   4.447  1.00  8.64          O   \nATOM   1138  N   ALA A 142      15.693 -22.473   3.364  1.00  8.64          N   \nATOM   1139  CA  ALA A 142      16.460 -23.706   3.208  1.00  8.64          C   \nATOM   1140  C   ALA A 142      17.958 -23.439   3.331  1.00  8.64          C   \nATOM   1141  CB  ALA A 142      16.148 -24.360   1.864  1.00  8.64          C   \nATOM   1142  O   ALA A 142      18.474 -22.483   2.749  1.00  8.64          O   \nATOM   1143  N   ASP A 143      18.576 -22.902   4.585  1.00  8.64          N   \nATOM   1144  CA  ASP A 143      19.977 -23.243   4.809  1.00  8.64          C   \nATOM   1145  C   ASP A 143      20.646 -22.233   5.738  1.00  8.64          C   \nATOM   1146  CB  ASP A 143      20.732 -23.315   3.480  1.00  8.64          C   \nATOM   1147  O   ASP A 143      20.988 -21.126   5.317  1.00  8.64          O   \nATOM   1148  CG  ASP A 143      21.865 -24.326   3.495  1.00  8.64          C   \nATOM   1149  OD1 ASP A 143      22.444 -24.609   2.424  1.00  8.64          O   \nATOM   1150  OD2 ASP A 143      22.180 -24.846   4.587  1.00  8.64          O   \nATOM   1151  N   SER A 144      20.228 -21.957   7.002  1.00  8.64          N   \nATOM   1152  CA  SER A 144      21.341 -21.510   7.832  1.00  8.64          C   \nATOM   1153  C   SER A 144      21.253 -22.095   9.238  1.00  8.64          C   \nATOM   1154  CB  SER A 144      21.373 -19.983   7.908  1.00  8.64          C   \nATOM   1155  O   SER A 144      21.817 -21.541  10.183  1.00  8.64          O   \nATOM   1156  OG  SER A 144      20.155 -19.479   8.427  1.00  8.64          O   \nATOM   1157  N   ARG A 145      20.767 -23.335   9.468  1.00  8.64          N   \nATOM   1158  CA  ARG A 145      20.907 -23.823  10.836  1.00  8.64          C   \nATOM   1159  C   ARG A 145      22.363 -24.145  11.156  1.00  8.64          C   \nATOM   1160  CB  ARG A 145      20.036 -25.062  11.058  1.00  8.64          C   \nATOM   1161  O   ARG A 145      23.035 -24.835  10.387  1.00  8.64          O   \nATOM   1162  CG  ARG A 145      18.542 -24.781  11.007  1.00  8.64          C   \nATOM   1163  CD  ARG A 145      17.724 -26.058  11.140  1.00  8.64          C   \nATOM   1164  NE  ARG A 145      17.859 -26.910   9.963  1.00  8.64          N   \nATOM   1165  NH1 ARG A 145      16.657 -28.674  10.846  1.00  8.64          N   \nATOM   1166  NH2 ARG A 145      17.532 -28.821   8.732  1.00  8.64          N   \nATOM   1167  CZ  ARG A 145      17.349 -28.133   9.850  1.00  8.64          C   \nATOM   1168  N   THR A 146      23.240 -23.194  11.377  1.00  8.64          N   \nATOM   1169  CA  THR A 146      24.353 -23.445  12.287  1.00  8.64          C   \nATOM   1170  C   THR A 146      23.848 -23.974  13.626  1.00  8.64          C   \nATOM   1171  CB  THR A 146      25.186 -22.170  12.516  1.00  8.64          C   \nATOM   1172  O   THR A 146      22.915 -23.417  14.208  1.00  8.64          O   \nATOM   1173  CG2 THR A 146      26.113 -21.899  11.336  1.00  8.64          C   \nATOM   1174  OG1 THR A 146      24.303 -21.054  12.683  1.00  8.64          O   \nATOM   1175  N   VAL A 147      23.601 -25.297  13.669  1.00  8.64          N   \nATOM   1176  CA  VAL A 147      23.604 -26.015  14.940  1.00  8.64          C   \nATOM   1177  C   VAL A 147      25.042 -26.295  15.372  1.00  8.64          C   \nATOM   1178  CB  VAL A 147      22.809 -27.337  14.846  1.00  8.64          C   \nATOM   1179  O   VAL A 147      25.856 -26.768  14.575  1.00  8.64          O   \nATOM   1180  CG1 VAL A 147      22.708 -28.004  16.217  1.00  8.64          C   \nATOM   1181  CG2 VAL A 147      21.418 -27.082  14.269  1.00  8.64          C   \nATOM   1182  N   ASP A 148      25.801 -25.404  15.970  1.00  8.64          N   \nATOM   1183  CA  ASP A 148      26.582 -25.450  17.202  1.00  8.64          C   \nATOM   1184  C   ASP A 148      27.024 -24.051  17.625  1.00  8.64          C   \nATOM   1185  CB  ASP A 148      27.802 -26.358  17.031  1.00  8.64          C   \nATOM   1186  O   ASP A 148      27.467 -23.256  16.793  1.00  8.64          O   \nATOM   1187  CG  ASP A 148      27.486 -27.826  17.259  1.00  8.64          C   \nATOM   1188  OD1 ASP A 148      28.258 -28.694  16.799  1.00  8.64          O   \nATOM   1189  OD2 ASP A 148      26.454 -28.116  17.901  1.00  8.64          O   \nTER    1190      ASP A 148\nENDMDL\nEND\n"
  },
  {
    "path": "alphafold/relax/utils.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Utils for minimization.\"\"\"\nimport io\nfrom alphafold.common import residue_constants\nfrom Bio import PDB\nimport numpy as np\n\n\ndef overwrite_b_factors(pdb_str: str, bfactors: np.ndarray) -> str:\n  \"\"\"Overwrites the B-factors in pdb_str with contents of bfactors array.\n\n  Args:\n    pdb_str: An input PDB string.\n    bfactors: A numpy array with shape [1, n_residues, 37]. We assume that the\n      B-factors are per residue; i.e. that the nonzero entries are identical in\n      [0, i, :].\n\n  Returns:\n    A new PDB string with the B-factors replaced.\n  \"\"\"\n  if bfactors.shape[-1] != residue_constants.atom_type_num:\n    raise ValueError(\n        f'Invalid final dimension size for bfactors: {bfactors.shape[-1]}.')\n\n  parser = PDB.PDBParser(QUIET=True)\n  handle = io.StringIO(pdb_str)\n  structure = parser.get_structure('', handle)\n\n  curr_resid = ('', '', '')\n  idx = -1\n  for atom in structure.get_atoms():\n    atom_resid = atom.parent.get_id()\n    if atom_resid != curr_resid:\n      idx += 1\n      if idx >= bfactors.shape[0]:\n        raise ValueError('Index into bfactors exceeds number of residues. '\n                         'B-factors shape: {shape}, idx: {idx}.')\n    curr_resid = atom_resid\n    atom.bfactor = bfactors[idx, residue_constants.atom_order['CA']]\n\n  new_pdb = io.StringIO()\n  pdb_io = PDB.PDBIO()\n  pdb_io.set_structure(structure)\n  pdb_io.save(new_pdb)\n  return new_pdb.getvalue()\n\n\ndef assert_equal_nonterminal_atom_types(\n    atom_mask: np.ndarray, ref_atom_mask: np.ndarray):\n  \"\"\"Checks that pre- and post-minimized proteins have same atom set.\"\"\"\n  # Ignore any terminal OXT atoms which may have been added by minimization.\n  oxt = residue_constants.atom_order['OXT']\n  no_oxt_mask = np.ones(shape=atom_mask.shape, dtype=bool)\n  no_oxt_mask[..., oxt] = False\n  np.testing.assert_almost_equal(ref_atom_mask[no_oxt_mask],\n                                 atom_mask[no_oxt_mask])\n"
  },
  {
    "path": "alphafold/relax/utils_test.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Tests for utils.\"\"\"\n\nimport os\n\nfrom absl.testing import absltest\nfrom alphafold.common import protein\nfrom alphafold.relax import utils\nimport numpy as np\n# Internal import (7716).\n\n\nclass UtilsTest(absltest.TestCase):\n\n  def test_overwrite_b_factors(self):\n    testdir = os.path.join(\n        absltest.get_default_test_srcdir(),\n        'alphafold/relax/testdata/'\n        'multiple_disulfides_target.pdb')\n    with open(testdir) as f:\n      test_pdb = f.read()\n    n_residues = 191\n    bfactors = np.stack([np.arange(0, n_residues)] * 37, axis=-1)\n\n    output_pdb = utils.overwrite_b_factors(test_pdb, bfactors)\n\n    # Check that the atom lines are unchanged apart from the B-factors.\n    atom_lines_original = [l for l in test_pdb.split('\\n') if l[:4] == ('ATOM')]\n    atom_lines_new = [l for l in output_pdb.split('\\n') if l[:4] == ('ATOM')]\n    for line_original, line_new in zip(atom_lines_original, atom_lines_new):\n      self.assertEqual(line_original[:60].strip(), line_new[:60].strip())\n      self.assertEqual(line_original[66:].strip(), line_new[66:].strip())\n\n    # Check B-factors are correctly set for all atoms present.\n    as_protein = protein.from_pdb_string(output_pdb)\n    np.testing.assert_almost_equal(\n        np.where(as_protein.atom_mask > 0, as_protein.b_factors, 0),\n        np.where(as_protein.atom_mask > 0, bfactors, 0))\n\n\nif __name__ == '__main__':\n  absltest.main()\n"
