Full Code of atenfyr/UAssetAPI for AI

master cb4206007d86 cached
1498 files
90.0 MB
1.0M tokens
2915 symbols
1 requests
Download .txt
Showing preview only (4,071K chars total). Download the full file or copy to clipboard to get everything.
Repository: atenfyr/UAssetAPI
Branch: master
Commit: cb4206007d86
Files: 1498
Total size: 90.0 MB

Directory structure:
gitextract_6utsa1vi/

├── .github/
│   ├── ISSUE_TEMPLATE/
│   │   ├── bug_report.md
│   │   ├── config.yml
│   │   └── feature_request.md
│   ├── pull_request_template.md
│   └── workflows/
│       ├── build.yml
│       └── main.yml
├── .gitignore
├── LICENSE
├── NOTICE.md
├── README.md
├── UAssetAPI/
│   ├── AC7Decrypt.cs
│   ├── AssetBinaryReader.cs
│   ├── AssetBinaryWriter.cs
│   ├── CRCGenerator.cs
│   ├── CustomVersion.cs
│   ├── CustomVersions/
│   │   └── CustomVersions.cs
│   ├── ExportTypes/
│   │   ├── AssetImportDataExport.cs
│   │   ├── ClassExport.cs
│   │   ├── DataTableExport.cs
│   │   ├── EnumExport.cs
│   │   ├── Export.cs
│   │   ├── FieldExport.cs
│   │   ├── FunctionExport.cs
│   │   ├── LevelExport.cs
│   │   ├── MetaDataExport.cs
│   │   ├── NormalExport.cs
│   │   ├── PropertyExport.cs
│   │   ├── RawExport.cs
│   │   ├── StringTableExport.cs
│   │   ├── StructExport.cs
│   │   └── UserDefinedStructExport.cs
│   ├── FieldTypes/
│   │   ├── EArrayDim.cs
│   │   ├── ELifetimeCondition.cs
│   │   ├── FField.cs
│   │   └── UField.cs
│   ├── Import.cs
│   ├── JSON/
│   │   ├── ByteArrayJsonConverter.cs
│   │   ├── FNameJsonConverter.cs
│   │   ├── FPackageIndexJsonConverter.cs
│   │   ├── FSignedZeroJsonConverter.cs
│   │   ├── FStringJsonConverter.cs
│   │   ├── FStringTableJsonConverter.cs
│   │   ├── GuidJsonConverter.cs
│   │   ├── TMapJsonConverter.cs
│   │   └── UAssetContractResolver.cs
│   ├── Kismet/
│   │   ├── Bytecode/
│   │   │   ├── EBlueprintTextLiteralType.cs
│   │   │   ├── EExprToken.cs
│   │   │   ├── EScriptInstrumentationType.cs
│   │   │   ├── ExpressionSerializer.cs
│   │   │   ├── Expressions/
│   │   │   │   ├── EX_AddMulticastDelegate.cs
│   │   │   │   ├── EX_ArrayConst.cs
│   │   │   │   ├── EX_ArrayGetByRef.cs
│   │   │   │   ├── EX_Assert.cs
│   │   │   │   ├── EX_BindDelegate.cs
│   │   │   │   ├── EX_BitFieldConst.cs
│   │   │   │   ├── EX_Breakpoint.cs
│   │   │   │   ├── EX_ByteConst.cs
│   │   │   │   ├── EX_CallMath.cs
│   │   │   │   ├── EX_CallMulticastDelegate.cs
│   │   │   │   ├── EX_CastBase.cs
│   │   │   │   ├── EX_ClassContext.cs
│   │   │   │   ├── EX_ClassSparseDataVariable.cs
│   │   │   │   ├── EX_ClearMulticastDelegate.cs
│   │   │   │   ├── EX_ComputedJump.cs
│   │   │   │   ├── EX_Context.cs
│   │   │   │   ├── EX_Context_FailSilent.cs
│   │   │   │   ├── EX_CrossInterfaceCast.cs
│   │   │   │   ├── EX_DefaultVariable.cs
│   │   │   │   ├── EX_DeprecatedOp4A.cs
│   │   │   │   ├── EX_DoubleConst.cs
│   │   │   │   ├── EX_DynamicCast.cs
│   │   │   │   ├── EX_EndArray.cs
│   │   │   │   ├── EX_EndArrayConst.cs
│   │   │   │   ├── EX_EndFunctionParms.cs
│   │   │   │   ├── EX_EndMap.cs
│   │   │   │   ├── EX_EndMapConst.cs
│   │   │   │   ├── EX_EndOfScript.cs
│   │   │   │   ├── EX_EndParmValue.cs
│   │   │   │   ├── EX_EndSet.cs
│   │   │   │   ├── EX_EndSetConst.cs
│   │   │   │   ├── EX_EndStructConst.cs
│   │   │   │   ├── EX_False.cs
│   │   │   │   ├── EX_FieldPathConst.cs
│   │   │   │   ├── EX_FinalFunction.cs
│   │   │   │   ├── EX_FloatConst.cs
│   │   │   │   ├── EX_InstanceDelegate.cs
│   │   │   │   ├── EX_InstanceVariable.cs
│   │   │   │   ├── EX_InstrumentationEvent.cs
│   │   │   │   ├── EX_Int64Const.cs
│   │   │   │   ├── EX_IntConst.cs
│   │   │   │   ├── EX_IntConstByte.cs
│   │   │   │   ├── EX_IntOne.cs
│   │   │   │   ├── EX_IntZero.cs
│   │   │   │   ├── EX_InterfaceContext.cs
│   │   │   │   ├── EX_InterfaceToObjCast.cs
│   │   │   │   ├── EX_Jump.cs
│   │   │   │   ├── EX_JumpIfNot.cs
│   │   │   │   ├── EX_Let.cs
│   │   │   │   ├── EX_LetBase.cs
│   │   │   │   ├── EX_LetBool.cs
│   │   │   │   ├── EX_LetDelegate.cs
│   │   │   │   ├── EX_LetMulticastDelegate.cs
│   │   │   │   ├── EX_LetObj.cs
│   │   │   │   ├── EX_LetValueOnPersistentFrame.cs
│   │   │   │   ├── EX_LetWeakObjPtr.cs
│   │   │   │   ├── EX_LocalFinalFunction.cs
│   │   │   │   ├── EX_LocalOutVariable.cs
│   │   │   │   ├── EX_LocalVariable.cs
│   │   │   │   ├── EX_LocalVirtualFunction.cs
│   │   │   │   ├── EX_MapConst.cs
│   │   │   │   ├── EX_MetaCast.cs
│   │   │   │   ├── EX_NameConst.cs
│   │   │   │   ├── EX_NoInterface.cs
│   │   │   │   ├── EX_NoObject.cs
│   │   │   │   ├── EX_Nothing.cs
│   │   │   │   ├── EX_NothingInt32.cs
│   │   │   │   ├── EX_ObjToInterfaceCast.cs
│   │   │   │   ├── EX_ObjectConst.cs
│   │   │   │   ├── EX_PopExecutionFlow.cs
│   │   │   │   ├── EX_PopExecutionFlowIfNot.cs
│   │   │   │   ├── EX_PrimitiveCast.cs
│   │   │   │   ├── EX_PropertyConst.cs
│   │   │   │   ├── EX_PushExecutionFlow.cs
│   │   │   │   ├── EX_RemoveMulticastDelegate.cs
│   │   │   │   ├── EX_Return.cs
│   │   │   │   ├── EX_RotationConst.cs
│   │   │   │   ├── EX_Self.cs
│   │   │   │   ├── EX_SetArray.cs
│   │   │   │   ├── EX_SetConst.cs
│   │   │   │   ├── EX_SetMap.cs
│   │   │   │   ├── EX_SetSet.cs
│   │   │   │   ├── EX_Skip.cs
│   │   │   │   ├── EX_SkipOffsetConst.cs
│   │   │   │   ├── EX_SoftObjectConst.cs
│   │   │   │   ├── EX_StringConst.cs
│   │   │   │   ├── EX_StructConst.cs
│   │   │   │   ├── EX_StructMemberContext.cs
│   │   │   │   ├── EX_SwitchValue.cs
│   │   │   │   ├── EX_TextConst.cs
│   │   │   │   ├── EX_Tracepoint.cs
│   │   │   │   ├── EX_TransformConst.cs
│   │   │   │   ├── EX_True.cs
│   │   │   │   ├── EX_UInt64Const.cs
│   │   │   │   ├── EX_UnicodeStringConst.cs
│   │   │   │   ├── EX_VariableBase.cs
│   │   │   │   ├── EX_Vector3fConst.cs
│   │   │   │   ├── EX_VectorConst.cs
│   │   │   │   ├── EX_VirtualFunction.cs
│   │   │   │   └── EX_WireTracepoint.cs
│   │   │   ├── FScriptText.cs
│   │   │   ├── KismetExpression.cs
│   │   │   └── KismetPropertyPointer.cs
│   │   └── KismetSerializer.cs
│   ├── MainSerializer.cs
│   ├── Pak/
│   │   ├── Interop.cs
│   │   └── RePak.cs
│   ├── Properties/
│   │   ├── AssemblyInfo.cs
│   │   ├── Resources.Designer.cs
│   │   └── Resources.resx
│   ├── PropertyTypes/
│   │   ├── Objects/
│   │   │   ├── ArrayPropertyData.cs
│   │   │   ├── BoolPropertyData.cs
│   │   │   ├── BytePropertyData.cs
│   │   │   ├── DelegatePropertyData.cs
│   │   │   ├── DoublePropertyData.cs
│   │   │   ├── EnumPropertyData.cs
│   │   │   ├── FieldPathPropertyData.cs
│   │   │   ├── FloatPropertyData.cs
│   │   │   ├── Int16PropertyData.cs
│   │   │   ├── Int64PropertyData.cs
│   │   │   ├── Int8PropertyData.cs
│   │   │   ├── IntPropertyData.cs
│   │   │   ├── InterfacePropertyData.cs
│   │   │   ├── MapPropertyData.cs
│   │   │   ├── MulticastDelegatePropertyData.cs
│   │   │   ├── NamePropertyData.cs
│   │   │   ├── ObjectPropertyData.cs
│   │   │   ├── PropertyData.cs
│   │   │   ├── SetPropertyData.cs
│   │   │   ├── SoftObjectPropertyData.cs
│   │   │   ├── StrPropertyData.cs
│   │   │   ├── TextHistoryType.cs
│   │   │   ├── TextPropertyData.cs
│   │   │   ├── UInt16PropertyData.cs
│   │   │   ├── UInt32PropertyData.cs
│   │   │   ├── UInt64PropertyData.cs
│   │   │   ├── UnknownPropertyData.cs
│   │   │   └── WeakObjectPropertyData.cs
│   │   └── Structs/
│   │       ├── ClothLODDataPropertyData.cs
│   │       ├── ClothTetherDataPropertyData.cs
│   │       ├── Core/
│   │       │   ├── ColorPropertyData.cs
│   │       │   ├── DateTimePropertyData.cs
│   │       │   ├── GuidPropertyData.cs
│   │       │   └── TimespanPropertyData.cs
│   │       ├── Engine/
│   │       │   ├── FontCharacterPropertyData.cs
│   │       │   ├── KeyHandleMapPropertyData.cs
│   │       │   ├── MaterialInputProperties.cs
│   │       │   ├── MaterialOverrideNanitePropertyData.cs
│   │       │   ├── NavAgentSelectorPropertyData.cs
│   │       │   ├── PerPlatformProperties.cs
│   │       │   ├── PerQualityProperties.cs
│   │       │   ├── RichCurveKeyPropertyData.cs
│   │       │   ├── SkeletalMeshSamplingLODBuiltDataPropertyData.cs
│   │       │   ├── SkeletalMeshSamplingRegionBuiltDataPropertyData.cs
│   │       │   ├── SmartNamePropertyData.cs
│   │       │   ├── StringCurveKeyPropertyData.cs
│   │       │   ├── ViewTargetBlendParamsPropertyData.cs
│   │       │   └── WeightedRandomSamplerPropertyData.cs
│   │       ├── GameplayTagContainerPropertyData.cs
│   │       ├── LevelSequenceObjectReferenceMapPropertyData.cs
│   │       ├── Math/
│   │       │   ├── BoxPropertyData.cs
│   │       │   ├── IntPointPropertyData.cs
│   │       │   ├── IntVector2PropertyData.cs
│   │       │   ├── IntVectorPropertyData.cs
│   │       │   ├── LinearColorPropertyData.cs
│   │       │   ├── MatrixPropertyData.cs
│   │       │   ├── PlanePropertyData.cs
│   │       │   ├── QuatPropertyData.cs
│   │       │   ├── RotatorPropertyData.cs
│   │       │   ├── TwoVectorsPropertyData.cs
│   │       │   ├── Vector2DPropertyData.cs
│   │       │   ├── Vector2fPropertyData.cs
│   │       │   ├── Vector3fPropertyData.cs
│   │       │   ├── Vector4PropertyData.cs
│   │       │   ├── Vector4fPropertyData.cs
│   │       │   ├── VectorNetQuantizePropertyData.cs
│   │       │   └── VectorPropertyData.cs
│   │       ├── Movies/
│   │       │   ├── FrameNumberPropertyData.cs
│   │       │   ├── MovieScene.cs
│   │       │   ├── MovieSceneChannel.cs
│   │       │   ├── MovieSceneDoubleChannelPropertyData.cs
│   │       │   ├── MovieSceneEvalTemplatePtrPropertyData.cs
│   │       │   ├── MovieSceneEvaluationFieldEntityTreePropertyData.cs
│   │       │   ├── MovieSceneEvaluationTree.cs
│   │       │   ├── MovieSceneEvaluationTreeNode.cs
│   │       │   ├── MovieSceneEventParametersPropertyData.cs
│   │       │   ├── MovieSceneFloatChannelPropertyData.cs
│   │       │   ├── MovieSceneFloatValuePropertyData.cs
│   │       │   ├── MovieSceneFrameRangePropertyData.cs
│   │       │   ├── MovieSceneGenerationLedgerPropertyData.cs
│   │       │   ├── MovieSceneSegment.cs
│   │       │   ├── MovieSceneSegmentPropertyData.cs
│   │       │   ├── MovieSceneTrackIdentifierPropertyData.cs
│   │       │   ├── MovieSceneValue.cs
│   │       │   └── NameCurveKeyPropertyData.cs
│   │       ├── Niagara/
│   │       │   ├── NiagaraDataInterfaceGPUParamInfoPropertyData.cs
│   │       │   └── NiagaraVariablePropertyData.cs
│   │       ├── Ranges/
│   │       │   └── FloatRangePropertyData.cs
│   │       ├── RawStructPropertyData.cs
│   │       ├── Slate/
│   │       │   ├── DeprecateSlateVector2DPropertyData.cs
│   │       │   └── FontDataPropertyData.cs
│   │       ├── SoftObjectPathPropertyData.cs
│   │       └── StructPropertyData.cs
│   ├── UAPUtils.cs
│   ├── UAsset.cs
│   ├── UAssetAPI.csproj
│   ├── UnrealTypes/
│   │   ├── EngineVersion.cs
│   │   ├── FFieldPath.cs
│   │   ├── FGatherableTextData.cs
│   │   ├── FLocMetadataObject.cs
│   │   ├── FName.cs
│   │   ├── FObjectDataResource.cs
│   │   ├── FObjectThumbnail.cs
│   │   ├── FPackageIndex.cs
│   │   ├── FPropertyTypeName.cs
│   │   ├── FString.cs
│   │   ├── FTextSourceData.cs
│   │   ├── FTextSourceSiteContext.cs
│   │   ├── FUniversalObjectLocatorFragment.cs
│   │   ├── FWorldTileInfo.cs
│   │   ├── Flags.cs
│   │   ├── ObjectVersion.cs
│   │   ├── Objects/
│   │   │   ├── Core/
│   │   │   │   └── Math/
│   │   │   │       ├── FIntVector.cs
│   │   │   │       ├── FIntVector2.cs
│   │   │   │       ├── FLinearColor.cs
│   │   │   │       ├── FMatrix.cs
│   │   │   │       ├── FPlane.cs
│   │   │   │       ├── FQuat.cs
│   │   │   │       ├── FRotator.cs
│   │   │   │       ├── FTransform.cs
│   │   │   │       ├── FTwoVectors.cs
│   │   │   │       ├── FVector.cs
│   │   │   │       ├── FVector2D.cs
│   │   │   │       ├── FVector2f.cs
│   │   │   │       ├── FVector3f.cs
│   │   │   │       ├── FVector4.cs
│   │   │   │       ├── FVector4f.cs
│   │   │   │       ├── TBox.cs
│   │   │   │       └── TPerQualityLevel.cs
│   │   │   ├── Engine/
│   │   │   │   ├── CoreUObject/
│   │   │   │   │   ├── CoreUObjectEnums.cs
│   │   │   │   │   └── CoreUObjectStructs.cs
│   │   │   │   ├── EngineEnums.cs
│   │   │   │   ├── FFontCharacter.cs
│   │   │   │   ├── FRichCurveKey.cs
│   │   │   │   ├── FSkeletalMeshSamplingRegionBuiltData.cs
│   │   │   │   ├── FWeightedRandomSampler.cs
│   │   │   │   ├── GameFramework/
│   │   │   │   │   └── UniqueNetIdReplPropertyData.cs
│   │   │   │   └── Niagara/
│   │   │   │       └── FNiagaraDataInterfaceGPUParamInfo.cs
│   │   │   └── SlateCore/
│   │   │       └── FFontData.cs
│   │   ├── TMap.cs
│   │   └── UE4VersionToObjectVersion.cs
│   └── Unversioned/
│       ├── FFragment.cs
│       ├── FUnversionedHeader.cs
│       ├── Oodle.cs
│       ├── SaveGame.cs
│       ├── Usmap.cs
│       └── UsmapBinaryReader.cs
├── UAssetAPI.Benchmark/
│   ├── App.config
│   ├── Program.cs
│   ├── Properties/
│   │   └── AssemblyInfo.cs
│   ├── TestAssets/
│   │   ├── B_Gamemode.uasset
│   │   ├── Begin_Player.uasset
│   │   ├── HUB_Restaurant.uexp
│   │   ├── HUB_Restaurant.umap
│   │   ├── PlayerBase01.uexp
│   │   ├── PlayerBase01.umap
│   │   ├── Staging_T2.uexp
│   │   ├── Staging_T2.umap
│   │   └── _asset_versions.json
│   └── UAssetAPI.Benchmark.csproj
├── UAssetAPI.Tests/
│   ├── AssetUnitTests.cs
│   ├── CoolPropertyData.cs
│   ├── Properties/
│   │   ├── AssemblyInfo.cs
│   │   ├── Resources.Designer.cs
│   │   └── Resources.resx
│   ├── TestAssets/
│   │   ├── TestACE7/
│   │   │   ├── ex02_IGC_03_Subtitle.uasset
│   │   │   ├── ex02_IGC_03_Subtitle.uexp
│   │   │   ├── plwp_6aam_a0.uasset
│   │   │   └── plwp_6aam_a0.uexp
│   │   ├── TestCustomProperty/
│   │   │   └── AlternateStartActor.uasset
│   │   ├── TestCustomSerializationStructsInMap/
│   │   │   ├── wtf.uasset
│   │   │   └── wtf.uexp
│   │   ├── TestDuplicateNameMapEntries/
│   │   │   ├── BIOME_AzureWeald.uasset
│   │   │   └── BIOME_AzureWeald.uexp
│   │   ├── TestEditorAssets/
│   │   │   ├── TestActorBP.uasset
│   │   │   ├── TestMaterial.uasset
│   │   │   └── TestSoundClass.uasset
│   │   ├── TestImproperNameMapHashes/
│   │   │   ├── OC_Gatling_DamageB_B.uasset
│   │   │   └── OC_Gatling_DamageB_B.uexp
│   │   ├── TestJson/
│   │   │   ├── ABP_SMG_A.uasset
│   │   │   ├── ABP_SMG_A.uexp
│   │   │   ├── AssetDatabase_AutoGenerated.uasset
│   │   │   ├── AssetDatabase_AutoGenerated.uexp
│   │   │   ├── Atlas_6x4_Semi.uasset
│   │   │   ├── Atlas_6x4_Semi.uexp
│   │   │   ├── BlinkerLight_01.uasset
│   │   │   ├── BlinkerLight_01.uexp
│   │   │   ├── FrontDomeLight_2m.uasset
│   │   │   ├── FrontDomeLight_2m.uexp
│   │   │   ├── Items.uasset
│   │   │   ├── Items.uexp
│   │   │   ├── MGA_HeavyWeapon_Parent.uasset
│   │   │   ├── MGA_HeavyWeapon_Parent.uexp
│   │   │   ├── MTVehicleBaseBP.uasset
│   │   │   ├── MTVehicleBaseBP.uexp
│   │   │   ├── Map_FrontEnd_Hotel_LS_Night.uexp
│   │   │   ├── Map_FrontEnd_Hotel_LS_Night.umap
│   │   │   ├── MotorTown.usmap
│   │   │   ├── Outriders.usmap
│   │   │   ├── RaceSimDataAsset.uasset
│   │   │   ├── RaceSimDataAsset.uexp
│   │   │   ├── ReverseLight_01.uasset
│   │   │   ├── ReverseLight_01.uexp
│   │   │   ├── TaliLight_01.uasset
│   │   │   ├── TaliLight_01.uexp
│   │   │   ├── TurboAcres_Environment.uasset
│   │   │   ├── TurboAcres_Environment.uexp
│   │   │   ├── WPN_LockOnRifle.uasset
│   │   │   └── WPN_LockOnRifle.uexp
│   │   ├── TestManyAssets/
│   │   │   ├── Astroneer/
│   │   │   │   ├── Augment_BroadBrush.uasset
│   │   │   │   ├── DebugMenu.uasset
│   │   │   │   ├── LargeResourceCanister_IT.uasset
│   │   │   │   ├── ResourceProgressCurve.uasset
│   │   │   │   └── Staging_T2.umap
│   │   │   ├── Biodigital/
│   │   │   │   ├── Roboto.uasset
│   │   │   │   └── RobotoTiny.uasset
│   │   │   ├── Bloodstained/
│   │   │   │   ├── PB_DT_ItemMaster.uasset
│   │   │   │   ├── PB_DT_RandomizerRoomCheck.uasset
│   │   │   │   ├── m01SIP_000_BG.umap
│   │   │   │   ├── m01SIP_000_Gimmick.umap
│   │   │   │   ├── m02VIL_004_Gimmick.umap
│   │   │   │   └── m05SAN_000_Gimmick.umap
│   │   │   ├── BurningDaylight/
│   │   │   │   ├── TestMap.uexp
│   │   │   │   └── TestMap.umap
│   │   │   ├── CodeVein/
│   │   │   │   ├── SK_Inner_Female1.uasset
│   │   │   │   └── SK_Inner_Female1.uexp
│   │   │   ├── F1Manager2023/
│   │   │   │   ├── F1Manager2023.usmap
│   │   │   │   ├── FixedStaff.uasset
│   │   │   │   ├── FixedStaff.uexp
│   │   │   │   ├── MI_F1_Driver_LoganSargeant_Visor.uasset
│   │   │   │   ├── MI_F1_Driver_LoganSargeant_Visor.uexp
│   │   │   │   ├── StaffPhotoData.uasset
│   │   │   │   └── StaffPhotoData.uexp
│   │   │   ├── LiesOfP/
│   │   │   │   ├── ItemInfo.uasset
│   │   │   │   ├── ItemInfo.uexp
│   │   │   │   ├── LiesOfP.usmap
│   │   │   │   ├── SkillHitInfo.uasset
│   │   │   │   ├── SkillHitInfo.uexp
│   │   │   │   ├── SkillInfo.uasset
│   │   │   │   └── SkillInfo.uexp
│   │   │   ├── Liminal/
│   │   │   │   ├── FinalCinematic.uasset
│   │   │   │   ├── FinalCinematic.uexp
│   │   │   │   ├── InCathedralCinematic.uasset
│   │   │   │   ├── InCathedralCinematic.uexp
│   │   │   │   ├── InventoryStruct.uasset
│   │   │   │   └── InventoryStruct.uexp
│   │   │   ├── MISC_426/
│   │   │   │   ├── MainChar_BellySlice_BR.uasset
│   │   │   │   ├── MainChar_BellySlice_BR.uexp
│   │   │   │   ├── RaceSimDataAsset.uasset
│   │   │   │   └── RaceSimDataAsset.uexp
│   │   │   ├── MidAir/
│   │   │   │   ├── AM_MedChar_Reload_RingLauncher.uasset
│   │   │   │   ├── AM_MedChar_Reload_RingLauncher.uexp
│   │   │   │   ├── WBP_PartyPlayerRow.uasset
│   │   │   │   └── WBP_PartyPlayerRow.uexp
│   │   │   ├── MutantYearZero/
│   │   │   │   ├── ChroniclerpathCutscene.uasset
│   │   │   │   ├── ChroniclerpathCutscene.uexp
│   │   │   │   ├── MainCut.uasset
│   │   │   │   └── MainCut.uexp
│   │   │   ├── Palia/
│   │   │   │   ├── DT_FishConfigs.uasset
│   │   │   │   ├── DT_FishConfigs.uexp
│   │   │   │   ├── DT_FishingLevelConfigs.uasset
│   │   │   │   ├── DT_FishingLevelConfigs.uexp
│   │   │   │   ├── DT_FishingLevelSegmentConfigs.uasset
│   │   │   │   ├── DT_FishingLevelSegmentConfigs.uexp
│   │   │   │   ├── DT_FishingLootConfigs.uasset
│   │   │   │   ├── DT_FishingLootConfigs.uexp
│   │   │   │   ├── DT_FishingNibbleConfig.uasset
│   │   │   │   ├── DT_FishingNibbleConfig.uexp
│   │   │   │   ├── DT_FishingNibbleLevelConfig.uasset
│   │   │   │   ├── DT_FishingNibbleLevelConfig.uexp
│   │   │   │   ├── DT_ShopConfigs.uasset
│   │   │   │   ├── DT_ShopConfigs.uexp
│   │   │   │   └── Palia.usmap
│   │   │   ├── Palworld/
│   │   │   │   ├── BP_BuildObject_BaseCampWorkHard.uasset
│   │   │   │   ├── BP_BuildObject_BaseCampWorkHard.uexp
│   │   │   │   ├── BP_InteractableBox.uasset
│   │   │   │   ├── BP_InteractableBox.uexp
│   │   │   │   └── Palworld.usmap
│   │   │   ├── SnakePass/
│   │   │   │   ├── MP00_GateTutorial.uasset
│   │   │   │   └── MP00_Intro.uasset
│   │   │   ├── StarlitSeason/
│   │   │   │   ├── CharacterCostume_chr0001_DataTable.uasset
│   │   │   │   └── CharacterCostume_chr0001_DataTable.uexp
│   │   │   ├── Tekken/
│   │   │   │   └── BP_TekkenPlayer_Modular.uasset
│   │   │   ├── TheBeastInside/
│   │   │   │   ├── DV_ItemDescription.uasset
│   │   │   │   ├── DV_ItemDescription.uexp
│   │   │   │   ├── MF_CharacterEffects.uasset
│   │   │   │   └── MF_CharacterEffects.uexp
│   │   │   ├── TheOccupation/
│   │   │   │   ├── LiftStruct.uasset
│   │   │   │   └── RecieverPneumaticTerminals.uasset
│   │   │   ├── ToTheCore/
│   │   │   │   ├── BP_MimicCrate.uasset
│   │   │   │   └── BP_MimicCrate.uexp
│   │   │   └── VERSIONED/
│   │   │       └── Assault_M1A1Thompson_WW2_DrumSuppressor.uasset
│   │   ├── TestMaterials/
│   │   │   ├── M_COM_DetailMaster_B.uasset
│   │   │   ├── as_mt_base.uasset
│   │   │   └── as_mt_base.uexp
│   │   ├── TestUE5_1/
│   │   │   └── UnderlyingEnumTypes/
│   │   │       ├── NewDataTable.uasset
│   │   │       ├── NewDataTable.uexp
│   │   │       └── UnderlyingEnumTypes.usmap
│   │   ├── TestUE5_3/
│   │   │   ├── Engine/
│   │   │   │   ├── DefaultRecorderBoneCompression.uasset
│   │   │   │   ├── DefaultRecorderBoneCompression.uexp
│   │   │   │   ├── Engine.usmap
│   │   │   │   ├── Entry.uexp
│   │   │   │   ├── Entry.umap
│   │   │   │   ├── Entry_MODIFIED_INVALID_ENUM_INDEX.uexp
│   │   │   │   ├── Entry_MODIFIED_INVALID_ENUM_INDEX.umap
│   │   │   │   ├── OpenWorld.uexp
│   │   │   │   └── OpenWorld.umap
│   │   │   └── RON/
│   │   │       ├── AmmoDataTable.uasset
│   │   │       ├── AmmoDataTable.uexp
│   │   │       └── ReadyOrNot.usmap
│   │   ├── TestUE5_4/
│   │   │   ├── Bellwright/
│   │   │   │   ├── Bellwright.usmap
│   │   │   │   └── Content/
│   │   │   │       └── Mist/
│   │   │   │           └── Characters/
│   │   │   │               └── NPC/
│   │   │   │                   └── Villager/
│   │   │   │                       ├── HighSkill/
│   │   │   │                       │   ├── ApprenticeBlacksmithNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeBlacksmithNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeCarpenterNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeCarpenterNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeEngineerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeEngineerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeFarmerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeFarmerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeHealerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeHealerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeInkeeperNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeInkeeperNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeLabourerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeLabourerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeWeaverNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeWeaverNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeWoodsmanNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeWoodsmanNPCTemplate.uexp
│   │   │   │                       │   ├── HighNoTraitsVillagerIdleNPCTemplate.uasset
│   │   │   │                       │   ├── HighNoTraitsVillagerIdleNPCTemplate.uexp
│   │   │   │                       │   ├── HighVillagerIdleNPCTemplate.uasset
│   │   │   │                       │   └── HighVillagerIdleNPCTemplate.uexp
│   │   │   │                       ├── LowSkill/
│   │   │   │                       │   ├── LowBeggarNPCTemplate.uasset
│   │   │   │                       │   ├── LowBeggarNPCTemplate.uexp
│   │   │   │                       │   ├── LowVillagerIdleNPCTemplate.uasset
│   │   │   │                       │   ├── LowVillagerIdleNPCTemplate.uexp
│   │   │   │                       │   ├── LowVillagerIdleNoTraitsNPCTemplate.uasset
│   │   │   │                       │   └── LowVillagerIdleNoTraitsNPCTemplate.uexp
│   │   │   │                       └── MediumSkill/
│   │   │   │                           ├── MediumNoTraitsVillagerIdleNPCTemplate.uasset
│   │   │   │                           ├── MediumNoTraitsVillagerIdleNPCTemplate.uexp
│   │   │   │                           ├── MediumVillagerIdleNPCTemplate.uasset
│   │   │   │                           ├── MediumVillagerIdleNPCTemplate.uexp
│   │   │   │                           ├── NoviceBlacksmithNPCTemplate.uasset
│   │   │   │                           ├── NoviceBlacksmithNPCTemplate.uexp
│   │   │   │                           ├── NoviceCarpenterNPCTemplate.uasset
│   │   │   │                           ├── NoviceCarpenterNPCTemplate.uexp
│   │   │   │                           ├── NoviceEngineerNPCTemplate.uasset
│   │   │   │                           ├── NoviceEngineerNPCTemplate.uexp
│   │   │   │                           ├── NoviceFarmerNPCTemplate.uasset
│   │   │   │                           ├── NoviceFarmerNPCTemplate.uexp
│   │   │   │                           ├── NoviceHealerNPCTemplate.uasset
│   │   │   │                           ├── NoviceHealerNPCTemplate.uexp
│   │   │   │                           ├── NoviceInkeeperNPCTemplate.uasset
│   │   │   │                           ├── NoviceInkeeperNPCTemplate.uexp
│   │   │   │                           ├── NoviceLabourerNPCTemplate.uasset
│   │   │   │                           ├── NoviceLabourerNPCTemplate.uexp
│   │   │   │                           ├── NoviceWeaverNPCTemplate.uasset
│   │   │   │                           ├── NoviceWeaverNPCTemplate.uexp
│   │   │   │                           ├── NoviceWoodsmanNPCTemplate.uasset
│   │   │   │                           └── NoviceWoodsmanNPCTemplate.uexp
│   │   │   ├── Billiards/
│   │   │   │   ├── 5.4.3-34507850+++UE5+Release-5.4-DeepSpace7.usmap
│   │   │   │   ├── BP_Table_Lamp.uasset
│   │   │   │   └── BP_Table_Lamp.uexp
│   │   │   ├── BlankGame/
│   │   │   │   ├── BP_CubePawn.combined
│   │   │   │   ├── BP_CubePawn.uasset
│   │   │   │   ├── BP_CubePawn.uexp
│   │   │   │   ├── BlankGame_Dumper-7.usmap
│   │   │   │   ├── MI_BlueCube.uasset
│   │   │   │   ├── MI_BlueCube.uexp
│   │   │   │   ├── M_Cube.uasset
│   │   │   │   ├── M_Cube.uexp
│   │   │   │   ├── SM_BlueCube.uasset
│   │   │   │   └── SM_BlueCube.uexp
│   │   │   ├── JOY/
│   │   │   │   ├── 5.4.3-34507850+++UE5+Release-5.4-JOY.usmap
│   │   │   │   ├── BP_GameMode_Base.uasset
│   │   │   │   └── BP_GameMode_Base.uexp
│   │   │   └── TheForeverWinter/
│   │   │       ├── DA_DailyGiftList.uasset
│   │   │       ├── DA_DailyGiftList.uexp
│   │   │       └── TheForeverWinter.usmap
│   │   ├── TestUE5_5/
│   │   │   └── BlankGame/
│   │   │       ├── BP_Test.uasset
│   │   │       ├── BP_Test.uexp
│   │   │       ├── BlankUE5_5.usmap
│   │   │       ├── M_Cube_1.uasset
│   │   │       ├── M_Cube_1.uexp
│   │   │       ├── SM_Cube.uasset
│   │   │       ├── SM_Cube.ubulk
│   │   │       ├── SM_Cube.uexp
│   │   │       ├── T_Test.uasset
│   │   │       ├── T_Test.ubulk
│   │   │       ├── T_Test.uexp
│   │   │       ├── T_pl01_001_body_D.uasset
│   │   │       ├── T_pl01_001_body_D.uexp
│   │   │       ├── WBP_Hello.uasset
│   │   │       └── WBP_Hello.uexp
│   │   ├── TestUE5_6/
│   │   │   └── BpThirdPerson/
│   │   │       ├── BP_ThirdPersonCharacter.uasset
│   │   │       ├── BP_ThirdPersonCharacter.uexp
│   │   │       ├── ExplicitEnumValuesExample.usmap
│   │   │       ├── MI_Quinn_01.uasset
│   │   │       ├── MI_Quinn_01.uexp
│   │   │       ├── M_Mannequin.uasset
│   │   │       ├── M_Mannequin.uexp
│   │   │       ├── SKM_Quinn_Simple.uasset
│   │   │       ├── SKM_Quinn_Simple.uexp
│   │   │       ├── SM_Cube.uasset
│   │   │       ├── SM_Cube.ubulk
│   │   │       └── SM_Cube.uexp
│   │   └── TestUnknownProperties/
│   │       ├── BP_DetPack_Charge.uasset
│   │       └── BP_DetPack_Charge.uexp
│   └── UAssetAPI.Tests.csproj
├── UAssetAPI.sln
└── docs/
    ├── book.toml
    ├── correct_pages.py
    ├── correct_summary.py
    ├── css/
    │   └── custom.css
    ├── generate_docs.bat
    ├── generate_docs.sh
    └── src/
        ├── README.md
        ├── SUMMARY.md
        ├── SUMMARY_header.md
        ├── api/
        │   ├── uassetapi.ac7decrypt.md
        │   ├── uassetapi.ac7xorkey.md
        │   ├── uassetapi.assetbinaryreader.md
        │   ├── uassetapi.assetbinarywriter.md
        │   ├── uassetapi.crcgenerator.md
        │   ├── uassetapi.customserializationflags.md
        │   ├── uassetapi.customversion.md
        │   ├── uassetapi.customversions.fanimphysobjectversion.md
        │   ├── uassetapi.customversions.fassetregistryversion.md
        │   ├── uassetapi.customversions.fcoreobjectversion.md
        │   ├── uassetapi.customversions.feditorobjectversion.md
        │   ├── uassetapi.customversions.ffortnitemainbranchobjectversion.md
        │   ├── uassetapi.customversions.ffortnitereleasebranchcustomobjectversion.md
        │   ├── uassetapi.customversions.fframeworkobjectversion.md
        │   ├── uassetapi.customversions.fniagaracustomversion.md
        │   ├── uassetapi.customversions.fniagaraobjectversion.md
        │   ├── uassetapi.customversions.freleaseobjectversion.md
        │   ├── uassetapi.customversions.fsequencerobjectversion.md
        │   ├── uassetapi.customversions.fue5releasestreamobjectversion.md
        │   ├── uassetapi.customversions.introducedattribute.md
        │   ├── uassetapi.exporttypes.classexport.md
        │   ├── uassetapi.exporttypes.datatableexport.md
        │   ├── uassetapi.exporttypes.eclassserializationcontrolextension.md
        │   ├── uassetapi.exporttypes.ecppform.md
        │   ├── uassetapi.exporttypes.eexportfilterflags.md
        │   ├── uassetapi.exporttypes.enumexport.md
        │   ├── uassetapi.exporttypes.export.md
        │   ├── uassetapi.exporttypes.fieldexport.md
        │   ├── uassetapi.exporttypes.fstringtable.md
        │   ├── uassetapi.exporttypes.functionexport.md
        │   ├── uassetapi.exporttypes.furl.md
        │   ├── uassetapi.exporttypes.levelexport.md
        │   ├── uassetapi.exporttypes.metadataexport.md
        │   ├── uassetapi.exporttypes.normalexport.md
        │   ├── uassetapi.exporttypes.objectmetadataentry.md
        │   ├── uassetapi.exporttypes.propertyexport.md