  },
  {
    "path": "docs/python_inputs.md",
    "content": "# AlphaFold Python Input\n\nAuthor: Bozitao Zhong\n\nAlphaFold: v2.1.2; ParaFold: v1.1\n\n\n\n`--fasta_paths`: required\n\n`--is_prokaryote_list`: default all false, optional for multimer, contain a boolean for each fasta file\n\n`--model_names`: default none, only in *ParaFold*\n\n`--data_dir`: required\n\n`--output_dir`: required\n\n`--jackhmmer_binary_path`: auto find by `which jackhmmer`\n\n`--hhblits_binary_path`: auto find by `which hhblits`\n\n`--hhsearch_binary_path`: auto find by `which hhsearch`\n\n`--hmmsearch_binary_path`: auto find by `which hmmsearch`\n\n`--hmmbuild_binary_path`: auto find by `which hmmbuild`\n\n`--kalign_binary_path`: auto find by `which kalign`\n\n`--uniref90_database_path`: required\n\n`--mgnify_database_path`: required\n\n`--bfd_database_path`: required when `--db_preset==full_dbs`\n\n`--small_bfd_database_path`: required when `--db_preset==reduced_dbs`\n\n`--uniclust30_database_path`: required when `--db_preset==full_dbs`\n\n`--uniprot_database_path`: required when `--model_preset==multimer`\n\n`--pdb70_database_path`: required when `--model_preset!=multimer`\n\n`--pdb_seqres_database_path`: required when `--model_preset==multimer`\n\n`--template_mmcif_dir`: required\n\n`--max_template_date`: required\n\n`--obsolete_pdbs_path`: required\n\n`--db_preset`: default `full_dbs`, have choice `full_dbs`, `reduced_dbs`\n\n`--model_preset`: default `full_dbs`, have choice `monomer`, `monomer_casp14`, `monomer_ptm`, `multimer`\n\n`--benchmark`: default false\n\n`--random_seed`: default none\n\n`--use_precomputed_msas`: default false\n\n`--run_relax`: default true\n\n`--use_gpu_relax`: required\n\n`--recycling`: default 3, only in *ParaFold*\n\n`--run_feature`: default false, only in *ParaFold*\n\n\n\n\n\n"
  },
  {
    "path": "docs/usage.md",
    "content": "# Usage\n\n## Run features\n\nRun on CPUs to get features:\n\n```bash\n./run_alphafold.sh \\\n-d data \\\n-o output \\\n-p monomer_ptm \\\n-i input/GA98.fasta \\\n-t 1800-01-01 \\\n-m model_1 \\\n-f\n\n```\n\n`-f` means only run the featurization step, result in a `feature.pkl` file, and skip the following steps.\n\n>  8 CPUs is enough, according to my test, more CPUs won't help with speed\n\nFeaturing step will output the `feature.pkl`  and MSA folder in your output folder: `./output/[FASTA_NAME]/`\n\nPS: Here we put input files in an `input` folder to organize files in a better way.\n\n\n\n## Run monomer prediction\n\nAfter the feature step, you can run `run_alphafold.sh` using GPU:\n\n```bash\n./run_alphafold.sh \\\n-d data \\\n-o output \\\n-m model_1,model_2,model_3,model_4,model_5 \\\n-p monomer_ptm \\\n-i input/GA98.fasta \\\n-t 1800-01-01 \n\n```\n\nIf you have successfully output `feature.pkl`, you can have a very fast featuring step\n\n\n\n## Run multimer prediction\n\n```bash\n./run_alphafold.sh \\\n-d data \\\n-o output \\\n-m model_1_multimer,model_2_multimer,model_3_multimer,model_4_multimer,model_5_multimer \\\n-p multimer \\\n-i input/GA98.fasta \\\n-t 1800-01-01 \n\n```\n\n## Draw figures\n\n[This function is under repair]\n\nYou can run `run_figure.py` to visualize your result: [This will be available soon]\n\n```bash\npython3 run_figure.py [SystemName]\n```\n\nThis python file will create a figure folder in your output folder.\n\nNotice: `run_figure.py` need a local conda environment with matplotlib, pymol and numpy.\n\n"
  },
  {
    "path": "environment/environment_gpu.yml",
    "content": "name: parafold_test\nchannels:\n  - conda-forge\n  - defaults\ndependencies:\n  - _libgcc_mutex=0.1=conda_forge\n  - _openmp_mutex=4.5=2_kmp_llvm\n  - absl-py=2.0.0=pyhd8ed1ab_0\n  - aiohttp=3.9.1=py310h2372a71_0\n  - aiosignal=1.3.1=pyhd8ed1ab_0\n  - aom=3.7.1=h59595ed_0\n  - asttokens=2.4.1=pyhd8ed1ab_0\n  - astunparse=1.6.3=pyhd8ed1ab_0\n  - async-timeout=4.0.3=pyhd8ed1ab_0\n  - attrs=23.2.0=pyh71513ae_0\n  - biopython=1.83=py310h2372a71_0\n  - blinker=1.7.0=pyhd8ed1ab_0\n  - blosc=1.21.5=h0f2a231_0\n  - brotli=1.1.0=hd590300_1\n  - brotli-bin=1.1.0=hd590300_1\n  - brotli-python=1.1.0=py310hc6cd4ac_1\n  - bzip2=1.0.8=h7b6447c_0\n  - c-ares=1.25.0=hd590300_0\n  - ca-certificates=2023.11.17=hbcca054_0\n  - cached-property=1.5.2=hd8ed1ab_1\n  - cached_property=1.5.2=pyha770c72_1\n  - cachetools=5.3.2=pyhd8ed1ab_0\n  - certifi=2023.11.17=pyhd8ed1ab_0\n  - cffi=1.16.0=py310h2fee648_0\n  - charset-normalizer=3.3.2=pyhd8ed1ab_0\n  - chex=0.1.85=pyhd8ed1ab_0\n  - click=8.1.7=unix_pyh707e725_0\n  - comm=0.2.1=pyhd8ed1ab_0\n  - contourpy=1.2.0=py310hd41b1e2_0\n  - cryptography=41.0.7=py310hb8475ec_1\n  - cycler=0.12.1=pyhd8ed1ab_0\n  - dataclasses=0.8=pyhc8e2a94_3\n  - dav1d=1.2.1=hd590300_0\n  - debugpy=1.8.0=py310hc6cd4ac_1\n  - decorator=5.1.1=pyhd8ed1ab_0\n  - dm-haiku=0.0.11=pyhd8ed1ab_1\n  - dm-tree=0.1.8=py310h620c231_2\n  - etils=1.6.0=pyhd8ed1ab_1\n  - exceptiongroup=1.2.0=pyhd8ed1ab_2\n  - executing=2.0.1=pyhd8ed1ab_0\n  - flatbuffers=23.5.26=h59595ed_1\n  - flax=0.7.5=pyhd8ed1ab_0\n  - fonttools=4.47.2=py310h2372a71_0\n  - freetype=2.12.1=h267a509_2\n  - frozenlist=1.4.1=py310h2372a71_0\n  - gast=0.5.4=pyhd8ed1ab_0\n  - giflib=5.2.1=h0b41bf4_3\n  - google-auth=2.26.2=pyhca7485f_0\n  - google-auth-oauthlib=1.2.0=pyhd8ed1ab_0\n  - google-pasta=0.2.0=pyh8c360ce_0\n  - grpcio=1.59.3=py310h1b8f574_0\n  - h5py=3.10.0=nompi_py310h65828d5_101\n  - hdf5=1.14.3=nompi_h4f84152_100\n  - icu=73.2=h59595ed_0\n  - idna=3.6=pyhd8ed1ab_0\n  - importlib-metadata=7.0.1=pyha770c72_0\n  - importlib_metadata=7.0.1=hd8ed1ab_0\n  - importlib_resources=6.1.1=pyhd8ed1ab_0\n  - ipykernel=6.28.0=pyhd33586a_0\n  - ipython=8.20.0=pyh707e725_0\n  - jedi=0.19.1=pyhd8ed1ab_0\n  - jmp=0.0.4=pyhd8ed1ab_0\n  - jupyter_client=8.6.0=pyhd8ed1ab_0\n  - jupyter_core=5.7.1=py310hff52083_0\n  - keras=2.15.0=pyhd8ed1ab_0\n  - keyutils=1.6.1=h166bdaf_0\n  - kiwisolver=1.4.5=py310hd41b1e2_1\n  - krb5=1.21.2=h659d440_0\n  - lcms2=2.16=hb7c19ff_0\n  - ld_impl_linux-64=2.38=h1181459_1\n  - lerc=4.0.0=h27087fc_0\n  - libabseil=20230802.1=cxx17_h59595ed_0\n  - libaec=1.1.2=h59595ed_1\n  - libavif16=1.0.3=hef5bec9_1\n  - libblas=3.9.0=20_linux64_openblas\n  - libbrotlicommon=1.1.0=hd590300_1\n  - libbrotlidec=1.1.0=hd590300_1\n  - libbrotlienc=1.1.0=hd590300_1\n  - libcblas=3.9.0=20_linux64_openblas\n  - libcurl=8.5.0=hca28451_0\n  - libdeflate=1.19=hd590300_0\n  - libedit=3.1.20191231=he28a2e2_2\n  - libev=4.33=hd590300_2\n  - libffi=3.4.4=h6a678d5_0\n  - libgcc-ng=13.2.0=h807b86a_3\n  - libgfortran-ng=13.2.0=h69a702a_3\n  - libgfortran5=13.2.0=ha4646dd_3\n  - libgrpc=1.59.3=hd6c4280_0\n  - libjpeg-turbo=3.0.0=hd590300_1\n  - liblapack=3.9.0=20_linux64_openblas\n  - libnghttp2=1.58.0=h47da74e_1\n  - libopenblas=0.3.25=pthreads_h413a1c8_0\n  - libpng=1.6.39=h753d276_0\n  - libprotobuf=4.24.4=hf27288f_0\n  - libre2-11=2023.06.02=h7a70373_0\n  - libsodium=1.0.18=h36c2ea0_1\n  - libsqlite=3.44.2=h2797004_0\n  - libssh2=1.11.0=h0841786_0\n  - libstdcxx-ng=13.2.0=h7e041cc_3\n  - libtiff=4.6.0=ha9c0a0a_2\n  - libuuid=1.41.5=h5eee18b_0\n  - libwebp-base=1.3.2=hd590300_0\n  - libxcb=1.15=h0b41bf4_0\n  - libzlib=1.2.13=hd590300_5\n  - llvm-openmp=17.0.6=h4dfa4b3_0\n  - lz4-c=1.9.4=hcb278e6_0\n  - markdown=3.5.2=pyhd8ed1ab_0\n  - markdown-it-py=3.0.0=pyhd8ed1ab_0\n  - markupsafe=2.1.3=py310h2372a71_1\n  - matplotlib-base=3.8.2=py310h62c0568_0\n  - matplotlib-inline=0.1.6=pyhd8ed1ab_0\n  - mdurl=0.1.2=pyhd8ed1ab_0\n  - ml_dtypes=0.2.0=py310hcc13569_2\n  - msgpack-python=1.0.7=py310hd41b1e2_0\n  - multidict=6.0.4=py310h2372a71_1\n  - munkres=1.1.4=pyh9f0ad1d_0\n  - ncurses=6.4=h6a678d5_0\n  - nest-asyncio=1.5.8=pyhd8ed1ab_0\n  - numpy=1.26.3=py310hb13e2d6_0\n  - oauthlib=3.2.2=pyhd8ed1ab_0\n  - openjpeg=2.5.0=h488ebb8_3\n  - openssl=3.2.0=hd590300_1\n  - opt_einsum=3.3.0=pyhc1e730c_2\n  - optax=0.1.7=pyhd8ed1ab_0\n  - orbax-checkpoint=0.4.4=pyhd8ed1ab_0\n  - packaging=23.2=pyhd8ed1ab_0\n  - parso=0.8.3=pyhd8ed1ab_0\n  - pexpect=4.8.0=pyh1a96a4e_2\n  - pickleshare=0.7.5=py_1003\n  - pillow=10.2.0=py310h01dd4db_0\n  - pip=23.3.1=py310h06a4308_0\n  - platformdirs=4.1.0=pyhd8ed1ab_0\n  - prompt-toolkit=3.0.42=pyha770c72_0\n  - protobuf=4.24.4=py310h620c231_0\n  - psutil=5.9.7=py310h2372a71_0\n  - pthread-stubs=0.4=h36c2ea0_1001\n  - ptyprocess=0.7.0=pyhd3deb0d_0\n  - pure_eval=0.2.2=pyhd8ed1ab_0\n  - pyasn1=0.5.1=pyhd8ed1ab_0\n  - pyasn1-modules=0.3.0=pyhd8ed1ab_0\n  - pybind11-abi=4=hd8ed1ab_3\n  - pycparser=2.21=pyhd8ed1ab_0\n  - pygments=2.17.2=pyhd8ed1ab_0\n  - pyjwt=2.8.0=pyhd8ed1ab_0\n  - pyopenssl=23.3.0=pyhd8ed1ab_0\n  - pyparsing=3.1.1=pyhd8ed1ab_0\n  - pysocks=1.7.1=pyha2e5f31_6\n  - python=3.10.13=h955ad1f_0\n  - python-dateutil=2.8.2=pyhd8ed1ab_0\n  - python-flatbuffers=23.5.26=pyhd8ed1ab_0\n  - python_abi=3.10=2_cp310\n  - pyu2f=0.1.5=pyhd8ed1ab_0\n  - pyyaml=6.0.1=py310h2372a71_1\n  - pyzmq=25.1.2=py310h795f18f_0\n  - rav1e=0.6.6=he8a937b_2\n  - re2=2023.06.02=h2873b5e_0\n  - readline=8.2=h5eee18b_0\n  - requests=2.31.0=pyhd8ed1ab_0\n  - requests-oauthlib=1.3.1=pyhd8ed1ab_0\n  - rich=13.7.0=pyhd8ed1ab_0\n  - rsa=4.9=pyhd8ed1ab_0\n  - scipy=1.11.4=py310hb13e2d6_0\n  - setuptools=68.2.2=py310h06a4308_0\n  - six=1.16.0=pyh6c4a22f_0\n  - snappy=1.1.10=h9fff704_0\n  - sqlite=3.41.2=h5eee18b_0\n  - stack_data=0.6.2=pyhd8ed1ab_0\n  - svt-av1=1.8.0=h59595ed_0\n  - tabulate=0.9.0=pyhd8ed1ab_1\n  - tensorboard=2.15.1=pyhd8ed1ab_0\n  - tensorboard-data-server=0.7.0=py310h75e40e8_1\n  - tensorflow=2.15.0=cpu_py310h7825f03_1\n  - tensorflow-base=2.15.0=cpu_py310h7e4d085_1\n  - tensorflow-cpu=2.15.0=cpu_py310h718b53a_1\n  - tensorflow-estimator=2.15.0=cpu_py310haacee6a_1\n  - tensorstore=0.1.51=py310ha94ca7a_0\n  - termcolor=2.4.0=pyhd8ed1ab_0\n  - tk=8.6.13=noxft_h4845f30_101\n  - toolz=0.12.0=pyhd8ed1ab_0\n  - tornado=6.3.3=py310h2372a71_1\n  - traitlets=5.14.1=pyhd8ed1ab_0\n  - typing-extensions=4.9.0=hd8ed1ab_0\n  - typing_extensions=4.9.0=pyha770c72_0\n  - tzdata=2023d=h04d1e81_0\n  - unicodedata2=15.1.0=py310h2372a71_0\n  - urllib3=2.1.0=pyhd8ed1ab_0\n  - wcwidth=0.2.13=pyhd8ed1ab_0\n  - werkzeug=3.0.1=pyhd8ed1ab_0\n  - wheel=0.41.2=py310h06a4308_0\n  - wrapt=1.14.1=py310h5764c6d_1\n  - xorg-libxau=1.0.11=hd590300_0\n  - xorg-libxdmcp=1.1.3=h7f98852_0\n  - xz=5.4.5=h5eee18b_0\n  - yaml=0.2.5=h7f98852_2\n  - yarl=1.9.3=py310h2372a71_0\n  - zeromq=4.3.5=h59595ed_0\n  - zipp=3.17.0=pyhd8ed1ab_0\n  - zlib=1.2.13=hd590300_5\n  - zstd=1.5.5=hfc55251_0\n  - pip:\n    - contextlib2==21.6.0\n    - jax==0.4.23\n    - jaxlib==0.4.23\n    - ml-collections==0.1.1\n    - nvidia-cublas-cu11==11.11.3.6\n    - nvidia-cuda-cupti-cu11==11.8.87\n    - nvidia-cuda-nvcc-cu11==11.8.89\n    - nvidia-cuda-nvrtc-cu11==11.8.89\n    - nvidia-cuda-runtime-cu11==11.8.89\n    - nvidia-cudnn-cu11==8.9.6.50\n    - nvidia-cufft-cu11==10.9.0.58\n    - nvidia-cusolver-cu11==11.4.1.48\n    - nvidia-cusparse-cu11==11.7.5.86\n    - nvidia-nccl-cu11==2.19.3\n\n"
  },
  {
    "path": "input/mono_set1/GA98.fasta",
    "content": ">2LHC_1|Chain A|Ga98|artificial gene (32630)\nTTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE\n"
  },
  {
    "path": "input/mono_set1/GB98.fasta",
    "content": ">2LHD_1|Chain A|GB98|artificial gene (32630)\nTTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE\n"
  },
  {
    "path": "requirements.txt",
    "content": "absl-py==1.0.0\nbiopython==1.79\nchex==0.0.7\ndm-haiku==0.0.9\ndm-tree==0.1.6\nimmutabledict==2.0.0\njax==0.3.25\nml-collections==0.1.0\nnumpy==1.21.6\npandas==1.3.4\nscipy==1.7.0\ntensorflow-cpu==2.11.0\n"
  },
  {
    "path": "run_alphafold.py",
    "content": "# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n\n\"\"\"Full AlphaFold protein structure prediction script.\"\"\"\nimport enum\nimport json\nimport os\nimport pathlib\nimport pickle\nimport random\nimport shutil\nimport sys\nimport time\nfrom typing import Any, Dict, Mapping, Union\n\nfrom absl import app\nfrom absl import flags\nfrom absl import logging\nfrom alphafold.common import protein\nfrom alphafold.common import residue_constants\nfrom alphafold.data import pipeline\nfrom alphafold.data import pipeline_multimer\nfrom alphafold.data import templates\nfrom alphafold.data.tools import hhsearch\nfrom alphafold.data.tools import hmmsearch\nfrom alphafold.model import config\nfrom alphafold.model import data\nfrom alphafold.model import model\nfrom alphafold.relax import relax\nimport jax.numpy as jnp\nimport numpy as np\n\n# Internal import (7716).\n\nlogging.set_verbosity(logging.INFO)\n\n\n@enum.unique\nclass ModelsToRelax(enum.Enum):\n  ALL = 0\n  BEST = 1\n  NONE = 2\n\nflags.DEFINE_list(\n    'fasta_paths', None, 'Paths to FASTA files, each containing a prediction '\n    'target that will be folded one after another. If a FASTA file contains '\n    'multiple sequences, then it will be folded as a multimer. Paths should be '\n    'separated by commas. All FASTA paths must have a unique basename as the '\n    'basename is used to name the output directories for each prediction.')\nflags.DEFINE_list('model_names', None, 'Names of models to use.')\nflags.DEFINE_string('parameter_path', None, 'Path to directory of supporting data.')\nflags.DEFINE_string('output_dir', None, 'Path to a directory that will '\n                    'store the results.')\nflags.DEFINE_string('jackhmmer_binary_path', shutil.which('jackhmmer'),\n                    'Path to the JackHMMER executable.')\nflags.DEFINE_string('hhblits_binary_path', shutil.which('hhblits'),\n                    'Path to the HHblits executable.')\nflags.DEFINE_string('hhsearch_binary_path', shutil.which('hhsearch'),\n                    'Path to the HHsearch executable.')\nflags.DEFINE_string('hmmsearch_binary_path', shutil.which('hmmsearch'),\n                    'Path to the hmmsearch executable.')\nflags.DEFINE_string('hmmbuild_binary_path', shutil.which('hmmbuild'),\n                    'Path to the hmmbuild executable.')\nflags.DEFINE_string('kalign_binary_path', shutil.which('kalign'),\n                    'Path to the Kalign executable.')\nflags.DEFINE_string('uniref90_database_path', None, 'Path to the Uniref90 '\n                    'database for use by JackHMMER.')\nflags.DEFINE_string('mgnify_database_path', None, 'Path to the MGnify '\n                    'database for use by JackHMMER.')\nflags.DEFINE_string('bfd_database_path', None, 'Path to the BFD '\n                    'database for use by HHblits.')\nflags.DEFINE_string('small_bfd_database_path', None, 'Path to the small '\n                    'version of BFD used with the \"reduced_dbs\" preset.')\nflags.DEFINE_string('uniref30_database_path', None, 'Path to the UniRef30 '\n                    'database for use by HHblits.')\nflags.DEFINE_string('uniprot_database_path', None, 'Path to the Uniprot '\n                    'database for use by JackHMMer.')\nflags.DEFINE_string('pdb70_database_path', None, 'Path to the PDB70 '\n                    'database for use by HHsearch.')\nflags.DEFINE_string('pdb_seqres_database_path', None, 'Path to the PDB '\n                    'seqres database for use by hmmsearch.')\nflags.DEFINE_string('template_mmcif_dir', None, 'Path to a directory with '\n                    'template mmCIF structures, each named <pdb_id>.cif')\nflags.DEFINE_string('max_template_date', None, 'Maximum template release date '\n                    'to consider. Important if folding historical test sets.')\nflags.DEFINE_string('obsolete_pdbs_path', None, 'Path to file containing a '\n                    'mapping from obsolete PDB IDs to the PDB IDs of their '\n                    'replacements.')\nflags.DEFINE_enum('db_preset', 'full_dbs',\n                  ['full_dbs', 'reduced_dbs'],\n                  'Choose preset MSA database configuration - '\n                  'smaller genetic database config (reduced_dbs) or '\n                  'full genetic database config  (full_dbs)')\nflags.DEFINE_enum('model_preset', 'monomer',\n                  ['monomer', 'monomer_casp14', 'monomer_ptm', 'multimer'],\n                  'Choose preset model configuration - the monomer model, '\n                  'the monomer model with extra ensembling, monomer model with '\n                  'pTM head, or multimer model')\nflags.DEFINE_boolean('benchmark', False, 'Run multiple JAX model evaluations '\n                     'to obtain a timing that excludes the compilation time, '\n                     'which should be more indicative of the time required for '\n                     'inferencing many proteins.')\nflags.DEFINE_integer('random_seed', None, 'The random seed for the data '\n                     'pipeline. By default, this is randomly generated. Note '\n                     'that even if this is set, Alphafold may still not be '\n                     'deterministic, because processes like GPU inference are '\n                     'nondeterministic.')\nflags.DEFINE_integer('num_multimer_predictions_per_model', 5, 'How many '\n                     'predictions (each with a different random seed) will be '\n                     'generated per model. E.g. if this is 2 and there are 5 '\n                     'models then there will be 10 predictions per input. '\n                     'Note: this FLAG only applies if model_preset=multimer')\nflags.DEFINE_boolean('use_precomputed_msas', False, 'Whether to read MSAs that '\n                     'have been written to disk instead of running the MSA '\n                     'tools. The MSA files are looked up in the output '\n                     'directory, so it must stay the same between multiple '\n                     'runs that are to reuse the MSAs. WARNING: This will not '\n                     'check if the sequence, database or configuration have '\n                     'changed.')\nflags.DEFINE_enum_class('models_to_relax', ModelsToRelax.BEST, ModelsToRelax,\n                        'The models to run the final relaxation step on. '\n                        'If `all`, all models are relaxed, which may be time '\n                        'consuming. If `best`, only the most confident model '\n                        'is relaxed. If `none`, relaxation is not run. Turning '\n                        'off relaxation might result in predictions with '\n                        'distracting stereochemical violations but might help '\n                        'in case you are having issues with the relaxation '\n                        'stage.')\nflags.DEFINE_boolean('use_gpu_relax', None, 'Whether to relax on GPU. '\n                     'Relax on GPU can be much faster than CPU, so it is '\n                     'recommended to enable if possible. GPUs must be available'\n                     ' if this setting is enabled.')\nflags.DEFINE_integer('recycling', 3, 'Set number of recyclings')\nflags.DEFINE_boolean('run_feature', False, 'Calculate MSA and template to generate '\n                     'feature')\n\nFLAGS = flags.FLAGS\n\nMAX_TEMPLATE_HITS = 20\nRELAX_MAX_ITERATIONS = 0\nRELAX_ENERGY_TOLERANCE = 2.39\nRELAX_STIFFNESS = 10.0\nRELAX_EXCLUDE_RESIDUES = []\nRELAX_MAX_OUTER_ITERATIONS = 3\n\n\ndef _check_flag(flag_name: str,\n                other_flag_name: str,\n                should_be_set: bool):\n  if should_be_set != bool(FLAGS[flag_name].value):\n    verb = 'be' if should_be_set else 'not be'\n    raise ValueError(f'{flag_name} must {verb} set when running with '\n                     f'\"--{other_flag_name}={FLAGS[other_flag_name].value}\".')\n\n\ndef _jnp_to_np(output: Dict[str, Any]) -> Dict[str, Any]:\n  \"\"\"Recursively changes jax arrays to numpy arrays.\"\"\"\n  for k, v in output.items():\n    if isinstance(v, dict):\n      output[k] = _jnp_to_np(v)\n    elif isinstance(v, jnp.ndarray):\n      output[k] = np.array(v)\n  return output\n\n\ndef predict_structure(\n    fasta_path: str,\n    fasta_name: str,\n    output_dir_base: str,\n    data_pipeline: Union[pipeline.DataPipeline, pipeline_multimer.DataPipeline],\n    model_runners: Dict[str, model.RunModel],\n    amber_relaxer: relax.AmberRelaxation,\n    benchmark: bool,\n    random_seed: int,\n    models_to_relax: ModelsToRelax,\n    run_feature: bool):\n  \"\"\"Predicts structure using AlphaFold for the given sequence.\"\"\"\n  logging.info('Predicting %s', fasta_name)\n  timings = {}\n  output_dir = os.path.join(output_dir_base, fasta_name)\n  if not os.path.exists(output_dir):\n    os.makedirs(output_dir)\n  msa_output_dir = os.path.join(output_dir, 'msas')\n  if not os.path.exists(msa_output_dir):\n    os.makedirs(msa_output_dir)\n\n  # Get features.\n  t_0 = time.time()\n  features_output_path = os.path.join(output_dir, 'features.pkl')\n  \n  # If we already have feature.pkl file, skip the MSA and template finding step\n  if os.path.exists(features_output_path):\n    feature_dict = pickle.load(open(features_output_path, 'rb'))\n  \n  else:\n    feature_dict = data_pipeline.process(\n        input_fasta_path=fasta_path,\n        msa_output_dir=msa_output_dir)\n\n  # Write out features as a pickled dictionary.\n  features_output_path = os.path.join(output_dir, 'features.pkl')\n  with open(features_output_path, 'wb') as f:\n    pickle.dump(feature_dict, f, protocol=4)\n\n  timings['features'] = time.time() - t_0\n\n  if run_feature:    # if not run_feature, skip the rest of the function\n    return 0\n\n  unrelaxed_pdbs = {}\n  unrelaxed_proteins = {}\n  relaxed_pdbs = {}\n  relax_metrics = {}\n  ranking_confidences = {}\n\n  # Run the models.