        │   ├── uassetapi.exporttypes.rawexport.md
        │   ├── uassetapi.exporttypes.serializedinterfacereference.md
        │   ├── uassetapi.exporttypes.stringtableexport.md
        │   ├── uassetapi.exporttypes.structexport.md
        │   ├── uassetapi.exporttypes.udatatable.md
        │   ├── uassetapi.exporttypes.uenum.md
        │   ├── uassetapi.exporttypes.userdefinedstructexport.md
        │   ├── uassetapi.fengineversion.md
        │   ├── uassetapi.fgenerationinfo.md
        │   ├── uassetapi.fieldtypes.earraydim.md
        │   ├── uassetapi.fieldtypes.elifetimecondition.md
        │   ├── uassetapi.fieldtypes.farrayproperty.md
        │   ├── uassetapi.fieldtypes.fboolproperty.md
        │   ├── uassetapi.fieldtypes.fbyteproperty.md
        │   ├── uassetapi.fieldtypes.fclassproperty.md
        │   ├── uassetapi.fieldtypes.fdelegateproperty.md
        │   ├── uassetapi.fieldtypes.fenumproperty.md
        │   ├── uassetapi.fieldtypes.ffield.md
        │   ├── uassetapi.fieldtypes.fgenericproperty.md
        │   ├── uassetapi.fieldtypes.finterfaceproperty.md
        │   ├── uassetapi.fieldtypes.fmapproperty.md
        │   ├── uassetapi.fieldtypes.fmulticastdelegateproperty.md
        │   ├── uassetapi.fieldtypes.fmulticastinlinedelegateproperty.md
        │   ├── uassetapi.fieldtypes.fnumericproperty.md
        │   ├── uassetapi.fieldtypes.fobjectproperty.md
        │   ├── uassetapi.fieldtypes.foptionalproperty.md
        │   ├── uassetapi.fieldtypes.fproperty.md
        │   ├── uassetapi.fieldtypes.fsetproperty.md
        │   ├── uassetapi.fieldtypes.fsoftclassproperty.md
        │   ├── uassetapi.fieldtypes.fsoftobjectproperty.md
        │   ├── uassetapi.fieldtypes.fstructproperty.md
        │   ├── uassetapi.fieldtypes.fweakobjectproperty.md
        │   ├── uassetapi.fieldtypes.uarrayproperty.md
        │   ├── uassetapi.fieldtypes.uassetclassproperty.md
        │   ├── uassetapi.fieldtypes.uassetobjectproperty.md
        │   ├── uassetapi.fieldtypes.uboolproperty.md
        │   ├── uassetapi.fieldtypes.ubyteproperty.md
        │   ├── uassetapi.fieldtypes.uclassproperty.md
        │   ├── uassetapi.fieldtypes.udelegateproperty.md
        │   ├── uassetapi.fieldtypes.udoubleproperty.md
        │   ├── uassetapi.fieldtypes.uenumproperty.md
        │   ├── uassetapi.fieldtypes.ufield.md
        │   ├── uassetapi.fieldtypes.ufloatproperty.md
        │   ├── uassetapi.fieldtypes.ugenericproperty.md
        │   ├── uassetapi.fieldtypes.uint16property.md
        │   ├── uassetapi.fieldtypes.uint64property.md
        │   ├── uassetapi.fieldtypes.uint8property.md
        │   ├── uassetapi.fieldtypes.uinterfaceproperty.md
        │   ├── uassetapi.fieldtypes.uintproperty.md
        │   ├── uassetapi.fieldtypes.ulazyobjectproperty.md
        │   ├── uassetapi.fieldtypes.umapproperty.md
        │   ├── uassetapi.fieldtypes.umulticastdelegateproperty.md
        │   ├── uassetapi.fieldtypes.umulticastinlinedelegateproperty.md
        │   ├── uassetapi.fieldtypes.umulticastsparsedelegateproperty.md
        │   ├── uassetapi.fieldtypes.unameproperty.md
        │   ├── uassetapi.fieldtypes.unumericproperty.md
        │   ├── uassetapi.fieldtypes.uobjectproperty.md
        │   ├── uassetapi.fieldtypes.uproperty.md
        │   ├── uassetapi.fieldtypes.usetproperty.md
        │   ├── uassetapi.fieldtypes.usoftclassproperty.md
        │   ├── uassetapi.fieldtypes.usoftobjectproperty.md
        │   ├── uassetapi.fieldtypes.ustrproperty.md
        │   ├── uassetapi.fieldtypes.ustructproperty.md
        │   ├── uassetapi.fieldtypes.utextproperty.md
        │   ├── uassetapi.fieldtypes.uuint16property.md
        │   ├── uassetapi.fieldtypes.uuint32property.md
        │   ├── uassetapi.fieldtypes.uuint64property.md
        │   ├── uassetapi.fieldtypes.uweakobjectproperty.md
        │   ├── uassetapi.import.md
        │   ├── uassetapi.inamemap.md
        │   ├── uassetapi.invalidmappingsexception.md
        │   ├── uassetapi.json.bytearrayjsonconverter.md
        │   ├── uassetapi.json.fnamejsonconverter.md
        │   ├── uassetapi.json.fpackageindexjsonconverter.md
        │   ├── uassetapi.json.fsignedzerojsonconverter.md
        │   ├── uassetapi.json.fstringjsonconverter.md
        │   ├── uassetapi.json.fstringtablejsonconverter.md
        │   ├── uassetapi.json.guidjsonconverter.md
        │   ├── uassetapi.json.tmapjsonconverter-2.md
        │   ├── uassetapi.json.uassetcontractresolver.md
        │   ├── uassetapi.kismet.bytecode.eblueprinttextliteraltype.md
        │   ├── uassetapi.kismet.bytecode.ecasttoken.md
        │   ├── uassetapi.kismet.bytecode.eexprtoken.md
        │   ├── uassetapi.kismet.bytecode.escriptinstrumentationtype.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_addmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_arrayconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_arraygetbyref.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_assert.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_binddelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_bitfieldconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_breakpoint.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_byteconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_callmath.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_callmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_castbase.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_classcontext.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_classsparsedatavariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_clearmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_computedjump.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_context.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_context_failsilent.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_crossinterfacecast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_defaultvariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_deprecatedop4a.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_doubleconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_dynamiccast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endarray.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endarrayconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endfunctionparms.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endmap.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endmapconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endofscript.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endparmvalue.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endset.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endsetconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endstructconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_false.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_fieldpathconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_finalfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_floatconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_instancedelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_instancevariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_instrumentationevent.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_int64const.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intconstbyte.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_interfacecontext.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_interfacetoobjcast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intone.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intzero.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_jump.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_jumpifnot.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_let.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letbase.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letbool.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letobj.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letvalueonpersistentframe.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letweakobjptr.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localfinalfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localoutvariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localvariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localvirtualfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_mapconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_metacast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nameconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nointerface.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_noobject.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nothing.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nothingint32.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_objectconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_objtointerfacecast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_popexecutionflow.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_popexecutionflowifnot.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_primitivecast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_propertyconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_pushexecutionflow.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_removemulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_return.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_rotationconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_self.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setarray.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setmap.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setset.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_skip.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_skipoffsetconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_softobjectconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_stringconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_structconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_structmembercontext.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_switchvalue.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_textconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_tracepoint.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_transformconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_true.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_uint64const.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_unicodestringconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_variablebase.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_vector3fconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_vectorconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_virtualfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_wiretracepoint.md
        │   ├── uassetapi.kismet.bytecode.expressions.fkismetswitchcase.md
        │   ├── uassetapi.kismet.bytecode.expressionserializer.md
        │   ├── uassetapi.kismet.bytecode.fscripttext.md
        │   ├── uassetapi.kismet.bytecode.kismetexpression-1.md
        │   ├── uassetapi.kismet.bytecode.kismetexpression.md
        │   ├── uassetapi.kismet.bytecode.kismetpropertypointer.md
        │   ├── uassetapi.kismet.kismetserializer.md
        │   ├── uassetapi.mainserializer.md
        │   ├── uassetapi.namemapoutofrangeexception.md
        │   ├── uassetapi.pakbuilder.md
        │   ├── uassetapi.pakcompression.md
        │   ├── uassetapi.pakreader.md
        │   ├── uassetapi.pakversion.md
        │   ├── uassetapi.pakwriter.md
        │   ├── uassetapi.propertytypes.objects.ancestryinfo.md
        │   ├── uassetapi.propertytypes.objects.arraypropertydata.md
        │   ├── uassetapi.propertytypes.objects.assetobjectpropertydata.md
        │   ├── uassetapi.propertytypes.objects.boolpropertydata.md
        │   ├── uassetapi.propertytypes.objects.bytepropertydata.md
        │   ├── uassetapi.propertytypes.objects.bytepropertytype.md
        │   ├── uassetapi.propertytypes.objects.delegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.doublepropertydata.md
        │   ├── uassetapi.propertytypes.objects.enumpropertydata.md
        │   ├── uassetapi.propertytypes.objects.eoverriddenpropertyoperation.md
        │   ├── uassetapi.propertytypes.objects.epropertytagextension.md
        │   ├── uassetapi.propertytypes.objects.epropertytagflags.md
        │   ├── uassetapi.propertytypes.objects.etextflag.md
        │   ├── uassetapi.propertytypes.objects.etransformtype.md
        │   ├── uassetapi.propertytypes.objects.fdelegate.md
        │   ├── uassetapi.propertytypes.objects.fformatargumentdata.md
        │   ├── uassetapi.propertytypes.objects.fformatargumentvalue.md
        │   ├── uassetapi.propertytypes.objects.fieldpathpropertydata.md
        │   ├── uassetapi.propertytypes.objects.floatpropertydata.md
        │   ├── uassetapi.propertytypes.objects.fnumberformattingoptions.md
        │   ├── uassetapi.propertytypes.objects.fsoftobjectpath.md
        │   ├── uassetapi.propertytypes.objects.ftoplevelassetpath.md
        │   ├── uassetapi.propertytypes.objects.int16propertydata.md
        │   ├── uassetapi.propertytypes.objects.int64propertydata.md
        │   ├── uassetapi.propertytypes.objects.int8propertydata.md
        │   ├── uassetapi.propertytypes.objects.interfacepropertydata.md
        │   ├── uassetapi.propertytypes.objects.intpropertydata.md
        │   ├── uassetapi.propertytypes.objects.istruct-1.md
        │   ├── uassetapi.propertytypes.objects.mappropertydata.md
        │   ├── uassetapi.propertytypes.objects.multicastdelegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.multicastinlinedelegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.multicastsparsedelegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.namepropertydata.md
        │   ├── uassetapi.propertytypes.objects.objectpropertydata.md
        │   ├── uassetapi.propertytypes.objects.propertydata-1.md
        │   ├── uassetapi.propertytypes.objects.propertydata.md
        │   ├── uassetapi.propertytypes.objects.propertyserializationcontext.md
        │   ├── uassetapi.propertytypes.objects.setpropertydata.md
        │   ├── uassetapi.propertytypes.objects.softobjectpropertydata.md
        │   ├── uassetapi.propertytypes.objects.strpropertydata.md
        │   ├── uassetapi.propertytypes.objects.texthistorytype.md
        │   ├── uassetapi.propertytypes.objects.textpropertydata.md
        │   ├── uassetapi.propertytypes.objects.uint16propertydata.md
        │   ├── uassetapi.propertytypes.objects.uint32propertydata.md
        │   ├── uassetapi.propertytypes.objects.uint64propertydata.md
        │   ├── uassetapi.propertytypes.objects.unknownpropertydata.md
        │   ├── uassetapi.propertytypes.objects.weakobjectpropertydata.md
        │   ├── uassetapi.propertytypes.structs.box2dpropertydata.md
        │   ├── uassetapi.propertytypes.structs.box2fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.boxpropertydata.md
        │   ├── uassetapi.propertytypes.structs.clothloddatacommonpropertydata.md
        │   ├── uassetapi.propertytypes.structs.clothloddatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.clothtetherdatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.colormaterialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.colorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.datetimepropertydata.md
        │   ├── uassetapi.propertytypes.structs.deprecateslatevector2dpropertydata.md
        │   ├── uassetapi.propertytypes.structs.esectionevaluationflags.md
        │   ├── uassetapi.propertytypes.structs.expressioninputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.fentityandmetadataindex.md
        │   ├── uassetapi.propertytypes.structs.fentry.md
        │   ├── uassetapi.propertytypes.structs.fevaluationtreeentryhandle.md
        │   ├── uassetapi.propertytypes.structs.flevelsequencelegacyobjectreference.md
        │   ├── uassetapi.propertytypes.structs.floatrangepropertydata.md
        │   ├── uassetapi.propertytypes.structs.fmeshtomeshvertdata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenechannel-1.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenedoublechannel.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenedoublevalue.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationfieldentitytree.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationkey.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationtree.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationtreenode.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationtreenodehandle.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneeventparameters.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenefloatchannel.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenefloatvalue.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesegment.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsectiondata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsectionfielddata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsequencetree.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsequencetreeentry.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenetangentdata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenetrackfielddata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenevalue-1.md
        │   ├── uassetapi.propertytypes.structs.fnamecurvekey.md
        │   ├── uassetapi.propertytypes.structs.fnavagentselector.md
        │   ├── uassetapi.propertytypes.structs.fontcharacterpropertydata.md
        │   ├── uassetapi.propertytypes.structs.fontdatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.framenumberpropertydata.md
        │   ├── uassetapi.propertytypes.structs.fsectionevaluationdatatree.md
        │   ├── uassetapi.propertytypes.structs.fstringcurvekey.md
        │   ├── uassetapi.propertytypes.structs.gameplaytagcontainerpropertydata.md
        │   ├── uassetapi.propertytypes.structs.guidpropertydata.md
        │   ├── uassetapi.propertytypes.structs.intpointpropertydata.md
        │   ├── uassetapi.propertytypes.structs.intvector2propertydata.md
        │   ├── uassetapi.propertytypes.structs.intvectorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.keyhandlemappropertydata.md
        │   ├── uassetapi.propertytypes.structs.levelsequenceobjectreferencemappropertydata.md
        │   ├── uassetapi.propertytypes.structs.linearcolorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.materialattributesinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.materialoverridenanitepropertydata.md
        │   ├── uassetapi.propertytypes.structs.matrixpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenedoublechannelpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneevaltemplateptrpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneevaluationfieldentitytreepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneevaluationkeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneeventparameterspropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenefloatchannelpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenefloatvaluepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneframerangepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenegenerationledgerpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesegmentidentifierpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesegmentpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesequenceidpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesequenceinstancedataptrpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesubsectionfielddatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesubsequencetreepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetemplatepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetrackfielddatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetrackidentifierpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetrackimplementationptrpropertydata.md
        │   ├── uassetapi.propertytypes.structs.namecurvekeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.navagentselectorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaradatachannelvariablepropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaradatainterfacegpuparaminfopropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaravariablebasepropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaravariablepropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaravariablewithoffsetpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformboolpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformfloatpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformframeratepropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformintpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perqualitylevelfloatpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perqualitylevelintpropertydata.md
        │   ├── uassetapi.propertytypes.structs.planepropertydata.md
        │   ├── uassetapi.propertytypes.structs.quatpropertydata.md
        │   ├── uassetapi.propertytypes.structs.rawstructpropertydata.md
        │   ├── uassetapi.propertytypes.structs.richcurvekeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.rotatorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.scalarmaterialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.sectionevaluationdatatreepropertydata.md
        │   ├── uassetapi.propertytypes.structs.skeletalmeshareaweightedtrianglesamplerpropertydata.md
        │   ├── uassetapi.propertytypes.structs.skeletalmeshsamplinglodbuiltdatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.smartnamepropertydata.md
        │   ├── uassetapi.propertytypes.structs.softassetpathpropertydata.md
        │   ├── uassetapi.propertytypes.structs.softclasspathpropertydata.md
        │   ├── uassetapi.propertytypes.structs.softobjectpathpropertydata.md
        │   ├── uassetapi.propertytypes.structs.stringassetreferencepropertydata.md
        │   ├── uassetapi.propertytypes.structs.stringclassreferencepropertydata.md
        │   ├── uassetapi.propertytypes.structs.stringcurvekeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.structpropertydata.md
        │   ├── uassetapi.propertytypes.structs.tevaluationtreeentrycontainer-1.md
        │   ├── uassetapi.propertytypes.structs.timespanpropertydata.md
        │   ├── uassetapi.propertytypes.structs.tmoviesceneevaluationtree-1.md
        │   ├── uassetapi.propertytypes.structs.twovectorspropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector2dpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector2fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector2materialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector3fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector4fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector4propertydata.md
        │   ├── uassetapi.propertytypes.structs.vectormaterialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantize100propertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantize10propertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantizenormalpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantizepropertydata.md
        │   ├── uassetapi.propertytypes.structs.vectorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.viewtargetblendfunction.md
        │   ├── uassetapi.propertytypes.structs.viewtargetblendparamspropertydata.md
        │   ├── uassetapi.propertytypes.structs.weightedrandomsamplerpropertydata.md
        │   ├── uassetapi.repakinterop.md
        │   ├── uassetapi.streamcallbacks.md
        │   ├── uassetapi.structtypes.skeletalmeshsamplingregionbuiltdatapropertydata.md
        │   ├── uassetapi.uaputils.md
        │   ├── uassetapi.uasset.md
        │   ├── uassetapi.unknownengineversionexception.md
        │   ├── uassetapi.unrealbinaryreader.md
        │   ├── uassetapi.unrealbinarywriter.md
        │   ├── uassetapi.unrealtypes.comparer2-1.md
        │   ├── uassetapi.unrealtypes.dictionaryenumerator-2.md
        │   ├── uassetapi.unrealtypes.eaxis.md
        │   ├── uassetapi.unrealtypes.eclassflags.md
        │   ├── uassetapi.unrealtypes.efonthinting.md
        │   ├── uassetapi.unrealtypes.efontloadingpolicy.md
        │   ├── uassetapi.unrealtypes.efunctionflags.md
        │   ├── uassetapi.unrealtypes.einterpcurvemode.md
        │   ├── uassetapi.unrealtypes.emappednametype.md
        │   ├── uassetapi.unrealtypes.engineenums.animationcompressionformat.md
        │   ├── uassetapi.unrealtypes.engineenums.animationkeyformat.md
        │   ├── uassetapi.unrealtypes.engineenums.animphyscollisiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.animphystwistaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.beam2sourcetargetmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.beam2sourcetargettangentmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.beammodifiertype.md
        │   ├── uassetapi.unrealtypes.engineenums.cylinderheightaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.distributionparammode.md
        │   ├── uassetapi.unrealtypes.engineenums.eactorupdateoverlapsmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eadditiveanimationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eadditivebaseposetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eadmanagerdelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.eairabsorptionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.ealphablendoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ealphachannelmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eangularconstraintmotion.md
        │   ├── uassetapi.unrealtypes.engineenums.eangulardrivemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimalphainputtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimassetcurveflags.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimcurvetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimgrouprole.md
        │   ├── uassetapi.unrealtypes.engineenums.eaniminterpolationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimlinkmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimnotifyeventtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eantialiasingmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eapplicationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.easpectratioaxisconstraint.md
        │   ├── uassetapi.unrealtypes.engineenums.eattachlocation.md
        │   ├── uassetapi.unrealtypes.engineenums.eattachmentrule.md
        │   ├── uassetapi.unrealtypes.engineenums.eattenuationdistancemodel.md
        │   ├── uassetapi.unrealtypes.engineenums.eattenuationshape.md
        │   ├── uassetapi.unrealtypes.engineenums.eattractorparticleselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiocomponentplaystate.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiofadercurve.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiooutputtarget.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiorecordingexporttype.md
        │   ├── uassetapi.unrealtypes.engineenums.eautoexposuremethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eautoexposuremethodui.md
        │   ├── uassetapi.unrealtypes.engineenums.eautopossessai.md
        │   ├── uassetapi.unrealtypes.engineenums.eautoreceiveinput.md
        │   ├── uassetapi.unrealtypes.engineenums.eaxisoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ebeam2method.md
        │   ├── uassetapi.unrealtypes.engineenums.ebeamtapermethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eblendablelocation.md
        │   ├── uassetapi.unrealtypes.engineenums.eblendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eblendspaceaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.ebloommethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintcompilemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintnativizationflag.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintpinstyletype.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintstatus.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprinttype.md
        │   ├── uassetapi.unrealtypes.engineenums.ebodycollisionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.eboneaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonecontrolspace.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonefilteractionoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonerotationsource.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonespaces.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonetranslationretargetingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonevisibilitystatus.md
        │   ├── uassetapi.unrealtypes.engineenums.ebrushtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecameraalphablendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecameraanimplayspace.md
        │   ├── uassetapi.unrealtypes.engineenums.ecameraprojectionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecamerashakeattenuation.md
        │   ├── uassetapi.unrealtypes.engineenums.ecanbecharacterbase.md
        │   ├── uassetapi.unrealtypes.engineenums.ecancreateconnectionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.echannelmaskparametercolor.md
        │   ├── uassetapi.unrealtypes.engineenums.eclampmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eclearsceneoptions.md
        │   ├── uassetapi.unrealtypes.engineenums.eclothmassmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecloudstoragedelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisionchannel.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisionenabled.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisiontraceflag.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponentcreationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponentmobility.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponentsockettype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponenttype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecompositetexturemode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecompositingsamplecount.md
        │   ├── uassetapi.unrealtypes.engineenums.econstraintframe.md
        │   ├── uassetapi.unrealtypes.engineenums.econstrainttransform.md
        │   ├── uassetapi.unrealtypes.engineenums.econtrolconstraint.md
        │   ├── uassetapi.unrealtypes.engineenums.econtrolleranalogstick.md
        │   ├── uassetapi.unrealtypes.engineenums.ecopytype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecsgoper.md
        │   ├── uassetapi.unrealtypes.engineenums.ecurveblendoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ecurvetablemode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecustomdepthstencil.md
        │   ├── uassetapi.unrealtypes.engineenums.ecustommaterialoutputtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecustomtimestepsynchronizationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.edecalblendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.edecompressiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.edefaultbackbufferpixelformat.md
        │   ├── uassetapi.unrealtypes.engineenums.edemoplayfailure.md
        │   ├── uassetapi.unrealtypes.engineenums.edepthoffieldfunctionvalue.md
        │   ├── uassetapi.unrealtypes.engineenums.edepthoffieldmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.edetachmentrule.md
        │   ├── uassetapi.unrealtypes.engineenums.edetailmode.md
        │   ├── uassetapi.unrealtypes.engineenums.edistributionvectorlockflags.md
        │   ├── uassetapi.unrealtypes.engineenums.edistributionvectormirrorflags.md
        │   ├── uassetapi.unrealtypes.engineenums.edofmode.md
        │   ├── uassetapi.unrealtypes.engineenums.edrawdebugitemtype.md
        │   ├── uassetapi.unrealtypes.engineenums.edrawdebugtrace.md
        │   ├── uassetapi.unrealtypes.engineenums.edynamicforcefeedbackaction.md
        │   ├── uassetapi.unrealtypes.engineenums.eearlyzpass.md
        │   ├── uassetapi.unrealtypes.engineenums.eeasingfunc.md
        │   ├── uassetapi.unrealtypes.engineenums.eedgraphpindirection.md
        │   ├── uassetapi.unrealtypes.engineenums.eemitterdynamicparametervalue.md
        │   ├── uassetapi.unrealtypes.engineenums.eemitternormalsmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eemitterrendermode.md
        │   ├── uassetapi.unrealtypes.engineenums.eendplayreason.md
        │   ├── uassetapi.unrealtypes.engineenums.eevaluatecurvetableresult.md
        │   ├── uassetapi.unrealtypes.engineenums.eevaluatordatasource.md
        │   ├── uassetapi.unrealtypes.engineenums.eevaluatormode.md
        │   ├── uassetapi.unrealtypes.engineenums.efastarrayserializerdeltaflags.md
        │   ├── uassetapi.unrealtypes.engineenums.efilterinterpolationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.efontcachetype.md
        │   ├── uassetapi.unrealtypes.engineenums.efontimportcharacterset.md
        │   ├── uassetapi.unrealtypes.engineenums.eformatargumenttype.md
        │   ├── uassetapi.unrealtypes.engineenums.efrictioncombinemode.md
        │   ├── uassetapi.unrealtypes.engineenums.efullyloadpackagetype.md
        │   ├── uassetapi.unrealtypes.engineenums.efunctioninputtype.md
        │   ├── uassetapi.unrealtypes.engineenums.egbufferformat.md
        │   ├── uassetapi.unrealtypes.engineenums.egrammaticalgender.md
        │   ├── uassetapi.unrealtypes.engineenums.egrammaticalnumber.md
        │   ├── uassetapi.unrealtypes.engineenums.egraphaxisstyle.md
        │   ├── uassetapi.unrealtypes.engineenums.egraphdatastyle.md
        │   ├── uassetapi.unrealtypes.engineenums.egraphtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ehascustomnavigablegeometry.md
        │   ├── uassetapi.unrealtypes.engineenums.ehitproxypriority.md
        │   ├── uassetapi.unrealtypes.engineenums.ehoriztextaligment.md
        │   ├── uassetapi.unrealtypes.engineenums.eimportancelevel.md
        │   ├── uassetapi.unrealtypes.engineenums.eimportanceweight.md
        │   ├── uassetapi.unrealtypes.engineenums.eindirectlightingcachequality.md
        │   ├── uassetapi.unrealtypes.engineenums.einertializationbonestate.md
        │   ├── uassetapi.unrealtypes.engineenums.einertializationspace.md
        │   ├── uassetapi.unrealtypes.engineenums.einertializationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.einitialoscillatoroffset.md
        │   ├── uassetapi.unrealtypes.engineenums.einputevent.md
        │   ├── uassetapi.unrealtypes.engineenums.einterpmoveaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.einterptobehaviourtype.md
        │   ├── uassetapi.unrealtypes.engineenums.einterptrackmoverotmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ekinematicbonesupdatetophysics.md
        │   ├── uassetapi.unrealtypes.engineenums.elandscapecullingprecision.md
        │   ├── uassetapi.unrealtypes.engineenums.elegendposition.md
        │   ├── uassetapi.unrealtypes.engineenums.elerpinterpolationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.elightingbuildquality.md
        │   ├── uassetapi.unrealtypes.engineenums.elightmappaddingtype.md
        │   ├── uassetapi.unrealtypes.engineenums.elightmaptype.md
        │   ├── uassetapi.unrealtypes.engineenums.elightunits.md
        │   ├── uassetapi.unrealtypes.engineenums.elinearconstraintmotion.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationbonesocketselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationbonesocketsource.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationemitterselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationskelvertsurfacesource.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialattributeblend.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialdecalresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialdomain.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialexposedtextureproperty.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialexposedviewproperty.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialfunctionusage.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialmergetype.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialparameterassociation.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialpositiontransformsource.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialproperty.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialsamplertype.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialsceneattributeinputmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialshadingmodel.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialstencilcompare.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialtessellationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialusage.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialvectorcoordtransform.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialvectorcoordtransformsource.md
        │   ├── uassetapi.unrealtypes.engineenums.ematrixcolumns.md
        │   ├── uassetapi.unrealtypes.engineenums.emaxconcurrentresolutionrule.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshbufferaccess.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshcamerafacingoptions.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshcamerafacingupaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshfeatureimportance.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshinstancingreplacementmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshlodselectiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshmergetype.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshscreenalignment.md
        │   ├── uassetapi.unrealtypes.engineenums.emicrotransactiondelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.emicrotransactionresult.md
        │   ├── uassetapi.unrealtypes.engineenums.emobilemsaasamplecount.md
        │   ├── uassetapi.unrealtypes.engineenums.emoduletype.md
        │   ├── uassetapi.unrealtypes.engineenums.emonochannelupmixmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.emontagenotifyticktype.md
        │   ├── uassetapi.unrealtypes.engineenums.emontageplayreturntype.md
        │   ├── uassetapi.unrealtypes.engineenums.emontagesubstepresult.md
        │   ├── uassetapi.unrealtypes.engineenums.emousecapturemode.md
        │   ├── uassetapi.unrealtypes.engineenums.emouselockmode.md
        │   ├── uassetapi.unrealtypes.engineenums.emovecomponentaction.md
        │   ├── uassetapi.unrealtypes.engineenums.emovementmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enaturalsoundfalloffmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enavdatagatheringmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enavdatagatheringmodeconfig.md
        │   ├── uassetapi.unrealtypes.engineenums.enavigationoptionflag.md
        │   ├── uassetapi.unrealtypes.engineenums.enavigationqueryresult.md
        │   ├── uassetapi.unrealtypes.engineenums.enavlinkdirection.md
        │   ├── uassetapi.unrealtypes.engineenums.enavpathevent.md
        │   ├── uassetapi.unrealtypes.engineenums.enetdormancy.md
        │   ├── uassetapi.unrealtypes.engineenums.enetrole.md
        │   ├── uassetapi.unrealtypes.engineenums.enetworkfailure.md
        │   ├── uassetapi.unrealtypes.engineenums.enetworklagstate.md
        │   ├── uassetapi.unrealtypes.engineenums.enetworksmoothingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enodeadvancedpins.md
        │   ├── uassetapi.unrealtypes.engineenums.enodeenabledstate.md
        │   ├── uassetapi.unrealtypes.engineenums.enodetitletype.md
        │   ├── uassetapi.unrealtypes.engineenums.enoisefunction.md
        │   ├── uassetapi.unrealtypes.engineenums.enormalmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enotifyfiltertype.md
        │   ├── uassetapi.unrealtypes.engineenums.enotifytriggermode.md
        │   ├── uassetapi.unrealtypes.engineenums.eobjecttypequery.md
        │   ├── uassetapi.unrealtypes.engineenums.eocclusioncombinemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eopacitysourcemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eoptimizationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eorbitchainmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eoscillatorwaveform.md
        │   ├── uassetapi.unrealtypes.engineenums.eoverlapfilteroption.md
        │   ├── uassetapi.unrealtypes.engineenums.epanningmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleaxislock.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleburstmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecameraoffsetupdatemethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecollisioncomplete.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecollisionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecollisionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticledetailmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleeventtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlescreenalignment.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesignificancelevel.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesortmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesourceselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesubuvinterpmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesysparamtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesysteminsignificancereaction.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesystemocclusionboundsmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesystemupdatemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleuvflipmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysbodyop.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicalmaterialmaskcolor.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicalsurface.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicstransformupdatemode.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicstype.md
        │   ├── uassetapi.unrealtypes.engineenums.epincontainertype.md
        │   ├── uassetapi.unrealtypes.engineenums.epinhidingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eplaneconstraintaxissetting.md
        │   ├── uassetapi.unrealtypes.engineenums.eplatforminterfacedatatype.md
        │   ├── uassetapi.unrealtypes.engineenums.epostcopyoperation.md
        │   ├── uassetapi.unrealtypes.engineenums.epreviewanimationblueprintapplicationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eprimaryassetcookrule.md
        │   ├── uassetapi.unrealtypes.engineenums.epriorityattenuationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eproxynormalcomputationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.epscpoolmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.equitpreference.md
        │   ├── uassetapi.unrealtypes.engineenums.eradialimpulsefalloff.md
        │   ├── uassetapi.unrealtypes.engineenums.erawcurvetracktypes.md
        │   ├── uassetapi.unrealtypes.engineenums.eraytracingglobalilluminationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ereflectedandrefractedraytracedshadows.md
        │   ├── uassetapi.unrealtypes.engineenums.ereflectionsourcetype.md
        │   ├── uassetapi.unrealtypes.engineenums.ereflectionstype.md
        │   ├── uassetapi.unrealtypes.engineenums.erefractionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erelativetransformspace.md
        │   ├── uassetapi.unrealtypes.engineenums.erendererstencilmask.md
        │   ├── uassetapi.unrealtypes.engineenums.erenderfocusrule.md
        │   ├── uassetapi.unrealtypes.engineenums.ereporterlinestyle.md
        │   ├── uassetapi.unrealtypes.engineenums.ereverbsendmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvecompressionformat.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurveextrapolation.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurveinterpmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvekeytimecompressionformat.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvetangentmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvetangentweightmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionaccumulatemode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionfinishvelocitymode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionrootlock.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionsourcesettingsflags.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionsourcestatusflags.md
        │   ├── uassetapi.unrealtypes.engineenums.erotatorquantization.md
        │   ├── uassetapi.unrealtypes.engineenums.eroundingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eruntimevirtualtexturemainpasstype.md
        │   ├── uassetapi.unrealtypes.engineenums.eruntimevirtualtexturematerialtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eruntimevirtualtexturemipvaluemode.md
        │   ├── uassetapi.unrealtypes.engineenums.esamplersourcemode.md
        │   ├── uassetapi.unrealtypes.engineenums.escenecapturecompositemode.md
        │   ├── uassetapi.unrealtypes.engineenums.escenecaptureprimitiverendermode.md
        │   ├── uassetapi.unrealtypes.engineenums.escenecapturesource.md
        │   ├── uassetapi.unrealtypes.engineenums.escenedepthprioritygroup.md
        │   ├── uassetapi.unrealtypes.engineenums.escenetextureid.md
        │   ├── uassetapi.unrealtypes.engineenums.escreenorientation.md
        │   ├── uassetapi.unrealtypes.engineenums.esendlevelcontrolmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.esettingsdof.md
        │   ├── uassetapi.unrealtypes.engineenums.esettingslockedaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.eshadowmapflags.md
        │   ├── uassetapi.unrealtypes.engineenums.eskeletalmeshgeoimportversions.md
        │   ├── uassetapi.unrealtypes.engineenums.eskeletalmeshskinningimportversions.md
        │   ├── uassetapi.unrealtypes.engineenums.eskincachedefaultbehavior.md
        │   ├── uassetapi.unrealtypes.engineenums.eskincacheusage.md
        │   ├── uassetapi.unrealtypes.engineenums.eskyatmospheretransformmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eskylightsourcetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eslategesture.md
        │   ├── uassetapi.unrealtypes.engineenums.esleepfamily.md
        │   ├── uassetapi.unrealtypes.engineenums.esounddistancecalc.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundgroup.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundspatializationalgorithm.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundwavefftsize.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundwaveloadingbehavior.md
        │   ├── uassetapi.unrealtypes.engineenums.esourcebuschannels.md
        │   ├── uassetapi.unrealtypes.engineenums.esourcebussendlevelcontrolmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.espawnactorcollisionhandlingmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.espeedtreegeometrytype.md
        │   ├── uassetapi.unrealtypes.engineenums.espeedtreelodtype.md
        │   ├── uassetapi.unrealtypes.engineenums.espeedtreewindtype.md
        │   ├── uassetapi.unrealtypes.engineenums.esplinecoordinatespace.md
        │   ├── uassetapi.unrealtypes.engineenums.esplinemeshaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.esplinepointtype.md
        │   ├── uassetapi.unrealtypes.engineenums.estandbytype.md
        │   ├── uassetapi.unrealtypes.engineenums.estaticmeshreductionterimationcriterion.md
        │   ├── uassetapi.unrealtypes.engineenums.estereolayershape.md
        │   ├── uassetapi.unrealtypes.engineenums.estereolayertype.md
        │   ├── uassetapi.unrealtypes.engineenums.estreamingvolumeusage.md
        │   ├── uassetapi.unrealtypes.engineenums.esubmixsendmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.esubuvboundingvertexcount.md
        │   ├── uassetapi.unrealtypes.engineenums.esuggestprojvelocitytraceoption.md
        │   ├── uassetapi.unrealtypes.engineenums.eteleporttype.md
        │   ├── uassetapi.unrealtypes.engineenums.etemperatureseveritytype.md
        │   ├── uassetapi.unrealtypes.engineenums.etextgender.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturecolorchannel.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturecompressionquality.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturelossycompressionamount.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturemipcount.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturemiploadoptions.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturemipvaluemode.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturepoweroftwosetting.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturerendertargetformat.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesamplerfilter.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesizingtype.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesourcearttype.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesourceformat.md
        │   ├── uassetapi.unrealtypes.engineenums.etickinggroup.md
        │   ├── uassetapi.unrealtypes.engineenums.etimecodeprovidersynchronizationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.etimelinedirection.md
        │   ├── uassetapi.unrealtypes.engineenums.etimelinelengthmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etimelinesigtype.md
        │   ├── uassetapi.unrealtypes.engineenums.etimestretchcurvemapping.md
        │   ├── uassetapi.unrealtypes.engineenums.etracetypequery.md
        │   ├── uassetapi.unrealtypes.engineenums.etrackactivecondition.md
        │   ├── uassetapi.unrealtypes.engineenums.etracktoggleaction.md
        │   ├── uassetapi.unrealtypes.engineenums.etrail2sourcemethod.md
        │   ├── uassetapi.unrealtypes.engineenums.etrailsrenderaxisoption.md
        │   ├── uassetapi.unrealtypes.engineenums.etrailwidthmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etransitionblendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etransitionlogictype.md
        │   ├── uassetapi.unrealtypes.engineenums.etransitiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.etranslucencylightingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etranslucencytype.md
        │   ├── uassetapi.unrealtypes.engineenums.etranslucentsortpolicy.md
        │   ├── uassetapi.unrealtypes.engineenums.etravelfailure.md
        │   ├── uassetapi.unrealtypes.engineenums.etraveltype.md
        │   ├── uassetapi.unrealtypes.engineenums.etwitterintegrationdelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.etwitterrequestmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.etypeadvanceanim.md
        │   ├── uassetapi.unrealtypes.engineenums.euiscalingrule.md
        │   ├── uassetapi.unrealtypes.engineenums.eupdaterateshiftbucket.md
        │   ├── uassetapi.unrealtypes.engineenums.euserdefinedstructurestatus.md
        │   ├── uassetapi.unrealtypes.engineenums.euvoutput.md
        │   ├── uassetapi.unrealtypes.engineenums.evectorfieldconstructionop.md
        │   ├── uassetapi.unrealtypes.engineenums.evectornoisefunction.md
        │   ├── uassetapi.unrealtypes.engineenums.evectorquantization.md
        │   ├── uassetapi.unrealtypes.engineenums.evertexpaintaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.everticaltextaligment.md
        │   ├── uassetapi.unrealtypes.engineenums.eviewmodeindex.md
        │   ├── uassetapi.unrealtypes.engineenums.eviewtargetblendfunction.md
        │   ├── uassetapi.unrealtypes.engineenums.evirtualizationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilityaggressiveness.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilitybasedanimtickoption.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilitytrackaction.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilitytrackcondition.md
        │   ├── uassetapi.unrealtypes.engineenums.evoicesamplerate.md
        │   ├── uassetapi.unrealtypes.engineenums.evolumelightingmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.ewalkableslopebehavior.md
        │   ├── uassetapi.unrealtypes.engineenums.ewindowmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ewindowtitlebarmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ewindsourcetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eworldpositionincludedoffsets.md
        │   ├── uassetapi.unrealtypes.engineenums.fnavigationsystemrunmode.md
        │   ├── uassetapi.unrealtypes.engineenums.modulationparammode.md
        │   ├── uassetapi.unrealtypes.engineenums.particlereplaystate.md
        │   ├── uassetapi.unrealtypes.engineenums.particlesystemlodmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.reverbpreset.md
        │   ├── uassetapi.unrealtypes.engineenums.skeletalmeshoptimizationimportance.md
        │   ├── uassetapi.unrealtypes.engineenums.skeletalmeshoptimizationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.skeletalmeshterminationcriterion.md
        │   ├── uassetapi.unrealtypes.engineenums.textureaddress.md
        │   ├── uassetapi.unrealtypes.engineenums.texturecompressionsettings.md
        │   ├── uassetapi.unrealtypes.engineenums.texturefilter.md
        │   ├── uassetapi.unrealtypes.engineenums.texturegroup.md
        │   ├── uassetapi.unrealtypes.engineenums.texturemipgensettings.md
        │   ├── uassetapi.unrealtypes.engineversion.md
        │   ├── uassetapi.unrealtypes.eobjectdataresourceflags.md
        │   ├── uassetapi.unrealtypes.eobjectdataresourceversion.md
        │   ├── uassetapi.unrealtypes.eobjectflags.md
        │   ├── uassetapi.unrealtypes.epackageflags.md
        │   ├── uassetapi.unrealtypes.epropertyflags.md
        │   ├── uassetapi.unrealtypes.erangeboundtypes.md
        │   ├── uassetapi.unrealtypes.ffieldpath.md
        │   ├── uassetapi.unrealtypes.ffontcharacter.md
        │   ├── uassetapi.unrealtypes.ffontdata.md
        │   ├── uassetapi.unrealtypes.fframenumber.md
        │   ├── uassetapi.unrealtypes.fframerate.md
        │   ├── uassetapi.unrealtypes.fframetime.md
        │   ├── uassetapi.unrealtypes.fgatherabletextdata.md
        │   ├── uassetapi.unrealtypes.fintvector.md
        │   ├── uassetapi.unrealtypes.fintvector2.md
        │   ├── uassetapi.unrealtypes.flinearcolor.md
        │   ├── uassetapi.unrealtypes.flocmetadataobject.md
        │   ├── uassetapi.unrealtypes.fmatrix.md
        │   ├── uassetapi.unrealtypes.fname.md
        │   ├── uassetapi.unrealtypes.fniagaradatainterfacegeneratedfunction.md
        │   ├── uassetapi.unrealtypes.fniagaradatainterfacegpuparaminfo.md
        │   ├── uassetapi.unrealtypes.fniagaravariablecommonreference.md
        │   ├── uassetapi.unrealtypes.fobjectdataresource.md
        │   ├── uassetapi.unrealtypes.fobjectthumbnail.md
        │   ├── uassetapi.unrealtypes.fpackageindex.md
        │   ├── uassetapi.unrealtypes.fplane.md
        │   ├── uassetapi.unrealtypes.fpropertytypename.md
        │   ├── uassetapi.unrealtypes.fpropertytypenameconverter.md
        │   ├── uassetapi.unrealtypes.fpropertytypenamenode.md
        │   ├── uassetapi.unrealtypes.fqualifiedframetime.md
        │   ├── uassetapi.unrealtypes.fquat.md
        │   ├── uassetapi.unrealtypes.frichcurvekey.md
        │   ├── uassetapi.unrealtypes.frotator.md
        │   ├── uassetapi.unrealtypes.fskeletalmeshareaweightedtrianglesampler.md
        │   ├── uassetapi.unrealtypes.fskeletalmeshsamplingregionbuiltdata.md
        │   ├── uassetapi.unrealtypes.fstring.md
        │   ├── uassetapi.unrealtypes.ftextsourcedata.md
        │   ├── uassetapi.unrealtypes.ftextsourcesitecontext.md
        │   ├── uassetapi.unrealtypes.ftimecode.md
        │   ├── uassetapi.unrealtypes.ftransform.md
        │   ├── uassetapi.unrealtypes.ftwovectors.md
        │   ├── uassetapi.unrealtypes.funiquenetid.md
        │   ├── uassetapi.unrealtypes.fvector.md
        │   ├── uassetapi.unrealtypes.fvector2d.md
        │   ├── uassetapi.unrealtypes.fvector2f.md
        │   ├── uassetapi.unrealtypes.fvector3f.md
        │   ├── uassetapi.unrealtypes.fvector4.md
        │   ├── uassetapi.unrealtypes.fvector4f.md
        │   ├── uassetapi.unrealtypes.fweightedrandomsampler.md
        │   ├── uassetapi.unrealtypes.fworldtileinfo.md
        │   ├── uassetapi.unrealtypes.fworldtilelayer.md
        │   ├── uassetapi.unrealtypes.fworldtilelodinfo.md
        │   ├── uassetapi.unrealtypes.iordereddictionary-2.md
        │   ├── uassetapi.unrealtypes.linearhelpers.md
        │   ├── uassetapi.unrealtypes.objectversion.md
        │   ├── uassetapi.unrealtypes.objectversionue5.md
        │   ├── uassetapi.unrealtypes.tbox-1.md
        │   ├── uassetapi.unrealtypes.tmap-2.md
        │   ├── uassetapi.unrealtypes.tperqualitylevel-1.md
        │   ├── uassetapi.unrealtypes.trange-1.md
        │   ├── uassetapi.unrealtypes.trangebound-1.md
        │   ├── uassetapi.unrealtypes.ue4versiontoobjectversion.md
        │   ├── uassetapi.unrealtypes.ue5versiontoobjectversion.md
        │   ├── uassetapi.unrealtypes.uniquenetidreplpropertydata.md
        │   ├── uassetapi.unrealtypes.universalobjectlocatorfragmentpropertydata.md
        │   ├── uassetapi.unversioned.ecompressionmethod.md
        │   ├── uassetapi.unversioned.ecustomversionserializationformat.md
        │   ├── uassetapi.unversioned.epropertytype.md
        │   ├── uassetapi.unversioned.esavegamefileversion.md
        │   ├── uassetapi.unversioned.ffragment.md
        │   ├── uassetapi.unversioned.funversionedheader.md
        │   ├── uassetapi.unversioned.oodle.md
        │   ├── uassetapi.unversioned.savegame.md
        │   ├── uassetapi.unversioned.usmap.md
        │   ├── uassetapi.unversioned.usmaparraydata.md
        │   ├── uassetapi.unversioned.usmapenum.md
        │   ├── uassetapi.unversioned.usmapenumdata.md
        │   ├── uassetapi.unversioned.usmapextensionlayoutversion.md
        │   ├── uassetapi.unversioned.usmapmapdata.md
        │   ├── uassetapi.unversioned.usmapproperty.md
        │   ├── uassetapi.unversioned.usmappropertydata.md
        │   ├── uassetapi.unversioned.usmapschema.md
        │   ├── uassetapi.unversioned.usmapschemapropertiesjsonconverter.md
        │   ├── uassetapi.unversioned.usmapstructdata.md
        │   ├── uassetapi.unversioned.usmapstructkind.md
        │   ├── uassetapi.unversioned.usmapversion.md
        │   └── uassetapi.usmapbinaryreader.md
        ├── guide/
        │   ├── basic.md
        │   ├── build.md
        │   └── extras.md
        └── samples/
            ├── plwp_6aam_a0.uasset
            └── plwp_6aam_a0.uexp