\n  num_models = len(model_runners)\n  for model_index, (model_name, model_runner) in enumerate(\n      model_runners.items()):\n    logging.info('Running model %s on %s', model_name, fasta_name)\n    t_0 = time.time()\n    model_random_seed = model_index + random_seed * num_models\n    processed_feature_dict = model_runner.process_features(\n        feature_dict, random_seed=model_random_seed)\n    timings[f'process_features_{model_name}'] = time.time() - t_0\n\n    t_0 = time.time()\n    prediction_result = model_runner.predict(processed_feature_dict,\n                                             random_seed=model_random_seed)\n    t_diff = time.time() - t_0\n    timings[f'predict_and_compile_{model_name}'] = t_diff\n    logging.info(\n        'Total JAX model %s on %s predict time (includes compilation time, see --benchmark): %.1fs',\n        model_name, fasta_name, t_diff)\n\n    if benchmark:\n      t_0 = time.time()\n      model_runner.predict(processed_feature_dict,\n                           random_seed=model_random_seed)\n      t_diff = time.time() - t_0\n      timings[f'predict_benchmark_{model_name}'] = t_diff\n      logging.info(\n          'Total JAX model %s on %s predict time (excludes compilation time): %.1fs',\n          model_name, fasta_name, t_diff)\n\n    plddt = prediction_result['plddt']\n    ranking_confidences[model_name] = prediction_result['ranking_confidence']\n\n    # Remove jax dependency from results.\n    np_prediction_result = _jnp_to_np(dict(prediction_result))\n\n    # Save the model outputs.\n    result_output_path = os.path.join(output_dir, f'result_{model_name}.pkl')\n    with open(result_output_path, 'wb') as f:\n      pickle.dump(np_prediction_result, f, protocol=4)\n\n    # Add the predicted LDDT in the b-factor column.\n    # Note that higher predicted LDDT value means higher model confidence.\n    plddt_b_factors = np.repeat(\n        plddt[:, None], residue_constants.atom_type_num, axis=-1)\n    unrelaxed_protein = protein.from_prediction(\n        features=processed_feature_dict,\n        result=prediction_result,\n        b_factors=plddt_b_factors,\n        remove_leading_feature_dimension=not model_runner.multimer_mode)\n\n    unrelaxed_proteins[model_name] = unrelaxed_protein\n    unrelaxed_pdbs[model_name] = protein.to_pdb(unrelaxed_protein)\n    unrelaxed_pdb_path = os.path.join(output_dir, f'unrelaxed_{model_name}.pdb')\n    with open(unrelaxed_pdb_path, 'w') as f:\n      f.write(unrelaxed_pdbs[model_name])\n\n  # Rank by model confidence.\n  ranked_order = [\n      model_name for model_name, confidence in\n      sorted(ranking_confidences.items(), key=lambda x: x[1], reverse=True)]\n\n  # Relax predictions.\n  if models_to_relax == ModelsToRelax.BEST:\n    to_relax = [ranked_order[0]]\n  elif models_to_relax == ModelsToRelax.ALL:\n    to_relax = ranked_order\n  elif models_to_relax == ModelsToRelax.NONE:\n    to_relax = []\n\n  for model_name in to_relax:\n    t_0 = time.time()\n    relaxed_pdb_str, _, violations = amber_relaxer.process(\n        prot=unrelaxed_proteins[model_name])\n    relax_metrics[model_name] = {\n        'remaining_violations': violations,\n        'remaining_violations_count': sum(violations)\n    }\n    timings[f'relax_{model_name}'] = time.time() - t_0\n\n    relaxed_pdbs[model_name] = relaxed_pdb_str\n\n    # Save the relaxed PDB.\n    relaxed_output_path = os.path.join(\n        output_dir, f'relaxed_{model_name}.pdb')\n    with open(relaxed_output_path, 'w') as f:\n      f.write(relaxed_pdb_str)\n\n  # Write out relaxed PDBs in rank order.\n  for idx, model_name in enumerate(ranked_order):\n    ranked_output_path = os.path.join(output_dir, f'ranked_{idx}.pdb')\n    with open(ranked_output_path, 'w') as f:\n      if model_name in relaxed_pdbs:\n        f.write(relaxed_pdbs[model_name])\n      else:\n        f.write(unrelaxed_pdbs[model_name])\n\n  ranking_output_path = os.path.join(output_dir, 'ranking_debug.json')\n  with open(ranking_output_path, 'w') as f:\n    label = 'iptm+ptm' if 'iptm' in prediction_result else 'plddts'\n    f.write(json.dumps(\n        {label: ranking_confidences, 'order': ranked_order}, indent=4))\n\n  logging.info('Final timings for %s: %s', fasta_name, timings)\n\n  timings_output_path = os.path.join(output_dir, 'timings.json')\n  with open(timings_output_path, 'w') as f:\n    f.write(json.dumps(timings, indent=4))\n  if models_to_relax != ModelsToRelax.NONE:\n    relax_metrics_path = os.path.join(output_dir, 'relax_metrics.json')\n    with open(relax_metrics_path, 'w') as f:\n      f.write(json.dumps(relax_metrics, indent=4))\n\n\ndef main(argv):\n  if len(argv) > 1:\n    raise app.UsageError('Too many command-line arguments.')\n\n  for tool_name in (\n      'jackhmmer', 'hhblits', 'hhsearch', 'hmmsearch', 'hmmbuild', 'kalign'):\n    if not FLAGS[f'{tool_name}_binary_path'].value:\n      raise ValueError(f'Could not find path to the \"{tool_name}\" binary. Make '\n                       'sure it is installed on your system.')\n\n  use_small_bfd = FLAGS.db_preset == 'reduced_dbs'\n  _check_flag('small_bfd_database_path', 'db_preset',\n              should_be_set=use_small_bfd)\n  _check_flag('bfd_database_path', 'db_preset',\n              should_be_set=not use_small_bfd)\n  _check_flag('uniref30_database_path', 'db_preset',\n              should_be_set=not use_small_bfd)\n\n  run_multimer_system = 'multimer' in FLAGS.model_preset\n  _check_flag('pdb70_database_path', 'model_preset',\n              should_be_set=not run_multimer_system)\n  _check_flag('pdb_seqres_database_path', 'model_preset',\n              should_be_set=run_multimer_system)\n  _check_flag('uniprot_database_path', 'model_preset',\n              should_be_set=run_multimer_system)\n\n  if FLAGS.model_preset == 'monomer_casp14':\n    num_ensemble = 8\n  else:\n    num_ensemble = 1\n\n  # Check for duplicate FASTA file names.\n  fasta_names = [pathlib.Path(p).stem for p in FLAGS.fasta_paths]\n  if len(fasta_names) != len(set(fasta_names)):\n    raise ValueError('All FASTA paths must have a unique basename.')\n\n  if run_multimer_system:\n    template_searcher = hmmsearch.Hmmsearch(\n        binary_path=FLAGS.hmmsearch_binary_path,\n        hmmbuild_binary_path=FLAGS.hmmbuild_binary_path,\n        database_path=FLAGS.pdb_seqres_database_path)\n    template_featurizer = templates.HmmsearchHitFeaturizer(\n        mmcif_dir=FLAGS.template_mmcif_dir,\n        max_template_date=FLAGS.max_template_date,\n        max_hits=MAX_TEMPLATE_HITS,\n        kalign_binary_path=FLAGS.kalign_binary_path,\n        release_dates_path=None,\n        obsolete_pdbs_path=FLAGS.obsolete_pdbs_path)\n  else:\n    template_searcher = hhsearch.HHSearch(\n        binary_path=FLAGS.hhsearch_binary_path,\n        databases=[FLAGS.pdb70_database_path])\n    template_featurizer = templates.HhsearchHitFeaturizer(\n        mmcif_dir=FLAGS.template_mmcif_dir,\n        max_template_date=FLAGS.max_template_date,\n        max_hits=MAX_TEMPLATE_HITS,\n        kalign_binary_path=FLAGS.kalign_binary_path,\n        release_dates_path=None,\n        obsolete_pdbs_path=FLAGS.obsolete_pdbs_path)\n\n  monomer_data_pipeline = pipeline.DataPipeline(\n      jackhmmer_binary_path=FLAGS.jackhmmer_binary_path,\n      hhblits_binary_path=FLAGS.hhblits_binary_path,\n      uniref90_database_path=FLAGS.uniref90_database_path,\n      mgnify_database_path=FLAGS.mgnify_database_path,\n      bfd_database_path=FLAGS.bfd_database_path,\n      uniref30_database_path=FLAGS.uniref30_database_path,\n      small_bfd_database_path=FLAGS.small_bfd_database_path,\n      template_searcher=template_searcher,\n      template_featurizer=template_featurizer,\n      use_small_bfd=use_small_bfd,\n      use_precomputed_msas=FLAGS.use_precomputed_msas)\n\n  if run_multimer_system:\n    num_predictions_per_model = FLAGS.num_multimer_predictions_per_model\n    data_pipeline = pipeline_multimer.DataPipeline(\n        monomer_data_pipeline=monomer_data_pipeline,\n        jackhmmer_binary_path=FLAGS.jackhmmer_binary_path,\n        uniprot_database_path=FLAGS.uniprot_database_path,\n        