================================================
FILE CONTENTS
================================================

================================================
FILE: .github/ISSUE_TEMPLATE/bug_report.md
================================================
---
name: Bug report
about: Create a report to help us improve
title: ''
labels: ''
assignees: ''

---

**Describe the bug**
A clear and concise description of what the bug is.

**To Reproduce**
Steps to reproduce the behavior:
1. Go to '...'
2. Click on '....'
3. Scroll down to '....'
4. See error

Please provide a copy of an asset that can be used to reproduce the issue if needed, along with the game's Unreal Engine version. If the asset uses unversioned properties, you should also provide a set of mappings. YOUR ISSUE WILL NOT BE REVIEWED IF YOUR ISSUE CANNOT BE REPLICATED BECAUSE NO TEST ASSET IS PROVIDED.

**Expected behavior**
A clear and concise description of what you expected to happen.

**Screenshots**
If applicable, add screenshots to help explain your problem.

**Desktop (please complete the following information):**
 - OS: [e.g. Windows 10]
 - Version or Commit: [e.g. 1.0.2/c7d9f8d]
   - If you encountered this issue on a release version of UAssetGUI, you may find that your issue has already been fixed with the latest experimental release: https://github.com/atenfyr/UAssetGUI/releases/tag/experimental-latest

**Additional context**
Add any other context about the problem here.


================================================
FILE: .github/ISSUE_TEMPLATE/config.yml
================================================
blank_issues_enabled: false

================================================
FILE: .github/ISSUE_TEMPLATE/feature_request.md
================================================
---
name: Feature request
about: Suggest an idea for this project
title: ''
labels: ''
assignees: ''

---

**Is your feature request related to a problem? Please describe.**
A clear and concise description of what the problem is. Ex. I'm always frustrated when [...]

**Describe the solution you'd like**
A clear and concise description of what you want to happen.

**Describe alternatives you've considered**
A clear and concise description of any alternative solutions or features you've considered.

**Additional context**
Add any other context or screenshots about the feature request here.


================================================
FILE: .github/pull_request_template.md
================================================
# Pull Request

## Description

<!-- Please include a summary of the change(s) you have made.

If this pull request is intended to fix an existing issue, reference the existing GitHub issue number here or create a new issue and reference the new issue number here. If your PR is intended to fix an existing issue but no issue number is referenced, your PR will not be reviewed.

Please note that we currently do not accept AI generated code on the UAssetAPI repository. UAssetAPI is mature, stable software, so all changes must be thoroughly tested and reviewed by a human. Pull requests containing AI generated code will not be reviewed. -->

## Type of change

<!-- Please delete options that are not relevant. -->

- [ ] Bug fix (non-breaking change which fixes an issue)
- [ ] New feature (non-breaking change which adds functionality)
- [ ] Breaking change (fix or feature that would cause existing functionality to not work as expected)
- [ ] Other (please specify)

## Testing

<!-- Please provide a sequence of steps that can be performed to verify your changes. If applicable, you may wish to create a new test in the UAssetAPI.Tests/AssetUnitTests.cs file including problematic assets. --> 


================================================
FILE: .github/workflows/build.yml
================================================
name: CI
on:
  push:
    branches:
      - master

jobs:
  build:
    runs-on: windows-latest
    steps:
      - name: git checkout
        uses: actions/checkout@v3
        with:
          fetch-depth: 0
      - name: .NET Setup
        uses: actions/setup-dotnet@v2
        with:
          dotnet-version: '8.0.x'
      - name: Install dependencies
        run: dotnet restore
      - name: Build
        run: dotnet build --configuration Release --no-restore
      - name: Unit tests
        run: dotnet test --no-restore --verbosity normal


================================================
FILE: .github/workflows/main.yml
================================================
name: Deploy
on:
  push:
    branches:
      - master

jobs:
  deploy:
    runs-on: ubuntu-latest
    steps:
    - uses: actions/checkout@v3
      with:
        fetch-depth: 0
    - name: Install mdbook
      run: |
        mkdir mdbook
        curl -sSL https://github.com/rust-lang/mdBook/releases/download/v0.4.14/mdbook-v0.4.14-x86_64-unknown-linux-gnu.tar.gz | tar -xz --directory=./mdbook
        echo `pwd`/mdbook >> $GITHUB_PATH
    - name: Deploy GitHub Pages
      run: |
        cd docs
        mdbook build
        git worktree add gh-pages
        git config user.name "Deploy from CI"
        git config user.email ""
        cd gh-pages
        git update-ref -d refs/heads/gh-pages
        rm -rf *
        mv ../book/* .
        git add .
        git commit -m "Deploy $GITHUB_SHA to gh-pages"
        git push --force --set-upstream origin gh-pages

================================================
FILE: .gitignore
================================================
.vs
docs/book
docs/XMLDoc2Markdown
packages
TestResults
UAssetAPI/git_commit.txt
UAssetAPI/bin
UAssetAPI/obj
UAssetAPI.Benchmark/bin
UAssetAPI.Benchmark/obj
UAssetAPI.Tests/bin
UAssetAPI.Tests/obj


================================================
FILE: LICENSE
================================================
MIT License

Copyright (c) 2020 - 2026 atenfyr

Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:

The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.

THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.