use_precomputed_msas=FLAGS.use_precomputed_msas)\n  else:\n    num_predictions_per_model = 1\n    data_pipeline = monomer_data_pipeline\n\n  model_runners = {}\n  if FLAGS.model_names:\n    model_names = FLAGS.model_names\n  else:\n    model_names = config.MODEL_PRESETS[FLAGS.model_preset]\n  for model_name in model_names:\n    model_config = config.model_config(model_name)\n    if run_multimer_system:\n      model_config.model.num_ensemble_eval = num_ensemble\n      model_config.model.num_recycle = FLAGS.recycling\n    else:\n      model_config.data.eval.num_ensemble = num_ensemble\n      model_config.model.num_recycle = FLAGS.recycling\n      model_config.data.common.num_recycle = FLAGS.recycling\n    model_params = data.get_model_haiku_params(\n        model_name=model_name, parameter_path=FLAGS.parameter_path)\n    model_runner = model.RunModel(model_config, model_params)\n    for i in range(num_predictions_per_model):\n      model_runners[f'{model_name}_pred_{i}'] = model_runner\n\n  logging.info('Have %d models: %s', len(model_runners),\n               list(model_runners.keys()))\n\n  amber_relaxer = relax.AmberRelaxation(\n      max_iterations=RELAX_MAX_ITERATIONS,\n      tolerance=RELAX_ENERGY_TOLERANCE,\n      stiffness=RELAX_STIFFNESS,\n      exclude_residues=RELAX_EXCLUDE_RESIDUES,\n      max_outer_iterations=RELAX_MAX_OUTER_ITERATIONS,\n      use_gpu=FLAGS.use_gpu_relax)\n\n  random_seed = FLAGS.random_seed\n  if random_seed is None:\n    random_seed = random.randrange(sys.maxsize // len(model_runners))\n  logging.info('Using random seed %d for the data pipeline', random_seed)\n\n  # Predict structure for each of the sequences.\n  for i, fasta_path in enumerate(FLAGS.fasta_paths):\n    fasta_name = fasta_names[i]\n    predict_structure(\n        fasta_path=fasta_path,\n        fasta_name=fasta_name,\n        output_dir_base=FLAGS.output_dir,\n        data_pipeline=data_pipeline,\n        model_runners=model_runners,\n        amber_relaxer=amber_relaxer,\n        benchmark=FLAGS.benchmark,\n        random_seed=random_seed,\n        models_to_relax=FLAGS.models_to_relax,\n        run_feature = FLAGS.run_feature)\n    logging.info('%s AlphaFold structure prediction COMPLETE', fasta_name)\n\n\nif __name__ == '__main__':\n  flags.mark_flags_as_required([\n      'fasta_paths',\n      'output_dir',\n      'parameter_path',\n      'uniref90_database_path',\n      'mgnify_database_path',\n      'template_mmcif_dir',\n      'max_template_date',\n      'obsolete_pdbs_path',\n      'use_gpu_relax',\n  ])\n\n  app.run(main)\n"
  },
  {
    "path": "run_alphafold.sh",
    "content": "#!/bin/bash\n# Description: AlphaFold non-docker version\n# Author: Sanjay Kumar Srikakulam\n# Modified by Bozitao Zhong\n\nusage() {\n        echo \"\"\n        echo \"Usage: $0 <OPTIONS>\"\n        echo \"Required Parameters:\"\n        echo \"-d <data_dir>           Path to directory of supporting data\"\n        echo \"-o <output_dir>         Path to a directory that will store the results.\"\n        echo \"-p <model_preset>       Model preset. Use monomer, monomer_ptm, monomer_casp14 or multimer models\"\n        echo \"-i <fasta_path>         Path to a FASTA file containing query sequence(s)\"\n\n        echo \"Optional Parameters:\"\n        echo \"-t <max_template_date>  Maximum template release date to consider (YYYY-MM-DD format). (default: 2020-12-01)\"\n        echo \"-b <benchmark>          Run multiple JAX model evaluations to obtain a timing that excludes the compilation time (default: 'False')\"\n        echo \"-g <use_gpu>            Enable NVIDIA runtime to run with GPUs (default: 'True')\"\n        echo \"-u <gpu_devices>        Comma separated list of devices to pass to 'CUDA_VISIBLE_DEVICES' (default: '0')\"\n        echo \"-c <db_preset>          Choose database reduced_dbs or full_dbs (default: 'full_dbs')\"\n        echo \"-r <models_to_relax>    'all': all models are relaxed, 'best': only the most confident model, 'none': no models are relaxed (default: 'all')\"\n        echo \"-m <model_selection>    Names of comma separated model names to use in prediction (default: All 5 models)\"\n        echo \"-R <recycling>          Set cycles for recycling (default: '3')\"\n        echo \"-f <run_feature>        Only run MSA and template search to generate feature file\"\n        echo \"-G <use_gpu_relax>      Disable GPU relax\"\n        \n        echo \"Future Parameters (You cannot use them now):\"\n        echo \"-s <skip_msa>           Skip MSA and template step, generate single sequence feature for ultimately fast prediction\"\n        echo \"-q <quick_mode>         Quick mode. Use small BFD database, no templates\"\n        echo \"-e <random_seed>        Set random seed\"\n        echo \"-P <precomputed_msas>   Use precomputed MSAs\"\n        echo \"\"\n        exit 1\n}\n\nwhile getopts \":d:o:p:i:t:u:c:m:R:r:bgvsqfG\" i; do\n        case \"${i}\" in\n        d)\n                data_dir=$OPTARG\n        ;;\n        o)\n                output_dir=$OPTARG\n        ;;\n        p)\n                model_preset=$OPTARG\n        ;;\n        i)\n                fasta_path=$OPTARG\n        ;;\n        t)\n                max_template_date=$OPTARG\n        ;;\n        b)\n                benchmark=true\n        ;;\n        g)\n                use_gpu=true\n        ;;\n        u)\n                gpu_devices=$OPTARG\n        ;;\n        c)\n                db_preset=$OPTARG\n        ;;\n        r)\n                models_to_relax=$OPTARG\n        ;;\n        m)\n                model_selection=$OPTARG\n        ;;\n        v)\n                visualizaion=true\n        ;;\n        s)\n                skip_msa=true\n        ;;\n        q)\n                quick_mode=true\n        ;;\n        R)\n                recycling=$OPTARG\n        ;;\n        f)\n                run_feature=true\n        ;;\n        G)\n                use_gpu_relax=false\n        ;;\n        esac\ndone\n\n# Parse input and set defaults\nif [[ \"$data_dir\" == \"\" || \"$output_dir\" == \"\" || \"$model_preset\" == \"\" || \"$fasta_path\" == \"\" ]] ; then\n    usage\nfi\n\nif [[ \"$max_template_date\" == \"\" ]] ; then\n    max_template_date=\"2020-12-01\"\nfi\n\nif [[ \"$benchmark\" == \"\" ]] ; then\n    benchmark=false\nfi\n\nif [[ \"$use_gpu\" == \"\" ]] ; then\n    use_gpu=true\nfi\n\nif [[ \"$gpu_devices\" == \"\" ]] ; then\n    gpu_devices=\"0\"\nfi\n\nif [[ \"$db_preset\" == \"\" ]] ; then\n    db_preset=\"full_dbs\"\nfi\n\nif [[ \"$models_to_relax\" == \"\" ]] ; then\n    models_to_relax=\"all\"\nfi\n\nif [[ \"$model_selection\" == \"\" ]] ; then\n    model_selection=\"\"\nfi\n\nif [[ \"$visualizaion\" == \"\" ]] ; then\n    visualizaion=false\nfi\n\nif [[ \"$skip_msa\" == \"\" ]] ; then\n    skip_msa=false\nfi\n\nif [[ \"$quick_mode\" == \"\" ]] ; then\n    quick_mode=false\nfi\n\nif [[ \"$recycling\" == \"\" ]] ; then\n    recycling=3\nfi\n\nif [[ \"$run_feature\" == \"\" ]] ; then\n    run_feature=false\nfi\n\nif [[ \"$use_gpu_relax\" == \"\" ]] ; then\n    use_gpu_relax=true\nfi\n\n\n# This bash script looks for the run_alphafold.py script in its current working directory, if it does not exist then exits\n#current_working_dir=$(pwd)\nalphafold_script=\"$(readlink -f $(dirname $0))/run_alphafold.py\"  \n\n\nif [ ! -f \"$alphafold_script\" ]; then\n    echo \"Alphafold python script $alphafold_script does not exist.\"\n    exit 1\nfi\n\n# Export ENVIRONMENT variables and set CUDA devices for use\nif [[ \"$use_gpu\" == true ]] ; then\n    export CUDA_VISIBLE_DEVICES=0\n\n    if [[ \"$gpu_devices\" ]] ; then\n        export CUDA_VISIBLE_DEVICES=$gpu_devices\n    fi\nfi\n\nexport TF_FORCE_UNIFIED_MEMORY='1'\nexport XLA_PYTHON_CLIENT_MEM_FRACTION='4.0'\n\n# Path and user config (change me if required)\nparameter_path=\"$data_dir/params\"\nbfd_database_path=\"$data_dir/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt\"\nsmall_bfd_database_path=\"$data_dir/small_bfd/bfd-first_non_consensus_sequences.fasta\"\nmgnify_database_path=\"$data_dir/mgnify/mgy_clusters_2018_12.fa\"\ntemplate_mmcif_dir=\"$data_dir/pdb_mmcif/mmcif_files\"\nobsolete_pdbs_path=\"$data_dir/pdb_mmcif/obsolete.dat\"\npdb70_database_path=\"$data_dir/pdb70/pdb70\"\npdb_seqres_database_path=\"$data_dir/pdb_seqres/pdb_seqres.txt\"\nuniref30_database_path=\"$data_dir/uniref30/UniRef30_2021_03\"  # We recommend this use the 2020 version of uniclust\nuniref90_database_path=\"$data_dir/uniref90/uniref90.fasta\"\nuniprot_database_path=\"$data_dir/uniprot/uniprot.fasta\"\n\n\nif [[ \"$db_preset\" == \"full_dbs\" ]] ; then\n    small_bfd_database_path=\"\"\nfi\n\nif [[ \"$db_preset\" == \"reduced_dbs\" ]] ; then\n    bfd_database_path=\"\"\n    uniref30_database_path=\"\"\nfi\n\n# Binary path (change me if required)\nhhblits_binary_path=$(which hhblits)\nhhsearch_binary_path=$(which hhsearch)\njackhmmer_binary_path=$(which jackhmmer)\nkalign_binary_path=$(which kalign)\nhmmsearch_binary_path=$(which hmmsearch)\nhmmbuild_binary_path=$(which hmmbuild)\n\n# Temporary\n# Missing random_seed, use_precomputed_msas\nif [[ \"$model_preset\" == \"monomer\" || \"$model_preset\" == \"monomer_ptm\" ]] ; then\n    pdb_seqres_database_path=\"\"\n    uniprot_database_path=\"\"\nfi\n\nif [[ \"$model_preset\" == \"multimer\" ]] ; then\n    pdb70_database_path=\"\"\nfi\n\n# Run AlphaFold with required parameters\npython $alphafold_script \\\n--fasta_paths=$fasta_path \\\n--model_names=$model_selection \\\n--parameter_path=$parameter_path \\\n--output_dir=$output_dir \\\n--jackhmmer_binary_path=$jackhmmer_binary_path \\\n--hhblits_binary_path=$hhblits_binary_path \\\n--hhsearch_binary_path=$hhsearch_binary_path \\\n--hmmsearch_binary_path=$hmmsearch_binary_path \\\n--hmmbuild_binary_path=$hmmbuild_binary_path \\\n--kalign_binary_path=$kalign_binary_path \\\n--uniref90_database_path=$uniref90_database_path \\\n--mgnify_database_path=$mgnify_database_path \\\n--bfd_database_path=$bfd_database_path \\\n--small_bfd_database_path=$small_bfd_database_path \\\n--uniref30_database_path=$uniref30_database_path \\\n--uniprot_database_path=$uniprot_database_path \\\n--pdb70_database_path=$pdb70_database_path \\\n--pdb_seqres_database_path=$pdb_seqres_database_path \\\n--template_mmcif_dir=$template_mmcif_dir \\\n--max_template_date=$max_template_date \\\n--obsolete_pdbs_path=$obsolete_pdbs_path \\\n--db_preset=$db_preset \\\n--model_preset=$model_preset \\\n--benchmark=$benchmark \\\n--models_to_relax=$models_to_relax \\\n--use_gpu_relax=$use_gpu_relax \\\n--recycling=$recycling \\\n--run_feature=$run_feature \\\n--logtostderr\n"
  },
  {
    "path": "scripts/download_all_data.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips all required data for AlphaFold.\n#\n# Usage: bash download_all_data.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n  echo \"Error: download directory must be provided as an input argument.\"\n  exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n  echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n  exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nDOWNLOAD_MODE=\"${2:-full_dbs}\"  # Default mode to full_dbs.\nif [[ \"${DOWNLOAD_MODE}\" != full_dbs && \"${DOWNLOAD_MODE}\" != reduced_dbs ]]\nthen\n  echo \"DOWNLOAD_MODE ${DOWNLOAD_MODE} not recognized.\"\n  exit 1\nfi\n\nSCRIPT_DIR=\"$(dirname \"$(realpath \"$0\")\")\"\n\necho \"Downloading AlphaFold parameters...\"\nbash \"${SCRIPT_DIR}/download_alphafold_params.sh\" \"${DOWNLOAD_DIR}\"\n\nif [[ \"${DOWNLOAD_MODE}\" = reduced_dbs ]] ; then\n  echo \"Downloading Small BFD...\"\n  bash \"${SCRIPT_DIR}/download_small_bfd.sh\" \"${DOWNLOAD_DIR}\"\nelse\n  echo \"Downloading BFD...\"\n  bash \"${SCRIPT_DIR}/download_bfd.sh\" \"${DOWNLOAD_DIR}\"\nfi\n\necho \"Downloading MGnify...\"\nbash \"${SCRIPT_DIR}/download_mgnify.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"Downloading PDB70...\"\nbash \"${SCRIPT_DIR}/download_pdb70.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"Downloading PDB mmCIF files...\"\nbash \"${SCRIPT_DIR}/download_pdb_mmcif.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"Downloading Uniref30...\"\nbash \"${SCRIPT_DIR}/download_uniref30.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"Downloading Uniref90...\"\nbash \"${SCRIPT_DIR}/download_uniref90.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"Downloading UniProt...\"\nbash \"${SCRIPT_DIR}/download_uniprot.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"Downloading PDB SeqRes...\"\nbash \"${SCRIPT_DIR}/download_pdb_seqres.sh\" \"${DOWNLOAD_DIR}\"\n\necho \"All data downloaded.\"\n"
  },
  {
    "path": "scripts/download_alphafold_params.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the AlphaFold parameters.\n#\n# Usage: bash download_alphafold_params.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/params\"\nSOURCE_URL=\"https://storage.googleapis.com/alphafold/alphafold_params_2022-12-06.tar\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\ntar --extract --verbose --file=\"${ROOT_DIR}/${BASENAME}\" \\\n  --directory=\"${ROOT_DIR}\" --preserve-permissions\nrm \"${ROOT_DIR}/${BASENAME}\"\n"
  },
  {
    "path": "scripts/download_bfd.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the BFD database for AlphaFold.\n#\n# Usage: bash download_bfd.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/bfd\"\n# Mirror of:\n# https://bfd.mmseqs.com/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt.tar.gz.\nSOURCE_URL=\"https://storage.googleapis.com/alphafold-databases/casp14_versions/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt.tar.gz\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\ntar --extract --verbose --file=\"${ROOT_DIR}/${BASENAME}\" \\\n  --directory=\"${ROOT_DIR}\"\nrm \"${ROOT_DIR}/${BASENAME}\"\n"
  },
  {
    "path": "scripts/download_mgnify.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the MGnify database for AlphaFold.\n#\n# Usage: bash download_mgnify.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/mgnify\"\n# Mirror of:\n# ftp://ftp.ebi.ac.uk/pub/databases/metagenomics/peptide_database/2022_05/mgy_clusters.fa.gz\nSOURCE_URL=\"https://storage.googleapis.com/alphafold-databases/v2.3/mgy_clusters_2022_05.fa.gz\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\npushd \"${ROOT_DIR}\"\ngunzip \"${ROOT_DIR}/${BASENAME}\"\npopd\n"
  },
  {
    "path": "scripts/download_pdb70.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the PDB70 database for AlphaFold.\n#\n# Usage: bash download_pdb70.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/pdb70\"\nSOURCE_URL=\"http://wwwuser.gwdg.de/~compbiol/data/hhsuite/databases/hhsuite_dbs/old-releases/pdb70_from_mmcif_200401.tar.gz\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\ntar --extract --verbose --file=\"${ROOT_DIR}/${BASENAME}\" \\\n  --directory=\"${ROOT_DIR}\"\nrm \"${ROOT_DIR}/${BASENAME}\"\n"
  },
  {