================================================
FILE: NOTICE.md
================================================
# Notices
The following is a list of applicable licensing information for all the third-party material used, in whole or in part, within this software.

## repak
https://github.com/trumank/repak
```
MIT License

Copyright 2024 Truman Kilen, spuds

Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:

The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.

THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.
```

## Json.NET
https://github.com/JamesNK/Newtonsoft.Json
```
The MIT License (MIT)

Copyright (c) 2007 James Newton-King

Permission is hereby granted, free of charge, to any person obtaining a copy of
this software and associated documentation files (the "Software"), to deal in
the Software without restriction, including without limitation the rights to
use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of
the Software, and to permit persons to whom the Software is furnished to do so,
subject to the following conditions:

The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.

THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS
FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR
COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER
IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN
CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
```

## dotmore
https://github.com/mattmc3/dotmore
```
The MIT License (MIT)

Copyright (c) 2014 mattmc3

Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:

The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.

THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.
```

## ZstdNet
https://github.com/skbkontur/ZstdNet
```
BSD License

For ZstdNet software

Copyright (c) 2016-present, SKB Kontur. All rights reserved.

Redistribution and use in source and binary forms, with or without modification,
are permitted provided that the following conditions are met:

 * Redistributions of source code must retain the above copyright notice, this
   list of conditions and the following disclaimer.

 * Redistributions in binary form must reproduce the above copyright notice,
   this list of conditions and the following disclaimer in the documentation
   and/or other materials provided with the distribution.

 * Neither the name SKB Kontur nor the names of its contributors may be used to
   endorse or promote products derived from this software without specific
   prior written permission.

THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND
ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED
WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE
DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR
ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES
(INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES;
LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON
ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS
SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
```

## zstd
https://github.com/facebook/zstd
```
BSD License

For Zstandard software

Copyright (c) Meta Platforms, Inc. and affiliates. All rights reserved.

Redistribution and use in source and binary forms, with or without modification,
are permitted provided that the following conditions are met:

 * Redistributions of source code must retain the above copyright notice, this
   list of conditions and the following disclaimer.

 * Redistributions in binary form must reproduce the above copyright notice,
   this list of conditions and the following disclaimer in the documentation
   and/or other materials provided with the distribution.

 * Neither the name Facebook, nor Meta, nor the names of its contributors may
   be used to endorse or promote products derived from this software without
   specific prior written permission.

THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND
ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED
WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE
DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR
ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES
(INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES;
LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON
ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS
SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
```

## UEAssetToolkitGenerator
https://github.com/LongerWarrior/UEAssetToolkitGenerator

### License
```
                                 Apache License
                           Version 2.0, January 2004
                        http://www.apache.org/licenses/

   TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION

   1. Definitions.

      "License" shall mean the terms and conditions for use, reproduction,
      and distribution as defined by Sections 1 through 9 of this document.

      "Licensor" shall mean the copyright owner or entity authorized by
      the copyright owner that is granting the License.

      "Legal Entity" shall mean the union of the acting entity and all
      other entities that control, are controlled by, or are under common
      control with that entity. For the purposes of this definition,
      "control" means (i) the power, direct or indirect, to cause the
      direction or management of such entity, whether by contract or
      otherwise, or (ii) ownership of fifty percent (50%) or more of the
      outstanding shares, or (iii) beneficial ownership of such entity.

      "You" (or "Your") shall mean an individual or Legal Entity
      exercising permissions granted by this License.

      "Source" form shall mean the preferred form for making modifications,
      including but not limited to software source code, documentation
      source, and configuration files.

      "Object" form shall mean any form resulting from mechanical
      transformation or translation of a Source form, including but
      not limited to compiled object code, generated documentation,
      and conversions to other media types.

      "Work" shall mean the work of authorship, whether in Source or
      Object form, made available under the License, as indicated by a
      copyright notice that is included in or attached to the work
      (an example is provided in the Appendix below).

      "Derivative Works" shall mean any work, whether in Source or Object
      form, that is based on (or derived from) the Work and for which the
      editorial revisions, annotations, elaborations, or other modifications
      represent, as a whole, an original work of authorship. For the purposes
      of this License, Derivative Works shall not include works that remain
      separable from, or merely link (or bind by name) to the interfaces of,
      the Work and Derivative Works thereof.

      "Contribution" shall mean any work of authorship, including
      the original version of the Work and any modifications or additions
      to that Work or Derivative Works thereof, that is intentionally
      submitted to Licensor for inclusion in the Work by the copyright owner
      or by an individual or Legal Entity authorized to submit on behalf of
      the copyright owner. For the purposes of this definition, "submitted"
      means any form of electronic, verbal, or written communication sent
      to the Licensor or its representatives, including but not limited to
      communication on electronic mailing lists, source code control systems,
      and issue tracking systems that are managed by, or on behalf of, the
      Licensor for the purpose of discussing and improving the Work, but
      excluding communication that is conspicuously marked or otherwise
      designated in writing by the copyright owner as "Not a Contribution."

      "Contributor" shall mean Licensor and any individual or Legal Entity
      on behalf of whom a Contribution has been received by Licensor and
      subsequently incorporated within the Work.

   2. Grant of Copyright License. Subject to the terms and conditions of
      this License, each Contributor hereby grants to You a perpetual,
      worldwide, non-exclusive, no-charge, royalty-free, irrevocable
      copyright license to reproduce, prepare Derivative Works of,
      publicly display, publicly perform, sublicense, and distribute the
      Work and such Derivative Works in Source or Object form.

   3. Grant of Patent License. Subject to the terms and conditions of
      this License, each Contributor hereby grants to You a perpetual,
      worldwide, non-exclusive, no-charge, royalty-free, irrevocable
      (except as stated in this section) patent license to make, have made,
      use, offer to sell, sell, import, and otherwise transfer the Work,
      where such license applies only to those patent claims licensable
      by such Contributor that are necessarily infringed by their
      Contribution(s) alone or by combination of their Contribution(s)
      with the Work to which such Contribution(s) was submitted. If You
      institute patent litigation against any entity (including a
      cross-claim or counterclaim in a lawsuit) alleging that the Work
      or a Contribution incorporated within the Work constitutes direct
      or contributory patent infringement, then any patent licenses
      granted to You under this License for that Work shall terminate
      as of the date such litigation is filed.

   4. Redistribution. You may reproduce and distribute copies of the
      Work or Derivative Works thereof in any medium, with or without
      modifications, and in Source or Object form, provided that You
      meet the following conditions:

      (a) You must give any other recipients of the Work or
          Derivative Works a copy of this License; and

      (b) You must cause any modified files to carry prominent notices
          stating that You changed the files; and

      (c) You must retain, in the Source form of any Derivative Works
          that You distribute, all copyright, patent, trademark, and
          attribution notices from the Source form of the Work,
          excluding those notices that do not pertain to any part of
          the Derivative Works; and

      (d) If the Work includes a "NOTICE" text file as part of its
          distribution, then any Derivative Works that You distribute must
          include a readable copy of the attribution notices contained
          within such NOTICE file, excluding those notices that do not
          pertain to any part of the Derivative Works, in at least one
          of the following places: within a NOTICE text file distributed
          as part of the Derivative Works; within the Source form or
          documentation, if provided along with the Derivative Works; or,
          within a display generated by the Derivative Works, if and
          wherever such third-party notices normally appear. The contents
          of the NOTICE file are for informational purposes only and
          do not modify the License. You may add Your own attribution
          notices within Derivative Works that You distribute, alongside
          or as an addendum to the NOTICE text from the Work, provided
          that such additional attribution notices cannot be construed
          as modifying the License.

      You may add Your own copyright statement to Your modifications and
      may provide additional or different license terms and conditions
      for use, reproduction, or distribution of Your modifications, or
      for any such Derivative Works as a whole, provided Your use,
      reproduction, and distribution of the Work otherwise complies with
      the conditions stated in this License.

   5. Submission of Contributions. Unless You explicitly state otherwise,
      any Contribution intentionally submitted for inclusion in the Work
      by You to the Licensor shall be under the terms and conditions of
      this License, without any additional terms or conditions.
      Notwithstanding the above, nothing herein shall supersede or modify
      the terms of any separate license agreement you may have executed
      with Licensor regarding such Contributions.

   6. Trademarks. This License does not grant permission to use the trade
      names, trademarks, service marks, or product names of the Licensor,
      except as required for reasonable and customary use in describing the
      origin of the Work and reproducing the content of the NOTICE file.

   7. Disclaimer of Warranty. Unless required by applicable law or
      agreed to in writing, Licensor provides the Work (and each
      Contributor provides its Contributions) on an "AS IS" BASIS,
      WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or
      implied, including, without limitation, any warranties or conditions
      of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A
      PARTICULAR PURPOSE. You are solely responsible for determining the
      appropriateness of using or redistributing the Work and assume any
      risks associated with Your exercise of permissions under this License.

   8. Limitation of Liability. In no event and under no legal theory,
      whether in tort (including negligence), contract, or otherwise,
      unless required by applicable law (such as deliberate and grossly
      negligent acts) or agreed to in writing, shall any Contributor be
      liable to You for damages, including any direct, indirect, special,
      incidental, or consequential damages of any character arising as a
      result of this License or out of the use or inability to use the
      Work (including but not limited to damages for loss of goodwill,
      work stoppage, computer failure or malfunction, or any and all
      other commercial damages or losses), even if such Contributor
      has been advised of the possibility of such damages.

   9. Accepting Warranty or Additional Liability. While redistributing
      the Work or Derivative Works thereof, You may choose to offer,
      and charge a fee for, acceptance of support, warranty, indemnity,
      or other liability obligations and/or rights consistent with this
      License. However, in accepting such obligations, You may act only
      on Your own behalf and on Your sole responsibility, not on behalf
      of any other Contributor, and only if You agree to indemnify,
      defend, and hold each Contributor harmless for any liability
      incurred by, or claims asserted against, such Contributor by reason
      of your accepting any such warranty or additional liability.

   END OF TERMS AND CONDITIONS

   APPENDIX: How to apply the Apache License to your work.

      To apply the Apache License to your work, attach the following
      boilerplate notice, with the fields enclosed by brackets "[]"
      replaced with your own identifying information. (Don't include
      the brackets!)  The text should be enclosed in the appropriate
      comment syntax for the file format. We also recommend that a
      file or class name and description of purpose be included on the
      same "printed page" as the copyright notice for easier
      identification within third-party archives.

   Copyright [yyyy] [name of copyright owner]

   Licensed under the Apache License, Version 2.0 (the "License");
   you may not use this file except in compliance with the License.
   You may obtain a copy of the License at

       http://www.apache.org/licenses/LICENSE-2.0

   Unless required by applicable law or agreed to in writing, software
   distributed under the License is distributed on an "AS IS" BASIS,
   WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
   See the License for the specific language governing permissions and
   limitations under the License.
```
### Statement of Modification
Major portions of the source code that is adapted from UEAssetToolkitGenerator have been modified for usage in UAssetAPI through changes in code formatting, nomenclature, and serialization specifics in order to improve the effectiveness of the serialization across different engine versions and assets and to improve integration with newer versions of UAssetAPI. The relevant portions of source code have been sufficiently adapted such that no improper serialization or other unexpected behavior should be construed as having originated from any portion of the original work or any of its contributors.

### Original NOTICE text file information
The NOTICE text file bundled with the referenced project is not included in this copyright notice because none of the notices in that file pertain to any part of the work that is adapted for usage in UAssetAPI. Please see the original repository for more detailed copyright information.


================================================
FILE: README.md
================================================
# UAssetAPI
[![CI Status](https://img.shields.io/github/actions/workflow/status/atenfyr/UAssetAPI/build.yml?label=CI)](https://github.com/atenfyr/UAssetAPI/actions)
[![Issues](https://img.shields.io/github/issues/atenfyr/UAssetAPI.svg?style=flat-square)](https://github.com/atenfyr/UAssetAPI/issues)
[![License](https://img.shields.io/github/license/atenfyr/UAssetAPI.svg?style=flat-square)](https://github.com/atenfyr/UAssetAPI/blob/master/LICENSE.md)

UAssetAPI is a low-level .NET library for reading and writing Unreal Engine game assets.

<img src="https://i.imgur.com/GZbr93m.png" align="center">

## Features
- Low-level read/write capability for a wide variety of cooked and uncooked .uasset files from ~4.13 to 5.3
- Support for more than 100 property types and 12 export types
- Support for JSON export and import to a proprietary format that maintains binary equality
- Support for reading and writing raw Kismet (blueprint) bytecode
- Reading capability for the unofficial .usmap format to parse ambiguous and unversioned properties
- Robust fail-safes for many properties and exports that fail serialization
- Automatic reflection for new property types in other loaded assemblies

## Usage
To get started using UAssetAPI, first build the API using the [Build Instructions guide](https://atenfyr.github.io/UAssetAPI/guide/build.html) and learn how to perform basic operations on your cooked .uasset files using the [Basic Usage guide](https://atenfyr.github.io/UAssetAPI/guide/basic.html).

UAssetGUI, a graphical wrapper around UAssetAPI which allows you to directly view and modify game assets by hand, is also available and can be downloaded for free on GitHub at [https://github.com/atenfyr/UAssetGUI/releases](https://github.com/atenfyr/UAssetGUI/releases).

## Contributing
All contributions, whether through pull requests or issues, that you may make are greatly appreciated.

I am particularly interested in .uasset files that have their `VerifyBinaryEquality()` method return false (or display "failed to maintain binary equality" within [UAssetGUI](https://github.com/atenfyr/UAssetGUI)); if you encounter such an asset, feel free to submit an issue here with a copy of the asset in question along with the name of the game and the Unreal version that it was cooked with.

Please note: Your issue will NOT be reviewed if your issue cannot be replicated due to no test asset being provided.

## License
UAssetAPI and UAssetGUI are distributed under the MIT license, which you can view in detail in the [LICENSE file](LICENSE).


================================================
FILE: UAssetAPI/AC7Decrypt.cs
================================================
using System;
using System.Diagnostics;
using System.IO;
using UAssetAPI.ExportTypes;

namespace UAssetAPI
{
    /// <summary>
    /// XOR key for decrypting a particular Ace Combat 7 asset. 
    /// </summary>
    public class AC7XorKey
    {
        public int NameKey;
        public int Offset;
        public int pk1;
        public int pk2;

        public void SkipCount(int count)
        {
            int num = count % 217;
            pk1 += num;
            if (pk1 >= 217)
            {
                pk1 -= 217;
            }
            int num2 = count % 1024;
            pk2 += num2;
            if (pk2 >= 1024)
            {
                pk2 -= 1024;
            }
        }

        private static int CalcNameKey(string fname)
        {
            fname = fname.ToUpper();
            int num = 0;
            for (int i = 0; i < fname.Length; i++)
            {
                int num2 = (byte)fname[i];
                num ^= num2;
                num2 = num * 8;
                num2 ^= num;
                int num3 = num + num;
                num2 = ~num2;
                num2 = (num2 >> 7) & 1;
                num = num2 | num3;
            }
            return num;
        }

        private static void CalcPKeyFromNKey(int nkey, int dataoffset, out int pk1, out int pk2)
        {
            long num = (uint)((long)nkey * 7L);
            System.Numerics.BigInteger bigInteger = new System.Numerics.BigInteger(5440514381186227205L);
            num += dataoffset;
            System.Numerics.BigInteger bigInteger2 = bigInteger * num;
            long num2 = (long)(bigInteger2 >> 70);
            long num3 = num2 >> 63;
            num2 += num3;
            num3 = num2 * 217;
            num -= num3;
            pk1 = (int)(num & 0xFFFFFFFFu);
            long num4 = (uint)((long)nkey * 11L);
            num4 += dataoffset;
            num2 = 0L;
            num2 &= 0x3FF;
            num4 += num2;
            num4 &= 0x3FF;
            long num5 = num4 - num2;
            pk2 = (int)(num5 & 0xFFFFFFFFu);
        }

        /// <summary>
        /// Generates an encryption key for a particular asset on disk.
        /// </summary>
        /// <param name="fname">The name of the asset being encrypted on disk without the extension.</param>
        /// <returns>An encryption key for the asset.</returns>
        public AC7XorKey(string fname)
        {
            NameKey = CalcNameKey(fname); Offset = 4;
            CalcPKeyFromNKey(this.NameKey, this.Offset, out this.pk1, out this.pk2);
        }
    }

    /// <summary>
    /// Decryptor for Ace Combat 7 assets.
    /// </summary>
    public class AC7Decrypt
    {
        private static byte[] AC7FullKey = new byte[0];

        public AC7Decrypt()
        {
            if (AC7FullKey.Length == 0) AC7FullKey = Properties.Resources.AC7Key;
        }

        /// <summary>
        /// Decrypts an Ace Combat 7 encrypted asset on disk.
        /// </summary>
        /// <param name="input">The path to an encrypted asset on disk.</param>
        /// <param name="output">The path that the decrypted asset should be saved to.</param>
        public void Decrypt(string input, string output)
        {
            AC7XorKey xorKey = new AC7XorKey(Path.GetFileNameWithoutExtension(input));
            byte[] doneData = DecryptUAssetBytes(File.ReadAllBytes(input), xorKey);
            File.WriteAllBytes(output, doneData);
            try
            {
                byte[] doneData2 = DecryptUexpBytes(File.ReadAllBytes(Path.ChangeExtension(input, "uexp")), xorKey);
                File.WriteAllBytes(Path.ChangeExtension(output, "uexp"), doneData2);
            }
            catch { }
        }

        /// <summary>
        /// Encrypts an Ace Combat 7 encrypted asset on disk.
        /// </summary>
        /// <param name="input">The path to a decrypted asset on disk.</param>
        /// <param name="output">The path that the encrypted asset should be saved to.</param>
        public void Encrypt(string input, string output)
        {
            AC7XorKey xorKey = new AC7XorKey(Path.GetFileNameWithoutExtension(output));
            byte[] doneData = EncryptUAssetBytes(File.ReadAllBytes(input), xorKey);
            File.WriteAllBytes(output, doneData);
            try
            {
                byte[] doneData2 = EncryptUexpBytes(File.ReadAllBytes(Path.ChangeExtension(input, "uexp")), xorKey);
                File.WriteAllBytes(Path.ChangeExtension(output, "uexp"), doneData2);
            }
            catch { }
        }

        public byte[] DecryptUAssetBytes(byte[] uasset, AC7XorKey xorkey)
        {
            if (xorkey == null) throw new NullReferenceException("Null key provided");
            byte[] array = new byte[uasset.Length];
            BitConverter.GetBytes(UAsset.UASSET_MAGIC).CopyTo(array, 0);
            for (int i = 4; i < array.Length; i++)
            {
                array[i] = GetXorByte(uasset[i], ref xorkey);
            }
            return array;
        }

        public byte[] EncryptUAssetBytes(byte[] uasset, AC7XorKey xorkey)
        {
            if (xorkey == null) throw new NullReferenceException("Null key provided");
            byte[] array = new byte[uasset.Length];
            BitConverter.GetBytes(UAsset.ACE7_MAGIC).CopyTo(array, 0);
            for (int i = 4; i < array.Length; i++)
            {
                array[i] = GetXorByte(uasset[i], ref xorkey);
            }
            return array;
        }

        public byte[] DecryptUexpBytes(byte[] uexp, AC7XorKey xorkey)
        {
            if (xorkey == null) throw new NullReferenceException("Null key provided");
            byte[] array = new byte[uexp.Length];
            for (int i = 0; i < array.Length; i++)
            {
                array[i] = GetXorByte(uexp[i], ref xorkey);
            }
            BitConverter.GetBytes(UAsset.UASSET_MAGIC).CopyTo(array, array.Length - 4);
            return array;
        }

        public byte[] EncryptUexpBytes(byte[] uexp, AC7XorKey xorkey)
        {
            if (xorkey == null) throw new NullReferenceException("Null key provided");
            byte[] array = new byte[uexp.Length];
            for (int i = 0; i < uexp.Length; i++)
            {
                array[i] = GetXorByte(uexp[i], ref xorkey);
            }
            return array;
        }

        private static byte GetXorByte(byte tagb, ref AC7XorKey xorkey)
        {
            if (xorkey == null)
            {
                return tagb;
            }
            tagb = (byte)((uint)(tagb ^ AC7FullKey[xorkey.pk1 * 1024 + xorkey.pk2]) ^ 0x77u);
            xorkey.pk1++;
            xorkey.pk2++;
            if (xorkey.pk1 >= 217)
            {
                xorkey.pk1 = 0;
            }
            if (xorkey.pk2 >= 1024)
            {
                xorkey.pk2 = 0;
            }
            return tagb;
        }
    }
}


================================================
FILE: UAssetAPI/AssetBinaryReader.cs
================================================
using System;
using System.Collections.Generic;
using System.IO;
using System.Text;
using UAssetAPI.CustomVersions;
using UAssetAPI.Kismet.Bytecode;
using UAssetAPI.UnrealTypes;
using UAssetAPI.Unversioned;

namespace UAssetAPI;