    "path": "scripts/download_pdb_mmcif.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads, unzips and flattens the PDB database for AlphaFold.\n#\n# Usage: bash download_pdb_mmcif.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nif ! command -v rsync &> /dev/null ; then\n    echo \"Error: rsync could not be found. Please install rsync.\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/pdb_mmcif\"\nRAW_DIR=\"${ROOT_DIR}/raw\"\nMMCIF_DIR=\"${ROOT_DIR}/mmcif_files\"\n\necho \"Running rsync to fetch all mmCIF files (note that the rsync progress estimate might be inaccurate)...\"\necho \"If the download speed is too slow, try changing the mirror to:\"\necho \"  * rsync.ebi.ac.uk::pub/databases/pdb/data/structures/divided/mmCIF/ (Europe)\"\necho \"  * ftp.pdbj.org::ftp_data/structures/divided/mmCIF/ (Asia)\"\necho \"or see https://www.wwpdb.org/ftp/pdb-ftp-sites for more download options.\"\nmkdir --parents \"${RAW_DIR}\"\nrsync --recursive --links --perms --times --compress --info=progress2 --delete --port=33444 \\\n  rsync.rcsb.org::ftp_data/structures/divided/mmCIF/ \\\n  \"${RAW_DIR}\"\n\necho \"Unzipping all mmCIF files...\"\nfind \"${RAW_DIR}/\" -type f -iname \"*.gz\" -exec gunzip {} +\n\necho \"Flattening all mmCIF files...\"\nmkdir --parents \"${MMCIF_DIR}\"\nfind \"${RAW_DIR}\" -type d -empty -delete  # Delete empty directories.\nfor subdir in \"${RAW_DIR}\"/*; do\n  mv \"${subdir}/\"*.cif \"${MMCIF_DIR}\"\ndone\n\n# Delete empty download directory structure.\nfind \"${RAW_DIR}\" -type d -empty -delete\n\naria2c \"ftp://ftp.wwpdb.org/pub/pdb/data/status/obsolete.dat\" --dir=\"${ROOT_DIR}\"\n"
  },
  {
    "path": "scripts/download_pdb_seqres.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the PDB SeqRes database for AlphaFold.\n#\n# Usage: bash download_pdb_seqres.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/pdb_seqres\"\nSOURCE_URL=\"ftp://ftp.wwpdb.org/pub/pdb/derived_data/pdb_seqres.txt\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\n\n# Keep only protein sequences.\ngrep --after-context=1 --no-group-separator '>.* mol:protein' \"${ROOT_DIR}/pdb_seqres.txt\" > \"${ROOT_DIR}/pdb_seqres_filtered.txt\"\nmv \"${ROOT_DIR}/pdb_seqres_filtered.txt\" \"${ROOT_DIR}/pdb_seqres.txt\"\n"
  },
  {
    "path": "scripts/download_small_bfd.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the Small BFD database for AlphaFold.\n#\n# Usage: bash download_small_bfd.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/small_bfd\"\nSOURCE_URL=\"https://storage.googleapis.com/alphafold-databases/reduced_dbs/bfd-first_non_consensus_sequences.fasta.gz\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\npushd \"${ROOT_DIR}\"\ngunzip \"${ROOT_DIR}/${BASENAME}\"\npopd\n"
  },
  {
    "path": "scripts/download_uniprot.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads, unzips and merges the SwissProt and TrEMBL databases for\n# AlphaFold-Multimer.\n#\n# Usage: bash download_uniprot.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/uniprot\"\n\nTREMBL_SOURCE_URL=\"ftp://ftp.ebi.ac.uk/pub/databases/uniprot/current_release/knowledgebase/complete/uniprot_trembl.fasta.gz\"\nTREMBL_BASENAME=$(basename \"${TREMBL_SOURCE_URL}\")\nTREMBL_UNZIPPED_BASENAME=\"${TREMBL_BASENAME%.gz}\"\n\nSPROT_SOURCE_URL=\"ftp://ftp.ebi.ac.uk/pub/databases/uniprot/current_release/knowledgebase/complete/uniprot_sprot.fasta.gz\"\nSPROT_BASENAME=$(basename \"${SPROT_SOURCE_URL}\")\nSPROT_UNZIPPED_BASENAME=\"${SPROT_BASENAME%.gz}\"\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${TREMBL_SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\naria2c \"${SPROT_SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\npushd \"${ROOT_DIR}\"\ngunzip \"${ROOT_DIR}/${TREMBL_BASENAME}\"\ngunzip \"${ROOT_DIR}/${SPROT_BASENAME}\"\n\n# Concatenate TrEMBL and SwissProt, rename to uniprot and clean up.\ncat \"${ROOT_DIR}/${SPROT_UNZIPPED_BASENAME}\" >> \"${ROOT_DIR}/${TREMBL_UNZIPPED_BASENAME}\"\nmv \"${ROOT_DIR}/${TREMBL_UNZIPPED_BASENAME}\" \"${ROOT_DIR}/uniprot.fasta\"\nrm \"${ROOT_DIR}/${SPROT_UNZIPPED_BASENAME}\"\npopd\n"
  },
  {
    "path": "scripts/download_uniref30.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the Uniclust30 database for AlphaFold.\n#\n# Usage: bash download_uniclust30.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/uniref30\"\n# Mirror of:\n# https://wwwuser.gwdg.de/~compbiol/uniclust/2021_03/UniRef30_2021_03.tar.gz\nSOURCE_URL=\"https://storage.googleapis.com/alphafold-databases/v2.3/UniRef30_2021_03.tar.gz\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\ntar --extract --verbose --file=\"${ROOT_DIR}/${BASENAME}\" \\\n  --directory=\"${ROOT_DIR}\"\nrm \"${ROOT_DIR}/${BASENAME}\"\n"
  },
  {
    "path": "scripts/download_uniref90.sh",
    "content": "#!/bin/bash\n#\n# Copyright 2021 DeepMind Technologies Limited\n#\n# Licensed under the Apache License, Version 2.0 (the \"License\");\n# you may not use this file except in compliance with the License.\n# You may obtain a copy of the License at\n#\n#      http://www.apache.org/licenses/LICENSE-2.0\n#\n# Unless required by applicable law or agreed to in writing, software\n# distributed under the License is distributed on an \"AS IS\" BASIS,\n# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n# See the License for the specific language governing permissions and\n# limitations under the License.\n#\n# Downloads and unzips the UniRef90 database for AlphaFold.\n#\n# Usage: bash download_uniref90.sh /path/to/download/directory\nset -e\n\nif [[ $# -eq 0 ]]; then\n    echo \"Error: download directory must be provided as an input argument.\"\n    exit 1\nfi\n\nif ! command -v aria2c &> /dev/null ; then\n    echo \"Error: aria2c could not be found. Please install aria2c (sudo apt install aria2).\"\n    exit 1\nfi\n\nDOWNLOAD_DIR=\"$1\"\nROOT_DIR=\"${DOWNLOAD_DIR}/uniref90\"\nSOURCE_URL=\"ftp://ftp.uniprot.org/pub/databases/uniprot/uniref/uniref90/uniref90.fasta.gz\"\nBASENAME=$(basename \"${SOURCE_URL}\")\n\nmkdir --parents \"${ROOT_DIR}\"\naria2c \"${SOURCE_URL}\" --dir=\"${ROOT_DIR}\"\npushd \"${ROOT_DIR}\"\ngunzip \"${ROOT_DIR}/${BASENAME}\"\npopd\n"
  },
  {
    "path": "tools/batch_scripts/batch_alphafold.sh",
    "content": "#!/bin/bash\n\nfor i in `seq -f \"%03g\" 2 1 5`\ndo\n    sed \"2s/^.*$/#SBATCH --job-name=A501_${i}/g\" template_alphafold.slurm > sub_alphafold.slurm\n    sbatch sub_alphafold.slurm\ndone\n\n\n\n"
  },
  {
    "path": "tools/batch_scripts/batch_feature.sh",
    "content": "#!/bin/bash\n\nfor i in `seq -f \"%03g\" 2 1 5`\ndo\n    sed \"2s/^.*$/#SBATCH --job-name=A501_${i}/g\" template.slurm > sub_feature.slurm\n    sbatch sub_feature.slurm\ndone\n\n\n\n"
  },
  {
    "path": "tools/batch_scripts/move_batch.sh",
    "content": "#!/bin/bash\n\nfor i in `seq -f \"%03g\" 18 1 20`\ndo\n    mv ./task_file/A501_${i}_* ./A501_result/A501_${i}/\ndone\n\n\n\n"
  },
  {
    "path": "tools/plddt.py",
    "content": "from __future__ import print_function\nimport pickle\nimport sys\n\ntry:\n    if sys.argv[1][-3:] == 'pkl':\n        pkl_file = open(sys.argv[1],'rb')\n        result_pkl = pickle.load(pkl_file)\n        plddt_score = result_pkl['plddt']\n        print(sys.argv[1][:-4],end=\", \")\n        for i in range(len(plddt_score)):\n            print(\"%.4f\"%plddt_score[i],end=\"\")\n            if i != len(plddt_score)-1:\n                print(\", \" ,end=\"\")\n        print('\\n',end=\"\")\n        pkl_file.close()\n    else:\n        print(\"Usage: python3 plddt.py [AlphaFold predict output plddt file]\\n\")\nexcept:\n    print(\"Usage: python3 plddt.py [AlphaFold predict output plddt file]\\n\")\n    \n\n"
  }
]