/// <summary>
/// Any binary reader used in the parsing of Unreal file types.
/// </summary>
public class UnrealBinaryReader : BinaryReader
{
    public UnrealBinaryReader(Stream stream) : base(stream) { }

    protected byte[] ReverseIfBigEndian(byte[] data)
    {
        if (!BitConverter.IsLittleEndian) Array.Reverse(data);
        return data;
    }

    public override short ReadInt16()
    {
        return BitConverter.ToInt16(ReverseIfBigEndian(base.ReadBytes(2)), 0);
    }

    public override ushort ReadUInt16()
    {
        return BitConverter.ToUInt16(ReverseIfBigEndian(base.ReadBytes(2)), 0);
    }

    public override int ReadInt32()
    {
        return BitConverter.ToInt32(ReverseIfBigEndian(base.ReadBytes(4)), 0);
    }

    public override uint ReadUInt32()
    {
        return BitConverter.ToUInt32(ReverseIfBigEndian(base.ReadBytes(4)), 0);
    }

    public override long ReadInt64()
    {
        return BitConverter.ToInt64(ReverseIfBigEndian(base.ReadBytes(8)), 0);
    }

    public override ulong ReadUInt64()
    {
        return BitConverter.ToUInt64(ReverseIfBigEndian(base.ReadBytes(8)), 0);
    }

    public override float ReadSingle()
    {
        return BitConverter.ToSingle(ReverseIfBigEndian(base.ReadBytes(4)), 0);
    }

    public override double ReadDouble()
    {
        return BitConverter.ToDouble(ReverseIfBigEndian(base.ReadBytes(8)), 0);
    }

    public bool ReadBooleanInt()
    {
        var i = ReadInt32();
        return i switch
        {
            1 => true,
            0 => false,
            _ => throw new FormatException($"Invalid boolean value {i}")
        };
    }

    public override string ReadString()
    {
        return ReadFString()?.Value;
    }

    public virtual FString ReadFString()
    {
        int length = this.ReadInt32();
        switch (length)
        {
            case < 0:
                var len = -length * 2;
                Span<byte> data = len < 512 ? stackalloc byte[len] : new byte[len];
                BaseStream.Read(data);
                return new FString(Encoding.Unicode.GetString(data[..^2]), Encoding.Unicode);
            case > 0:
                data = length < 512 ? stackalloc byte[length] : new byte[length];
                BaseStream.Read(data);
                return new FString(Encoding.UTF8.GetString(data[..^1]), Encoding.UTF8);
            default:
                return null;
        }
    }

    public virtual FString ReadUtf8String()
    {
        int length = this.ReadInt32();
        switch (length)
        {
            case < 0:
                throw new FormatException("Invalid UTF-8 string length");
            case > 0:
                Span<byte> data = length < 512 ? stackalloc byte[length] : new byte[length];
                BaseStream.Read(data);
                return new FString(Encoding.UTF8.GetString(data), Encoding.UTF8);
            default:
                return null;
        }
    }

    public virtual FString ReadNameMapString(out uint hashes)
    {
        hashes = 0;
        FString str = this.ReadFString();
        if (this is AssetBinaryReader abr)
        {
            if (abr.Asset is UAsset abrUa && abrUa.WillSerializeNameHashes != false && !string.IsNullOrEmpty(str.Value))
            {
                hashes = this.ReadUInt32();
                if (hashes < (1 << 10) && abrUa.ObjectVersion < ObjectVersion.VER_UE4_NAME_HASHES_SERIALIZED) // "i lied, there's actually no hashes"
                {
                    abrUa.WillSerializeNameHashes = false;
                    hashes = 0;
                    this.BaseStream.Position -= sizeof(uint);
                }
                else
                {
                    abrUa.WillSerializeNameHashes = true;
                }
            }
        }
        return str;
    }

    public List<CustomVersion> ReadCustomVersionContainer(ECustomVersionSerializationFormat format, List<CustomVersion> oldCustomVersionContainer = null, Usmap Mappings = null)
    {
        var newCustomVersionContainer = new List<CustomVersion>();
        var existingCustomVersions = new HashSet<Guid>();
        switch (format)
        {
            case ECustomVersionSerializationFormat.Enums:
                throw new NotImplementedException("Custom version serialization format Enums is currently unimplemented");
            case ECustomVersionSerializationFormat.Guids:
                int numCustomVersions = ReadInt32();
                for (int i = 0; i < numCustomVersions; i++)
                {
                    var customVersionID = new Guid(ReadBytes(16));
                    var customVersionNumber = ReadInt32();
                    newCustomVersionContainer.Add(new CustomVersion(customVersionID, customVersionNumber) { Name = ReadFString() });
                    existingCustomVersions.Add(customVersionID);
                }
                break;
            case ECustomVersionSerializationFormat.Optimized:
                numCustomVersions = ReadInt32();
                for (int i = 0; i < numCustomVersions; i++)
                {
                    var customVersionID = new Guid(ReadBytes(16));
                    var customVersionNumber = ReadInt32();
                    newCustomVersionContainer.Add(new CustomVersion(customVersionID, customVersionNumber));                      
                    existingCustomVersions.Add(customVersionID);
                }
                break;

        }    

        if (Mappings != null && Mappings.CustomVersionContainer != null && Mappings.CustomVersionContainer.Count > 0)
        {
            foreach (CustomVersion entry in Mappings.CustomVersionContainer)
            {
                if (!existingCustomVersions.Contains(entry.Key)) newCustomVersionContainer.Add(entry.SetIsSerialized(false));
            }
        }

        if (oldCustomVersionContainer != null)
        {
            foreach (CustomVersion entry in oldCustomVersionContainer)
            {
                if (!existingCustomVersions.Contains(entry.Key)) newCustomVersionContainer.Add(entry.SetIsSerialized(false));
            }
        }

        return newCustomVersionContainer;
    }
}

/// <summary>
/// Reads primitive data types from Unreal Engine assets.
/// </summary>
public class AssetBinaryReader : UnrealBinaryReader
{
    public UAsset Asset;
    public bool LoadUexp = true;

    public AssetBinaryReader(Stream stream, UAsset asset = null) : base(stream)
    {
        Asset = asset;
    }
    
    public AssetBinaryReader(Stream stream, bool inLoadUexp, UAsset asset = null) : base(stream)
    {
        Asset = asset;
        LoadUexp = inLoadUexp;
    }

    public virtual Guid? ReadPropertyGuid()
    {
        if (Asset.HasUnversionedProperties) return null;
        if (Asset.ObjectVersion >= ObjectVersion.VER_UE4_PROPERTY_GUID_IN_PROPERTY_TAG)
        {
            bool hasPropertyGuid = ReadBoolean();
            if (hasPropertyGuid) return new Guid(ReadBytes(16));
        }
        return null;
    }

    public virtual FName ReadFName()
    {
        int nameMapPointer = this.ReadInt32();
        int number = this.ReadInt32();
        return new FName(Asset, nameMapPointer, number);
    }

    public T[] ReadArray<T>(Func<T> readElement)
    {
        int arrayLength = ReadInt32();
        if (arrayLength == 0) return [];
        T[] newData = new T[arrayLength];
        for (int i = 0; i < arrayLength; i++)
        {
            newData[i] = readElement();
        }
        return newData;
    }

    public FObjectThumbnail ReadObjectThumbnail()
    {
        var thumb = new FObjectThumbnail();

        thumb.Width = ReadInt32();
        thumb.Height = ReadInt32();
        var imageBytesCount = ReadInt32();
        thumb.CompressedImageData = imageBytesCount > 0 ? ReadBytes(imageBytesCount) : Array.Empty<byte>();

        return thumb;
    }

    public FLocMetadataObject ReadLocMetadataObject()
    {
        var locMetadataObject = new FLocMetadataObject();

        var valueCount = ReadInt32();
        if (valueCount > 0)
            throw new NotImplementedException("TODO: implement ReadLocMetadataObject");

        return locMetadataObject;
    }

    public string XFERSTRING()
    {
        List<byte> readData = new List<byte>();
        while (true)
        {
            byte newVal = this.ReadByte();
            if (newVal == 0) break;
            readData.Add(newVal);
        }
        return Encoding.UTF8.GetString(readData.ToArray());
    }

    public string XFERUNICODESTRING()
    {
        List<byte> readData = new List<byte>();
        while (true)
        {
            byte newVal1 = this.ReadByte();
            byte newVal2 = this.ReadByte();
            if (newVal1 == 0 && newVal2 == 0) break;
            readData.Add(newVal1);
            readData.Add(newVal2);
        }
        return Encoding.Unicode.GetString(readData.ToArray());
    }

    public void XFERTEXT()
    {

    }

    public FName XFERNAME()
    {
        return this.ReadFName();
    }

    public FName XFER_FUNC_NAME()
    {
        return this.XFERNAME();
    }

    public FPackageIndex XFERPTR()
    {
        return new FPackageIndex(this.ReadInt32());
    }

    public FPackageIndex XFER_FUNC_POINTER()
    {
        return this.XFERPTR();
    }

    public KismetPropertyPointer XFER_PROP_POINTER()
    {
        if (Asset.GetCustomVersion<FReleaseObjectVersion>() >= FReleaseObjectVersion.FFieldPathOwnerSerialization)
        {
            int numEntries = this.ReadInt32();
            FName[] allNames = new FName[numEntries];
            for (int i = 0; i < numEntries; i++)
            {
                allNames[i] = this.ReadFName();
            }
            FPackageIndex owner = this.XFER_OBJECT_POINTER();
            return new KismetPropertyPointer(new FFieldPath(allNames, owner, this.Asset.Exports.Count));
        }
        else
        {
            return new KismetPropertyPointer(this.XFERPTR());
        }
    }

    public FPackageIndex XFER_OBJECT_POINTER()
    {
        return this.XFERPTR();
    }

    public KismetExpression[] ReadExpressionArray(EExprToken endToken)
    {
        List<KismetExpression> newData = new List<KismetExpression>();
        KismetExpression currExpression = null;
        while (currExpression == null || currExpression.Token != endToken)
        {
            if (currExpression != null) newData.Add(currExpression);
            currExpression = ExpressionSerializer.ReadExpression(this);
        }
        return newData.ToArray();
    }
}


================================================
FILE: UAssetAPI/AssetBinaryWriter.cs
================================================
using System;
using System.Collections.Generic;
using System.IO;
using System.Text;
using UAssetAPI.CustomVersions;
using UAssetAPI.Kismet.Bytecode;
using UAssetAPI.UnrealTypes;
using UAssetAPI.Unversioned;

namespace UAssetAPI
{
    /// <summary>
    /// Any binary writer used in the parsing of Unreal file types.
    /// </summary>
    public class UnrealBinaryWriter : BinaryWriter
    {
        public UnrealBinaryWriter() : base()
        {

        }

        public UnrealBinaryWriter(Stream stream) : base(stream)
        {

        }

        public UnrealBinaryWriter(Stream stream, Encoding encoding) : base(stream, encoding)
        {

        }

        public UnrealBinaryWriter(Stream stream, Encoding encoding, bool leaveOpen) : base(stream, encoding, leaveOpen)
        {

        }

        protected byte[] ReverseIfBigEndian(byte[] data)
        {
            if (!BitConverter.IsLittleEndian) Array.Reverse(data);
            return data;
        }

        public override void Write(short value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(ushort value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(int value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(uint value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(long value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(ulong value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(float value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(double value)
        {
            this.Write(ReverseIfBigEndian(BitConverter.GetBytes(value)));
        }

        public override void Write(string value)
        {
            Write(new FString(value));
        }

        public virtual int Write(FString value)
        {
            switch (value?.Value)
            {
                case null:
                    this.Write((int)0);
                    return sizeof(int);
                default:
                    string nullTerminatedStr = value.Value + "\0";
                    this.Write(value.Encoding is UnicodeEncoding ? -nullTerminatedStr.Length : nullTerminatedStr.Length);
                    byte[] actualStrData = value.Encoding.GetBytes(nullTerminatedStr);
                    this.Write(actualStrData);
                    return actualStrData.Length + 4;
            }
        }

        public int WriteUtf8String(FString value)
        {
            switch (value?.Value)
            {
                case null:
                    this.Write((int)0);
                    return sizeof(int);
                default:
                    this.Write(value.Value.Length);
                    byte[] actualStrData = value.Encoding.GetBytes(value.Value);
                    this.Write(actualStrData);
                    return actualStrData.Length + 4;
            }
        }

        public void WriteCustomVersionContainer(ECustomVersionSerializationFormat format, List<CustomVersion> CustomVersionContainer)
        {
            // TODO: support for enum-based custom versions
            int num = CustomVersionContainer == null ? 0 : CustomVersionContainer.Count;

            switch (format)
            {
                case ECustomVersionSerializationFormat.Enums:
                    throw new NotImplementedException("Custom version serialization format Enums is currently unimplemented");
                case ECustomVersionSerializationFormat.Guids:
                    long numLoc = this.BaseStream.Position;
                    Write((int)0);

                    int realNum = 0;
                    for (int i = 0; i < num; i++)
                    {
                        if (CustomVersionContainer[i].Version <= 0 || !CustomVersionContainer[i].IsSerialized) continue;
                        realNum++;
                        Write(CustomVersionContainer[i].Key.ToByteArray());
                        Write(CustomVersionContainer[i].Version);
                        Write(CustomVersionContainer[i].Name);
                    }

                    long endLoc = this.BaseStream.Position;
                    this.Seek((int)numLoc, SeekOrigin.Begin);
                    Write(realNum);
                    this.Seek((int)endLoc, SeekOrigin.Begin);
                    break;
                case ECustomVersionSerializationFormat.Optimized:
                    numLoc = this.BaseStream.Position;
                    Write((int)0);

                    realNum = 0;
                    for (int i = 0; i < num; i++)
                    {
                        if (CustomVersionContainer[i].Version < 0 || !CustomVersionContainer[i].IsSerialized) continue;
                        realNum++;
                        Write(CustomVersionContainer[i].Key.ToByteArray());
                        Write(CustomVersionContainer[i].Version);
                    }

                    endLoc = this.BaseStream.Position;
                    this.Seek((int)numLoc, SeekOrigin.Begin);
                    Write(realNum);
                    this.Seek((int)endLoc, SeekOrigin.Begin);
                    break;
            }
        }
    }

    /// <summary>
    /// Writes primitive data types from Unreal Engine assets.
    /// </summary>
    public class AssetBinaryWriter : UnrealBinaryWriter
    {
        public UAsset Asset;

        public AssetBinaryWriter(UAsset asset) : base()
        {
            Asset = asset;
        }

        public AssetBinaryWriter(Stream stream, UAsset asset) : base(stream)
        {
            Asset = asset;
        }

        public AssetBinaryWriter(Stream stream, Encoding encoding, UAsset asset) : base(stream, encoding)
        {
            Asset = asset;
        }

        public AssetBinaryWriter(Stream stream, Encoding encoding, bool leaveOpen, UAsset asset) : base(stream, encoding, leaveOpen)
        {
            Asset = asset;
        }

        public virtual void Write(FName name)
        {
            if (name == null) name = new FName(Asset, 0, 0);
            this.Write(name.Index);
            this.Write(name.Number);
        }

        public virtual void WritePropertyGuid(Guid? guid)
        {
            if (Asset.HasUnversionedProperties) return;
            if (Asset.ObjectVersion >= ObjectVersion.VER_UE4_PROPERTY_GUID_IN_PROPERTY_TAG)
            {
                Write(guid != null);
                if (guid != null) Write(((Guid)guid).ToByteArray());
            }
        }

        public virtual void Write(FObjectThumbnail thumbnail)
        {
            Write(thumbnail.Width);
            Write(thumbnail.Height);
            Write(thumbnail.CompressedImageData.Length);
            if (thumbnail.CompressedImageData.Length > 0)
                Write(thumbnail.CompressedImageData);
        }

        public virtual void Write(FLocMetadataObject metadataObject)
        {
            Write(metadataObject.Values.Count);
            if (metadataObject.Values.Count > 0)
                throw new NotImplementedException("TODO: implement Write(FLocMetadataObject)");
        }

        /*
        !!!!!

        THE FOLLOWING METHODS ARE INTENDED ONLY TO BE USED IN PARSING KISMET BYTECODE; PLEASE DO NOT USE THEM FOR ANY OTHER PURPOSE!

        !!!!!
        */

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFERSTRING(string val)
        {
            long startMetric = this.BaseStream.Position;
            this.Write(Encoding.UTF8.GetBytes(val + "\0"));
            return (int)(this.BaseStream.Position - startMetric);
        }

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFERUNICODESTRING(string val)
        {
            long startMetric = this.BaseStream.Position;
            this.Write(Encoding.Unicode.GetBytes(val + "\0"));
            return (int)(this.BaseStream.Position - startMetric);
        }

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFERNAME(FName val)
        {
            this.Write(val);
            return 12; // FScriptName's iCode offset is 12 bytes, not 8
        }

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFER_FUNC_NAME(FName val)
        {
            return this.XFERNAME(val);
        }

        private static readonly int PointerSize = sizeof(ulong);

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFERPTR(FPackageIndex val)
        {
            this.Write(val?.Index ?? 0);
            return PointerSize; // For the iCode offset, we return the size of a pointer in memory rather than the size of an FPackageIndex on disk
        }

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFER_FUNC_POINTER(FPackageIndex val)
        {
            return this.XFERPTR(val);
        }

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFER_PROP_POINTER(KismetPropertyPointer val)
        {
            if (Asset.GetCustomVersion<FReleaseObjectVersion>() >= FReleaseObjectVersion.FFieldPathOwnerSerialization)
            {
                this.Write(val.New.Path.Length);
                for (int i = 0; i < val.New.Path.Length; i++)
                {
                    this.XFERNAME(val.New.Path[i]);
                }
                this.XFER_OBJECT_POINTER(val.New.ResolvedOwner);
            }
            else
            {
                this.XFERPTR(val.Old);
            }
            return PointerSize;
        }

        /// <summary>This method is intended only to be used in parsing Kismet bytecode; please do not use it for any other purpose!</summary>
        public int XFER_OBJECT_POINTER(FPackageIndex val)
        {
            return this.XFERPTR(val);
        }
    }
}


================================================
FILE: UAssetAPI/CRCGenerator.cs
================================================
using System;
using System.Text;
using UAssetAPI.UnrealTypes;

namespace UAssetAPI;

public static class CRCGenerator
{
    public static uint GenerateHash(FString text, bool disableCasePreservingHash, bool version420 = false)
    {
        return GenerateHash(text?.Value, text?.Encoding, disableCasePreservingHash, version420);
    }

    public static uint GenerateHash(string text, bool disableCasePreservingHash, bool version420 = false)
    {
        return GenerateHash(text, Encoding.UTF8, disableCasePreservingHash, version420);
    }

    public static uint GenerateHash(string text, Encoding encoding, bool disableCasePreservingHash, bool version420 = false)
    {
        uint algor1 = Strihash_DEPRECATED(text, encoding, version420);
        uint algor2 = disableCasePreservingHash ? 0 : StrCrc32(text);
        return (algor1 & 0xFFFF) | ((algor2 & 0xFFFF) << 16);
    }

    public static char ToUpper(char input)
    {
        return (char)((uint)input - ((((uint)input - 'a' < 26u) ? 1 : 0) << 5));
    }

    public static char ToUpperVersion420(char input)
    {
        return (char)((input < 256 ? (uint)unchecked((sbyte)input) : (uint)input) - ((((uint)input - 'a' < 26u) ? 1 : 0) << 5));
    }

    public static string ToUpper(string input)
    {
        var res = "";
        foreach (char x in input) res += ToUpper(x); // todo: revise for better perf if needed
        return res;
    }

    public static char ToLower(char input)
    {
        return (char)((uint)input + ((((uint)input - 'A' < 26u) ? 1 : 0) << 5));
    }

    public static string ToLower(string input, bool coalesceToSlash = false)
    {
        var res = "";
        foreach (char x in input)
        {
            char chosenX = x;
            if (coalesceToSlash && (chosenX == '.' || chosenX == ':')) chosenX = '/';
            res += ToLower(chosenX); // todo: revise for better perf if needed
        }
        return res;
    }

    public static FString ToLower(FString input, bool coalesceToSlash = false)
    {
        FString output = (FString)input.Clone();
        output.Value = ToLower(output.Value, coalesceToSlash);
        return output;
    }

    public static uint Strihash_DEPRECATED(string text, Encoding encoding, bool version420 = false)
    {
        uint hash = 0;
        byte[] rawDataForCharacter;
        for (int i = 0; i < text.Length; i++)
        {
            var next = Math.Min(i + 1, text.Length - 1);
            if (char.IsHighSurrogate(text[i]) && next != i && char.IsLowSurrogate(text[next]))
            {
                rawDataForCharacter = encoding.GetBytes( new [] { text[i], text[++i] });
            }
            else
            {
                char B = !version420 ? ToUpper(text[i]) : ToUpperVersion420(text[i]);
                rawDataForCharacter = encoding.GetBytes(new [] { B });
            }

            foreach (byte rawByte in rawDataForCharacter)
            {
                hash = ((hash >> 8) & 0x00FFFFFF) ^ CRCTable_DEPRECATED[(hash ^ rawByte) & 0x000000FF];
            }
        }
        return hash;
    }

    // Accurate as-is for both WIDECHAR and ANSICHAR
    public static uint StrCrc32(string text, uint CRC = 0)
    {
        CRC = ~CRC;
        for (int i = 0; i < text.Length; i++)
        {
            char Ch = text[i];
            CRC = (CRC >> 8) ^ CRCTablesSB8[0, (CRC ^ Ch) & 0xFF];
            Ch >>= 8;
            CRC = (CRC >> 8) ^ CRCTablesSB8[0, (CRC ^ Ch) & 0xFF];
            Ch >>= 8;
            CRC = (CRC >> 8) ^ CRCTablesSB8[0, (CRC ^ Ch) & 0xFF];
            Ch >>= 8;
            CRC = (CRC >> 8) ^ CRCTablesSB8[0, (CRC ^ Ch) & 0xFF];
        }
        return ~CRC;
    }

    public static readonly uint[] CRCTable_DEPRECATED =
    [
        0x00000000, 0x04C11DB7, 0x09823B6E, 0x0D4326D9, 0x130476DC, 0x17C56B6B, 0x1A864DB2, 0x1E475005, 0x2608EDB8, 0x22C9F00F, 0x2F8AD6D6, 0x2B4BCB61, 0x350C9B64, 0x31CD86D3, 0x3C8EA00A, 0x384FBDBD,
        0x4C11DB70, 0x48D0C6C7, 0x4593E01E, 0x4152FDA9, 0x5F15ADAC, 0x5BD4B01B, 0x569796C2, 0x52568B75, 0x6A1936C8, 0x6ED82B7F, 0x639B0DA6, 0x675A1011, 0x791D4014, 0x7DDC5DA3, 0x709F7B7A, 0x745E66CD,
        0x9823B6E0, 0x9CE2AB57, 0x91A18D8E, 0x95609039, 0x8B27C03C, 0x8FE6DD8B, 0x82A5FB52, 0x8664E6E5, 0xBE2B5B58, 0xBAEA46EF, 0xB7A96036, 0xB3687D81, 0xAD2F2D84, 0xA9EE3033, 0xA4AD16EA, 0xA06C0B5D,
        0xD4326D90, 0xD0F37027, 0xDDB056FE, 0xD9714B49, 0xC7361B4C, 0xC3F706FB, 0xCEB42022, 0xCA753D95, 0xF23A8028, 0xF6FB9D9F, 0xFBB8BB46, 0xFF79A6F1, 0xE13EF6F4, 0xE5FFEB43, 0xE8BCCD9A, 0xEC7DD02D,
        0x34867077, 0x30476DC0, 0x3D044B19, 0x39C556AE, 0x278206AB, 0x23431B1C, 0x2E003DC5, 0x2AC12072, 0x128E9DCF, 0x164F8078, 0x1B0CA6A1, 0x1FCDBB16, 0x018AEB13, 0x054BF6A4, 0x0808D07D, 0x0CC9CDCA,
        0x7897AB07, 0x7C56B6B0, 0x71159069, 0x75D48DDE, 0x6B93DDDB, 0x6F52C06C, 0x6211E6B5, 0x66D0FB02, 0x5E9F46BF, 0x5A5E5B08, 0x571D7DD1, 0x53DC6066, 0x4D9B3063, 0x495A2DD4, 0x44190B0D, 0x40D816BA,
        0xACA5C697, 0xA864DB20, 0xA527FDF9, 0xA1E6E04E, 0xBFA1B04B, 0xBB60ADFC, 0xB6238B25, 0xB2E29692, 0x8AAD2B2F, 0x8E6C3698, 0x832F1041, 0x87EE0DF6, 0x99A95DF3, 0x9D684044, 0x902B669D, 0x94EA7B2A,
        0xE0B41DE7, 0xE4750050, 0xE9362689, 0xEDF73B3E, 0xF3B06B3B, 0xF771768C, 0xFA325055, 0xFEF34DE2, 0xC6BCF05F, 0xC27DEDE8, 0xCF3ECB31, 0xCBFFD686, 0xD5B88683, 0xD1799B34, 0xDC3ABDED, 0xD8FBA05A,
        0x690CE0EE, 0x6DCDFD59, 0x608EDB80, 0x644FC637, 0x7A089632, 0x7EC98B85, 0x738AAD5C, 0x774BB0EB, 0x4F040D56, 0x4BC510E1, 0x46863638, 0x42472B8F, 0x5C007B8A, 0x58C1663D, 0x558240E4, 0x51435D53,
        0x251D3B9E, 0x21DC2629, 0x2C9F00F0, 0x285E1D47, 0x36194D42, 0x32D850F5, 0x3F9B762C, 0x3B5A6B9B, 0x0315D626, 0x07D4CB91, 0x0A97ED48, 0x0E56F0FF, 0x1011A0FA, 0x14D0BD4D, 0x19939B94, 0x1D528623,
        0xF12F560E, 0xF5EE4BB9, 0xF8AD6D60, 0xFC6C70D7, 0xE22B20D2, 0xE6EA3D65, 0xEBA91BBC, 0xEF68060B, 0xD727BBB6, 0xD3E6A601, 0xDEA580D8, 0xDA649D6F, 0xC423CD6A, 0xC0E2D0DD, 0xCDA1F604, 0xC960EBB3,
        0xBD3E8D7E, 0xB9FF90C9, 0xB4BCB610, 0xB07DABA7, 0xAE3AFBA2, 0xAAFBE615, 0xA7B8C0CC, 0xA379DD7B, 0x9B3660C6, 0x9FF77D71, 0x92B45BA8, 0x9675461F, 0x8832161A, 0x8CF30BAD, 0x81B02D74, 0x857130C3,
        0x5D8A9099, 0x594B8D2E, 0x5408ABF7, 0x50C9B640, 0x4E8EE645, 0x4A4FFBF2, 0x470CDD2B, 0x43CDC09C, 0x7B827D21, 0x7F436096, 0x7200464F, 0x76C15BF8, 0x68860BFD, 0x6C47164A, 0x61043093, 0x65C52D24,
        0x119B4BE9, 0x155A565E, 0x18197087, 0x1CD86D30, 0x029F3D35, 0x065E2082, 0x0B1D065B, 0x0FDC1BEC, 0x3793A651, 0x3352BBE6, 0x3E119D3F, 0x3AD08088, 0x2497D08D, 0x2056CD3A, 0x2D15EBE3, 0x29D4F654,
        0xC5A92679, 0xC1683BCE, 0xCC2B1D17, 0xC8EA00A0, 0xD6AD50A5, 0xD26C4D12, 0xDF2F6BCB, 0xDBEE767C, 0xE3A1CBC1, 0xE760D676, 0xEA23F0AF, 0xEEE2ED18, 0xF0A5BD1D, 0xF464A0AA, 0xF9278673, 0xFDE69BC4,
        0x89B8FD09, 0x8D79E0BE, 0x803AC667, 0x84FBDBD0, 0x9ABC8BD5, 0x9E7D9662, 0x933EB0BB, 0x97FFAD0C, 0xAFB010B1, 0xAB710D06, 0xA6322BDF, 0xA2F33668, 0xBCB4666D, 0xB8757BDA, 0xB5365D03, 0xB1F740B4
    ];

    public static readonly uint[,] CRCTablesSB8 = new uint[8, 256]
    {
        {
            0x00000000, 0x77073096, 0xee0e612c, 0x990951ba, 0x076dc419, 0x706af48f, 0xe963a535, 0x9e6495a3, 0x0edb8832, 0x79dcb8a4, 0xe0d5e91e, 0x97d2d988, 0x09b64c2b, 0x7eb17cbd, 0xe7b82d07, 0x90bf1d91,
            0x1db71064, 0x6ab020f2, 0xf3b97148, 0x84be41de, 0x1adad47d, 0x6ddde4eb, 0xf4d4b551, 0x83d385c7, 0x136c9856, 0x646ba8c0, 0xfd62f97a, 0x8a65c9ec, 0x14015c4f, 0x63066cd9, 0xfa0f3d63, 0x8d080df5,
            0x3b6e20c8, 0x4c69105e, 0xd56041e4, 0xa2677172, 0x3c03e4d1, 0x4b04d447, 0xd20d85fd, 0xa50ab56b, 0x35b5a8fa, 0x42b2986c, 0xdbbbc9d6, 0xacbcf940, 0x32d86ce3, 0x45df5c75, 0xdcd60dcf, 0xabd13d59,
            0x26d930ac, 0x51de003a, 0xc8d75180, 0xbfd06116, 0x21b4f4b5, 0x56b3c423, 0xcfba9599, 0xb8bda50f, 0x2802b89e, 0x5f058808, 0xc60cd9b2, 0xb10be924, 0x2f6f7c87, 0x58684c11, 0xc1611dab, 0xb6662d3d,
            0x76dc4190, 0x01db7106, 0x98d220bc, 0xefd5102a, 0x71b18589, 0x06b6b51f, 0x9fbfe4a5, 0xe8b8d433, 0x7807c9a2, 0x0f00f934, 0x9609a88e, 0xe10e9818, 0x7f6a0dbb, 0x086d3d2d, 0x91646c97, 0xe6635c01,
            0x6b6b51f4, 0x1c6c6162, 0x856530d8, 0xf262004e, 0x6c0695ed, 0x1b01a57b, 0x8208f4c1, 0xf50fc457, 0x65b0d9c6, 0x12b7e950, 0x8bbeb8ea, 0xfcb9887c, 0x62dd1ddf, 0x15da2d49, 0x8cd37cf3, 0xfbd44c65,
            0x4db26158, 0x3ab551ce, 0xa3bc0074, 0xd4bb30e2, 0x4adfa541, 0x3dd895d7, 0xa4d1c46d, 0xd3d6f4fb, 0x4369e96a, 0x346ed9fc, 0xad678846, 0xda60b8d0, 0x44042d73, 0x33031de5, 0xaa0a4c5f, 0xdd0d7cc9,
            0x5005713c, 0x270241aa, 0xbe0b1010, 0xc90c2086, 0x5768b525, 0x206f85b3, 0xb966d409, 0xce61e49f, 0x5edef90e, 0x29d9c998, 0xb0d09822, 0xc7d7a8b4, 0x59b33d17, 0x2eb40d81, 0xb7bd5c3b, 0xc0ba6cad,
            0xedb88320, 0x9abfb3b6, 0x03b6e20c, 0x74b1d29a, 0xead54739, 0x9dd277af, 0x04db2615, 0x73dc1683, 0xe3630b12, 0x94643b84, 0x0d6d6a3e, 0x7a6a5aa8, 0xe40ecf0b, 0x9309ff9d, 0x0a00ae27, 0x7d079eb1,
            0xf00f9344, 0x8708a3d2, 0x1e01f268, 0x6906c2fe, 0xf762575d, 0x806567cb, 0x196c3671, 0x6e6b06e7, 0xfed41b76, 0x89d32be0, 0x10da7a5a, 0x67dd4acc, 0xf9b9df6f, 0x8ebeeff9, 0x17b7be43, 0x60b08ed5,
            0xd6d6a3e8, 0xa1d1937e, 0x38d8c2c4, 0x4fdff252, 0xd1bb67f1, 0xa6bc5767, 0x3fb506dd, 0x48b2364b, 0xd80d2bda, 0xaf0a1b4c, 0x36034af6, 0x41047a60, 0xdf60efc3, 0xa867df55, 0x316e8eef, 0x4669be79,
            0xcb61b38c, 0xbc66831a, 0x256fd2a0, 0x5268e236, 0xcc0c7795, 0xbb0b4703, 0x220216b9, 0x5505262f, 0xc5ba3bbe, 0xb2bd0b28, 0x2bb45a92, 0x5cb36a04, 0xc2d7ffa7, 0xb5d0cf31, 0x2cd99e8b, 0x5bdeae1d,
            0x9b64c2b0, 0xec63f226, 0x756aa39c, 0x026d930a, 0x9c0906a9, 0xeb0e363f, 0x72076785, 0x05005713, 0x95bf4a82, 0xe2b87a14, 0x7bb12bae, 0x0cb61b38, 0x92d28e9b, 0xe5d5be0d, 0x7cdcefb7, 0x0bdbdf21,
            0x86d3d2d4, 0xf1d4e242, 0x68ddb3f8, 0x1fda836e, 0x81be16cd, 0xf6b9265b, 0x6fb077e1, 0x18b74777, 0x88085ae6, 0xff0f6a70, 0x66063bca, 0x11010b5c, 0x8f659eff, 0xf862ae69, 0x616bffd3, 0x166ccf45,
            0xa00ae278, 0xd70dd2ee, 0x4e048354, 0x3903b3c2, 0xa7672661, 0xd06016f7, 0x4969474d, 0x3e6e77db, 0xaed16a4a, 0xd9d65adc, 0x40df0b66, 0x37d83bf0, 0xa9bcae53, 0xdebb9ec5, 0x47b2cf7f, 0x30b5ffe9,
            0xbdbdf21c, 0xcabac28a, 0x53b39330, 0x24b4a3a6, 0xbad03605, 0xcdd70693, 0x54de5729, 0x23d967bf, 0xb3667a2e, 0xc4614ab8, 0x5d681b02, 0x2a6f2b94, 0xb40bbe37, 0xc30c8ea1, 0x5a05df1b, 0x2d02ef8d
        },
        {
            0x00000000, 0x191b3141, 0x32366282, 0x2b2d53c3, 0x646cc504, 0x7d77f445, 0x565aa786, 0x4f4196c7, 0xc8d98a08, 0xd1c2bb49, 0xfaefe88a, 0xe3f4d9cb, 0xacb54f0c, 0xb5ae7e4d, 0x9e832d8e, 0x87981ccf,
            0x4ac21251, 0x53d92310, 0x78f470d3, 0x61ef4192, 0x2eaed755, 0x37b5e614, 0x1c98b5d7, 0x05838496, 0x821b9859, 0x9b00a918, 0xb02dfadb, 0xa936cb9a, 0xe6775d5d, 0xff6c6c1c, 0xd4413fdf, 0xcd5a0e9e,
            0x958424a2, 0x8c9f15e3, 0xa7b24620, 0xbea97761, 0xf1e8e1a6, 0xe8f3d0e7, 0xc3de8324, 0xdac5b265, 0x5d5daeaa, 0x44469feb, 0x6f6bcc28, 0x7670fd69, 0x39316bae, 0x202a5aef, 0x0b07092c, 0x121c386d,
            0xdf4636f3, 0xc65d07b2, 0xed705471, 0xf46b6530, 0xbb2af3f7, 0xa231c2b6, 0x891c9175, 0x9007a034, 0x179fbcfb, 0x0e848dba, 0x25a9de79, 0x3cb2ef38, 0x73f379ff, 0x6ae848be, 0x41c51b7d, 0x58de2a3c,
            0xf0794f05, 0xe9627e44, 0xc24f2d87, 0xdb541cc6, 0x94158a01, 0x8d0ebb40, 0xa623e883, 0xbf38d9c2, 0x38a0c50d, 0x21bbf44c, 0x0a96a78f, 0x138d96ce, 0x5ccc0009, 0x45d73148, 0x6efa628b, 0x77e153ca,
            0xbabb5d54, 0xa3a06c15, 0x888d3fd6, 0x91960e97, 0xded79850, 0xc7cca911, 0xece1fad2, 0xf5facb93, 0x7262d75c, 0x6b79e61d, 0x4054b5de, 0x594f849f, 0x160e1258, 0x0f152319, 0x243870da, 0x3d23419b,
            0x65fd6ba7, 0x7ce65ae6, 0x57cb0925, 0x4ed03864, 0x0191aea3, 0x188a9fe2, 0x33a7cc21, 0x2abcfd60, 0xad24e1af, 0xb43fd0ee, 0x9f12832d, 0x8609b26c, 0xc94824ab, 0xd05315ea, 0xfb7e4629, 0xe2657768,
            0x2f3f79f6, 0x362448b7, 0x1d091b74, 0x04122a35, 0x4b53bcf2, 0x52488db3, 0x7965de70, 0x607eef31, 0xe7e6f3fe, 0xfefdc2bf, 0xd5d0917c, 0xcccba03d, 0x838a36fa, 0x9a9107bb, 0xb1bc5478, 0xa8a76539,
            0x3b83984b, 0x2298a90a, 0x09b5fac9, 0x10aecb88, 0x5fef5d4f, 0x46f46c0e, 0x6dd93fcd, 0x74c20e8c, 0xf35a1243, 0xea412302, 0xc16c70c1, 0xd8774180, 0x9736d747, 0x8e2de606, 0xa500b5c5, 0xbc1b8484,
            0x71418a1a, 0x685abb5b, 0x4377e898, 0x5a6cd9d9, 0x152d4f1e, 0x0c367e5f, 0x271b2d9c, 0x3e001cdd, 0xb9980012, 0xa0833153, 0x8bae6290, 0x92b553d1, 0xddf4c516, 0xc4eff457, 0xefc2a794, 0xf6d996d5,
            0xae07bce9, 0xb71c8da8, 0x9c31de6b, 0x852aef2a, 0xca6b79ed, 0xd37048ac, 0xf85d1b6f, 0xe1462a2e, 0x66de36e1, 0x7fc507a0, 0x54e85463, 0x4df36522, 0x02b2f3e5, 0x1ba9c2a4, 0x30849167, 0x299fa026,
            0xe4c5aeb8, 0xfdde9ff9, 0xd6f3cc3a, 0xcfe8fd7b, 0x80a96bbc, 0x99b25afd, 0xb29f093e, 0xab84387f, 0x2c1c24b0, 0x350715f1, 0x1e2a4632, 0x07317773, 0x4870e1b4, 0x516bd0f5, 0x7a468336, 0x635db277,
            0xcbfad74e, 0xd2e1e60f, 0xf9ccb5cc, 0xe0d7848d, 0xaf96124a, 0xb68d230b, 0x9da070c8, 0x84bb4189, 0x03235d46, 0x1a386c07, 0x31153fc4, 0x280e0e85, 0x674f9842, 0x7e54a903, 0x5579fac0, 0x4c62cb81,
            0x8138c51f, 0x9823f45e, 0xb30ea79d, 0xaa1596dc, 0xe554001b, 0xfc4f315a, 0xd7626299, 0xce7953d8, 0x49e14f17, 0x50fa7e56, 0x7bd72d95, 0x62cc1cd4, 0x2d8d8a13, 0x3496bb52, 0x1fbbe891, 0x06a0d9d0,
            0x5e7ef3ec, 0x4765c2ad, 0x6c48916e, 0x7553a02f, 0x3a1236e8, 0x230907a9, 0x0824546a, 0x113f652b, 0x96a779e4, 0x8fbc48a5, 0xa4911b66, 0xbd8a2a27, 0xf2cbbce0, 0xebd08da1, 0xc0fdde62, 0xd9e6ef23,
            0x14bce1bd, 0x0da7d0fc, 0x268a833f, 0x3f91b27e, 0x70d024b9, 0x69cb15f8, 0x42e6463b, 0x5bfd777a, 0xdc656bb5, 0xc57e5af4, 0xee530937, 0xf7483876, 0xb809aeb1, 0xa1129ff0, 0x8a3fcc33, 0x9324fd72
        },
        {
            0x00000000, 0x01c26a37, 0x0384d46e, 0x0246be59, 0x0709a8dc, 0x06cbc2eb, 0x048d7cb2, 0x054f1685, 0x0e1351b8, 0x0fd13b8f, 0x0d9785d6, 0x0c55efe1, 0x091af964, 0x08d89353, 0x0a9e2d0a, 0x0b5c473d,
            0x1c26a370, 0x1de4c947, 0x1fa2771e, 0x1e601d29, 0x1b2f0bac, 0x1aed619b, 0x18abdfc2, 0x1969b5f5, 0x1235f2c8, 0x13f798ff, 0x11b126a6, 0x10734c91, 0x153c5a14, 0x14fe3023, 0x16b88e7a, 0x177ae44d,
            0x384d46e0, 0x398f2cd7, 0x3bc9928e, 0x3a0bf8b9, 0x3f44ee3c, 0x3e86840b, 0x3cc03a52, 0x3d025065, 0x365e1758, 0x379c7d6f, 0x35dac336, 0x3418a901, 0x3157bf84, 0x3095d5b3, 0x32d36bea, 0x331101dd,
            0x246be590, 0x25a98fa7, 0x27ef31fe, 0x262d5bc9, 0x23624d4c, 0x22a0277b, 0x20e69922, 0x2124f315, 0x2a78b428, 0x2bbade1f, 0x29fc6046, 0x283e0a71, 0x2d711cf4, 0x2cb376c3, 0x2ef5c89a, 0x2f37a2ad,
            0x709a8dc0, 0x7158e7f7, 0x731e59ae, 0x72dc3399, 0x7793251c, 0x76514f2b, 0x7417f172, 0x75d59b45, 0x7e89dc78, 0x7f4bb64f, 0x7d0d0816, 0x7ccf6221, 0x798074a4, 0x78421e93, 0x7a04a0ca, 0x7bc6cafd,
            0x6cbc2eb0, 0x6d7e4487, 0x6f38fade, 0x6efa90e9, 0x6bb5866c, 0x6a77ec5b, 0x68315202, 0x69f33835, 0x62af7f08, 0x636d153f, 0x612bab66, 0x60e9c151, 0x65a6d7d4, 0x6464bde3, 0x662203ba, 0x67e0698d,
            0x48d7cb20, 0x4915a117, 0x4b531f4e, 0x4a917579, 0x4fde63fc, 0x4e1c09cb, 0x4c5ab792, 0x4d98dda5, 0x46c49a98, 0x4706f0af, 0x45404ef6, 0x448224c1, 0x41cd3244, 0x400f5873, 0x4249e62a, 0x438b8c1d,
            0x54f16850, 0x55330267, 0x5775bc3e, 0x56b7d609, 0x53f8c08c, 0x523aaabb, 0x507c14e2, 0x51be7ed5, 0x5ae239e8, 0x5b2053df, 0x5966ed86, 0x58a487b1, 0x5deb9134, 0x5c29fb03, 0x5e6f455a, 0x5fad2f6d,
            0xe1351b80, 0xe0f771b7, 0xe2b1cfee, 0xe373a5d9, 0xe63cb35c, 0xe7fed96b, 0xe5b86732, 0xe47a0d05, 0xef264a38, 0xeee4200f, 0xeca29e56, 0xed60f461, 0xe82fe2e4, 0xe9ed88d3, 0xebab368a, 0xea695cbd,
            0xfd13b8f0, 0xfcd1d2c7, 0xfe976c9e, 0xff5506a9, 0xfa1a102c, 0xfbd87a1b, 0xf99ec442, 0xf85cae75, 0xf300e948, 0xf2c2837f, 0xf0843d26, 0xf1465711, 0xf4094194, 0xf5cb2ba3, 0xf78d95fa, 0xf64fffcd,
            0xd9785d60, 0xd8ba3757, 0xdafc890e, 0xdb3ee339, 0xde71f5bc, 0xdfb39f8b, 0xddf521d2, 0xdc374be5, 0xd76b0cd8, 0xd6a966ef, 0xd4efd8b6, 0xd52db281, 0xd062a404, 0xd1a0ce33, 0xd3e6706a, 0xd2241a5d,
            0xc55efe10, 0xc49c9427, 0xc6da2a7e, 0xc7184049, 0xc25756cc, 0xc3953cfb, 0xc1d382a2, 0xc011e895, 0xcb4dafa8, 0xca8fc59f, 0xc8c97bc6, 0xc90b11f1, 0xcc440774, 0xcd866d43, 0xcfc0d31a, 0xce02b92d,
            0x91af9640, 0x906dfc77, 0x922b422e, 0x93e92819, 0x96a63e9c, 0x976454ab, 0x9522eaf2, 0x94e080c5, 0x9fbcc7f8, 0x9e7eadcf, 0x9c381396, 0x9dfa79a1, 0x98b56f24, 0x99770513, 0x9b31bb4a, 0x9af3d17d,
            0x8d893530, 0x8c4b5f07, 0x8e0de15e, 0x8fcf8b69, 0x8a809dec, 0x8b42f7db, 0x89044982, 0x88c623b5, 0x839a6488, 0x82580ebf, 0x801eb0e6, 0x81dcdad1, 0x8493cc54, 0x8551a663, 0x8717183a, 0x86d5720d,
            0xa9e2d0a0, 0xa820ba97, 0xaa6604ce, 0xaba46ef9, 0xaeeb787c, 0xaf29124b, 0xad6fac12, 0xacadc625, 0xa7f18118, 0xa633eb2f, 0xa4755576, 0xa5b73f41, 0xa0f829c4, 0xa13a43f3, 0xa37cfdaa, 0xa2be979d,
            0xb5c473d0, 0xb40619e7, 0xb640a7be, 0xb782cd89, 0xb2cddb0c, 0xb30fb13b, 0xb1490f62, 0xb08b6555, 0xbbd72268, 0xba15485f, 0xb853f606, 0xb9919c31, 0xbcde8ab4, 0xbd1ce083, 0xbf5a5eda, 0xbe9834ed
        },
        {
            0x00000000, 0xb8bc6765, 0xaa09c88b, 0x12b5afee, 0x8f629757, 0x37def032, 0x256b5fdc, 0x9dd738b9, 0xc5b428ef, 0x7d084f8a, 0x6fbde064, 0xd7018701, 0x4ad6bfb8, 0xf26ad8dd, 0xe0df7733, 0x58631056,
            0x5019579f, 0xe8a530fa, 0xfa109f14, 0x42acf871, 0xdf7bc0c8, 0x67c7a7ad, 0x75720843, 0xcdce6f26, 0x95ad7f70, 0x2d111815, 0x3fa4b7fb, 0x8718d09e, 0x1acfe827, 0xa2738f42, 0xb0c620ac, 0x087a47c9,
            0xa032af3e, 0x188ec85b, 0x0a3b67b5, 0xb28700d0, 0x2f503869, 0x97ec5f0c, 0x8559f0e2, 0x3de59787, 0x658687d1, 0xdd3ae0b4, 0xcf8f4f5a, 0x7733283f, 0xeae41086, 0x525877e3, 0x40edd80d, 0xf851bf68,
            0xf02bf8a1, 0x48979fc4, 0x5a22302a, 0xe29e574f, 0x7f496ff6, 0xc7f50893, 0xd540a77d, 0x6dfcc018, 0x359fd04e, 0x8d23b72b, 0x9f9618c5, 0x272a7fa0, 0xbafd4719, 0x0241207c, 0x10f48f92, 0xa848e8f7,
            0x9b14583d, 0x23a83f58, 0x311d90b6, 0x89a1f7d3, 0x1476cf6a, 0xaccaa80f, 0xbe7f07e1, 0x06c36084, 0x5ea070d2, 0xe61c17b7, 0xf4a9b859, 0x4c15df3c, 0xd1c2e785, 0x697e80e0, 0x7bcb2f0e, 0xc377486b,
            0xcb0d0fa2, 0x73b168c7, 0x6104c729, 0xd9b8a04c, 0x446f98f5, 0xfcd3ff90, 0xee66507e, 0x56da371b, 0x0eb9274d, 0xb6054028, 0xa4b0efc6, 0x1c0c88a3, 0x81dbb01a, 0x3967d77f, 0x2bd27891, 0x936e1ff4,
            0x3b26f703, 0x839a9066, 0x912f3f88, 0x299358ed, 0xb4446054, 0x0cf80731, 0x1e4da8df, 0xa6f1cfba, 0xfe92dfec, 0x462eb889, 0x549b1767, 0xec277002, 0x71f048bb, 0xc94c2fde, 0xdbf98030, 0x6345e755,
            0x6b3fa09c, 0xd383c7f9, 0xc1366817, 0x798a0f72, 0xe45d37cb, 0x5ce150ae, 0x4e54ff40, 0xf6e89825, 0xae8b8873, 0x1637ef16, 0x048240f8, 0xbc3e279d, 0x21e91f24, 0x99557841, 0x8be0d7af, 0x335cb0ca,
            0xed59b63b, 0x55e5d15e, 0x47507eb0, 0xffec19d5, 0x623b216c, 0xda874609, 0xc832e9e7, 0x708e8e82, 0x28ed9ed4, 0x9051f9b1, 0x82e4565f, 0x3a58313a, 0xa78f0983, 0x1f336ee6, 0x0d86c108, 0xb53aa66d,
            0xbd40e1a4, 0x05fc86c1, 0x1749292f, 0xaff54e4a, 0x322276f3, 0x8a9e1196, 0x982bbe78, 0x2097d91d, 0x78f4c94b, 0xc048ae2e, 0xd2fd01c0, 0x6a4166a5, 0xf7965e1c, 0x4f2a3979, 0x5d9f9697, 0xe523f1f2,
            0x4d6b1905, 0xf5d77e60, 0xe762d18e, 0x5fdeb6eb, 0xc2098e52, 0x7ab5e937, 0x680046d9, 0xd0bc21bc, 0x88df31ea, 0x3063568f, 0x22d6f961, 0x9a6a9e04, 0x07bda6bd, 0xbf01c1d8, 0xadb46e36, 0x15080953,
            0x1d724e9a, 0xa5ce29ff, 0xb77b8611, 0x0fc7e174, 0x9210d9cd, 0x2aacbea8, 0x38191146, 0x80a57623, 0xd8c66675, 0x607a0110, 0x72cfaefe, 0xca73c99b, 0x57a4f122, 0xef189647, 0xfdad39a9, 0x45115ecc,
            0x764dee06, 0xcef18963, 0xdc44268d, 0x64f841e8, 0xf92f7951, 0x41931e34, 0x5326b1da, 0xeb9ad6bf, 0xb3f9c6e9, 0x0b45a18c, 0x19f00e62, 0xa14c6907, 0x3c9b51be, 0x842736db, 0x96929935, 0x2e2efe50,
            0x2654b999, 0x9ee8defc, 0x8c5d7112, 0x34e11677, 0xa9362ece, 0x118a49ab, 0x033fe645, 0xbb838120, 0xe3e09176, 0x5b5cf613, 0x49e959fd, 0xf1553e98, 0x6c820621, 0xd43e6144, 0xc68bceaa, 0x7e37a9cf,
            0xd67f4138, 0x6ec3265d, 0x7c7689b3, 0xc4caeed6, 0x591dd66f, 0xe1a1b10a, 0xf3141ee4, 0x4ba87981, 0x13cb69d7, 0xab770eb2, 0xb9c2a15c, 0x017ec639, 0x9ca9fe80, 0x241599e5, 0x36a0360b, 0x8e1c516e,
            0x866616a7, 0x3eda71c2, 0x2c6fde2c, 0x94d3b949, 0x090481f0, 0xb1b8e695, 0xa30d497b, 0x1bb12e1e, 0x43d23e48, 0xfb6e592d, 0xe9dbf6c3, 0x516791a6, 0xccb0a91f, 0x740cce7a, 0x66b96194, 0xde0506f1
        },
        {
            0x00000000, 0x3d6029b0, 0x7ac05360, 0x47a07ad0, 0xf580a6c0, 0xc8e08f70, 0x8f40f5a0, 0xb220dc10, 0x30704bc1, 0x0d106271, 0x4ab018a1, 0x77d03111, 0xc5f0ed01, 0xf890c4b1, 0xbf30be61, 0x825097d1,
            0x60e09782, 0x5d80be32, 0x1a20c4e2, 0x2740ed52, 0x95603142, 0xa80018f2, 0xefa06222, 0xd2c04b92, 0x5090dc43, 0x6df0f5f3, 0x2a508f23, 0x1730a693, 0xa5107a83, 0x98705333, 0xdfd029e3, 0xe2b00053,
            0xc1c12f04, 0xfca106b4, 0xbb017c64, 0x866155d4, 0x344189c4, 0x0921a074, 0x4e81daa4, 0x73e1f314, 0xf1b164c5, 0xccd14d75, 0x8b7137a5, 0xb6111e15, 0x0431c205, 0x3951ebb5, 0x7ef19165, 0x4391b8d5,
            0xa121b886, 0x9c419136, 0xdbe1ebe6, 0xe681c256, 0x54a11e46, 0x69c137f6, 0x2e614d26, 0x13016496, 0x9151f347, 0xac31daf7, 0xeb91a027, 0xd6f18997, 0x64d15587, 0x59b17c37, 0x1e1106e7, 0x23712f57,
            0x58f35849, 0x659371f9, 0x22330b29, 0x1f532299, 0xad73fe89, 0x9013d739, 0xd7b3ade9, 0xead38459, 0x68831388, 0x55e33a38, 0x124340e8, 0x2f236958, 0x9d03b548, 0xa0639cf8, 0xe7c3e628, 0xdaa3cf98,
            0x3813cfcb, 0x0573e67b, 0x42d39cab, 0x7fb3b51b, 0xcd93690b, 0xf0f340bb, 0xb7533a6b, 0x8a3313db, 0x0863840a, 0x3503adba, 0x72a3d76a, 0x4fc3feda, 0xfde322ca, 0xc0830b7a, 0x872371aa, 0xba43581a,
            0x9932774d, 0xa4525efd, 0xe3f2242d, 0xde920d9d, 0x6cb2d18d, 0x51d2f83d, 0x167282ed, 0x2b12ab5d, 0xa9423c8c, 0x9422153c, 0xd3826fec, 0xeee2465c, 0x5cc29a4c, 0x61a2b3fc, 0x2602c92c, 0x1b62e09c,
            0xf9d2e0cf, 0xc4b2c97f, 0x8312b3af, 0xbe729a1f, 0x0c52460f, 0x31326fbf, 0x7692156f, 0x4bf23cdf, 0xc9a2ab0e, 0xf4c282be, 0xb362f86e, 0x8e02d1de, 0x3c220dce, 0x0142247e, 0x46e25eae, 0x7b82771e,
            0xb1e6b092, 0x8c869922, 0xcb26e3f2, 0xf646ca42, 0x44661652, 0x79063fe2, 0x3ea64532, 0x03c66c82, 0x8196fb53, 0xbcf6d2e3, 0xfb56a833, 0xc6368183, 0x74165d93, 0x49767423, 0x0ed60ef3, 0x33b62743,
            0xd1062710, 0xec660ea0, 0xabc67470, 0x96a65dc0, 0x248681d0, 0x19e6a860, 0x5e46d2b0, 0x6326fb00, 0xe1766cd1, 0xdc164561, 0x9bb63fb1, 0xa6d61601, 0x14f6ca11, 0x2996e3a1, 0x6e369971, 0x5356b0c1,
            0x70279f96, 0x4d47b626, 0x0ae7ccf6, 0x3787e546, 0x85a73956, 0xb8c710e6, 0xff676a36, 0xc2074386, 0x4057d457, 0x7d37fde7, 0x3a978737, 0x07f7ae87, 0xb5d77297, 0x88b75b27, 0xcf1721f7, 0xf2770847,
            0x10c70814, 0x2da721a4, 0x6a075b74, 0x576772c4, 0xe547aed4, 0xd8278764, 0x9f87fdb4, 0xa2e7d404, 0x20b743d5, 0x1dd76a65, 0x5a7710b5, 0x67173905, 0xd537e515, 0xe857cca5, 0xaff7b675, 0x92979fc5,
            0xe915e8db, 0xd475c16b, 0x93d5bbbb, 0xaeb5920b, 0x1c954e1b, 0x21f567ab, 0x66551d7b, 0x5b3534cb, 0xd965a31a, 0xe4058aaa, 0xa3a5f07a, 0x9ec5d9ca, 0x2ce505da, 0x11852c6a, 0x562556ba, 0x6b457f0a,
            0x89f57f59, 0xb49556e9, 0xf3352c39, 0xce550589, 0x7c75d999, 0x4115f029, 0x06b58af9, 0x3bd5a349, 0xb9853498, 0x84e51d28, 0xc34567f8, 0xfe254e48, 0x4c059258, 0x7165bbe8, 0x36c5c138, 0x0ba5e888,
            0x28d4c7df, 0x15b4ee6f, 0x521494bf, 0x6f74bd0f, 0xdd54611f, 0xe03448af, 0xa794327f, 0x9af41bcf, 0x18a48c1e, 0x25c4a5ae, 0x6264df7e, 0x5f04f6ce, 0xed242ade, 0xd044036e, 0x97e479be, 0xaa84500e,
            0x4834505d, 0x755479ed, 0x32f4033d, 0x0f942a8d, 0xbdb4f69d, 0x80d4df2d, 0xc774a5fd, 0xfa148c4d, 0x78441b9c, 0x4524322c, 0x028448fc, 0x3fe4614c, 0x8dc4bd5c, 0xb0a494ec, 0xf704ee3c, 0xca64c78c
        },
        {
            0x00000000, 0xcb5cd3a5, 0x4dc8a10b, 0x869472ae, 0x9b914216, 0x50cd91b3, 0xd659e31d, 0x1d0530b8, 0xec53826d, 0x270f51c8, 0xa19b2366, 0x6ac7f0c3, 0x77c2c07b, 0xbc9e13de, 0x3a0a6170, 0xf156b2d5,
            0x03d6029b, 0xc88ad13e, 0x4e1ea390, 0x85427035, 0x9847408d, 0x531b9328, 0xd58fe186, 0x1ed33223, 0xef8580f6, 0x24d95353, 0xa24d21fd, 0x6911f258, 0x7414c2e0, 0xbf481145, 0x39dc63eb, 0xf280b04e,
            0x07ac0536, 0xccf0d693, 0x4a64a43d, 0x81387798, 0x9c3d4720, 0x57619485, 0xd1f5e62b, 0x1aa9358e, 0xebff875b, 0x20a354fe, 0xa6372650, 0x6d6bf5f5, 0x706ec54d, 0xbb3216e8, 0x3da66446, 0xf6fab7e3,
            0x047a07ad, 0xcf26d408, 0x49b2a6a6, 0x82ee7503, 0x9feb45bb, 0x54b7961e, 0xd223e4b0, 0x197f3715, 0xe82985c0, 0x23755665, 0xa5e124cb, 0x6ebdf76e, 0x73b8c7d6, 0xb8e41473, 0x3e7066dd, 0xf52cb578,
            0x0f580a6c, 0xc404d9c9, 0x4290ab67, 0x89cc78c2, 0x94c9487a, 0x5f959bdf, 0xd901e971, 0x125d3ad4, 0xe30b8801, 0x28575ba4, 0xaec3290a, 0x659ffaaf, 0x789aca17, 0xb3c619b2, 0x35526b1c, 0xfe0eb8b9,
            0x0c8e08f7, 0xc7d2db52, 0x4146a9fc, 0x8a1a7a59, 0x971f4ae1, 0x5c439944, 0xdad7ebea, 0x118b384f, 0xe0dd8a9a, 0x2b81593f, 0xad152b91, 0x6649f834, 0x7b4cc88c, 0xb0101b29, 0x36846987, 0xfdd8ba22,
            0x08f40f5a, 0xc3a8dcff, 0x453cae51, 0x8e607df4, 0x93654d4c, 0x58399ee9, 0xdeadec47, 0x15f13fe2, 0xe4a78d37, 0x2ffb5e92, 0xa96f2c3c, 0x6233ff99, 0x7f36cf21, 0xb46a1c84, 0x32fe6e2a, 0xf9a2bd8f,
            0x0b220dc1, 0xc07ede64, 0x46eaacca, 0x8db67f6f, 0x90b34fd7, 0x5bef9c72, 0xdd7beedc, 0x16273d79, 0xe7718fac, 0x2c2d5c09, 0xaab92ea7, 0x61e5fd02, 0x7ce0cdba, 0xb7bc1e1f, 0x31286cb1, 0xfa74bf14,
            0x1eb014d8, 0xd5ecc77d, 0x5378b5d3, 0x98246676, 0x852156ce, 0x4e7d856b, 0xc8e9f7c5, 0x03b52460, 0xf2e396b5, 0x39bf4510, 0xbf2b37be, 0x7477e41b, 0x6972d4a3, 0xa22e0706, 0x24ba75a8, 0xefe6a60d,
            0x1d661643, 0xd63ac5e6, 0x50aeb748, 0x9bf264ed, 0x86f75455, 0x4dab87f0, 0xcb3ff55e, 0x006326fb, 0xf135942e, 0x3a69478b, 0xbcfd3525, 0x77a1e680, 0x6aa4d638, 0xa1f8059d, 0x276c7733, 0xec30a496,
            0x191c11ee, 0xd240c24b, 0x54d4b0e5, 0x9f886340, 0x828d53f8, 0x49d1805d, 0xcf45f2f3, 0x04192156, 0xf54f9383, 0x3e134026, 0xb8873288, 0x73dbe12d, 0x6eded195, 0xa5820230, 0x2316709e, 0xe84aa33b,
            0x1aca1375, 0xd196c0d0, 0x5702b27e, 0x9c5e61db, 0x815b5163, 0x4a0782c6, 0xcc93f068, 0x07cf23cd, 0xf6999118, 0x3dc542bd, 0xbb513013, 0x700de3b6, 0x6d08d30e, 0xa65400ab, 0x20c07205, 0xeb9ca1a0,
            0x11e81eb4, 0xdab4cd11, 0x5c20bfbf, 0x977c6c1a, 0x8a795ca2, 0x41258f07, 0xc7b1fda9, 0x0ced2e0c, 0xfdbb9cd9, 0x36e74f7c, 0xb0733dd2, 0x7b2fee77, 0x662adecf, 0xad760d6a, 0x2be27fc4, 0xe0beac61,
            0x123e1c2f, 0xd962cf8a, 0x5ff6bd24, 0x94aa6e81, 0x89af5e39, 0x42f38d9c, 0xc467ff32, 0x0f3b2c97, 0xfe6d9e42, 0x35314de7, 0xb3a53f49, 0x78f9ecec, 0x65fcdc54, 0xaea00ff1, 0x28347d5f, 0xe368aefa,
            0x16441b82, 0xdd18c827, 0x5b8cba89, 0x90d0692c, 0x8dd55994, 0x46898a31, 0xc01df89f, 0x0b412b3a, 0xfa1799ef, 0x314b4a4a, 0xb7df38e4, 0x7c83eb41, 0x6186dbf9, 0xaada085c, 0x2c4e7af2, 0xe712a957,
            0x15921919, 0xdececabc, 0x585ab812, 0x93066bb7, 0x8e035b0f, 0x455f88aa, 0xc3cbfa04, 0x089729a1, 0xf9c19b74, 0x329d48d1, 0xb4093a7f, 0x7f55e9da, 0x6250d962, 0xa90c0ac7, 0x2f987869, 0xe4c4abcc
        },
        {
            0x00000000, 0xa6770bb4, 0x979f1129, 0x31e81a9d, 0xf44f2413, 0x52382fa7, 0x63d0353a, 0xc5a73e8e, 0x33ef4e67, 0x959845d3, 0xa4705f4e, 0x020754fa, 0xc7a06a74, 0x61d761c0, 0x503f7b5d, 0xf64870e9,
            0x67de9cce, 0xc1a9977a, 0xf0418de7, 0x56368653, 0x9391b8dd, 0x35e6b369, 0x040ea9f4, 0xa279a240, 0x5431d2a9, 0xf246d91d, 0xc3aec380, 0x65d9c834, 0xa07ef6ba, 0x0609fd0e, 0x37e1e793, 0x9196ec27,
            0xcfbd399c, 0x69ca3228, 0x582228b5, 0xfe552301, 0x3bf21d8f, 0x9d85163b, 0xac6d0ca6, 0x0a1a0712, 0xfc5277fb, 0x5a257c4f, 0x6bcd66d2, 0xcdba6d66, 0x081d53e8, 0xae6a585c, 0x9f8242c1, 0x39f54975,
            0xa863a552, 0x0e14aee6, 0x3ffcb47b, 0x998bbfcf, 0x5c2c8141, 0xfa5b8af5, 0xcbb39068, 0x6dc49bdc, 0x9b8ceb35, 0x3dfbe081, 0x0c13fa1c, 0xaa64f1a8, 0x6fc3cf26, 0xc9b4c492, 0xf85cde0f, 0x5e2bd5bb,
            0x440b7579, 0xe27c7ecd, 0xd3946450, 0x75e36fe4, 0xb044516a, 0x16335ade, 0x27db4043, 0x81ac4bf7, 0x77e43b1e, 0xd19330aa, 0xe07b2a37, 0x460c2183, 0x83ab1f0d, 0x25dc14b9, 0x14340e24, 0xb2430590,
            0x23d5e9b7, 0x85a2e203, 0xb44af89e, 0x123df32a, 0xd79acda4, 0x71edc610, 0x4005dc8d, 0xe672d739, 0x103aa7d0, 0xb64dac64, 0x87a5b6f9, 0x21d2bd4d, 0xe47583c3, 0x42028877, 0x73ea92ea, 0xd59d995e,
            0x8bb64ce5, 0x2dc14751, 0x1c295dcc, 0xba5e5678, 0x7ff968f6, 0xd98e6342, 0xe86679df, 0x4e11726b, 0xb8590282, 0x1e2e0936, 0x2fc613ab, 0x89b1181f, 0x4c162691, 0xea612d25, 0xdb8937b8, 0x7dfe3c0c,
            0xec68d02b, 0x4a1fdb9f, 0x7bf7c102, 0xdd80cab6, 0x1827f438, 0xbe50ff8c, 0x8fb8e511, 0x29cfeea5, 0xdf879e4c, 0x79f095f8, 0x48188f65, 0xee6f84d1, 0x2bc8ba5f, 0x8dbfb1eb, 0xbc57ab76, 0x1a20a0c2,
            0x8816eaf2, 0x2e61e146, 0x1f89fbdb, 0xb9fef06f, 0x7c59cee1, 0xda2ec555, 0xebc6dfc8, 0x4db1d47c, 0xbbf9a495, 0x1d8eaf21, 0x2c66b5bc, 0x8a11be08, 0x4fb68086, 0xe9c18b32, 0xd82991af, 0x7e5e9a1b,
            0xefc8763c, 0x49bf7d88, 0x78576715, 0xde206ca1, 0x1b87522f, 0xbdf0599b, 0x8c184306, 0x2a6f48b2, 0xdc27385b, 0x7a5033ef, 0x4bb82972, 0xedcf22c6, 0x28681c48, 0x8e1f17fc, 0xbff70d61, 0x198006d5,
            0x47abd36e, 0xe1dcd8da, 0xd034c247, 0x7643c9f3, 0xb3e4f77d, 0x1593fcc9, 0x247be654, 0x820cede0, 0x74449d09, 0xd23396bd, 0xe3db8c20, 0x45ac8794, 0x800bb91a, 0x267cb2ae, 0x1794a833, 0xb1e3a387,
            0x20754fa0, 0x86024414, 0xb7ea5e89, 0x119d553d, 0xd43a6bb3, 0x724d6007, 0x43a57a9a, 0xe5d2712e, 0x139a01c7, 0xb5ed0a73, 0x840510ee, 0x22721b5a, 0xe7d525d4, 0x41a22e60, 0x704a34fd, 0xd63d3f49,
            0xcc1d9f8b, 0x6a6a943f, 0x5b828ea2, 0xfdf58516, 0x3852bb98, 0x9e25b02c, 0xafcdaab1, 0x09baa105, 0xfff2d1ec, 0x5985da58, 0x686dc0c5, 0xce1acb71, 0x0bbdf5ff, 0xadcafe4b, 0x9c22e4d6, 0x3a55ef62,
            0xabc30345, 0x0db408f1, 0x3c5c126c, 0x9a2b19d8, 0x5f8c2756, 0xf9fb2ce2, 0xc813367f, 0x6e643dcb, 0x982c4d22, 0x3e5b4696, 0x0fb35c0b, 0xa9c457bf, 0x6c636931, 0xca146285, 0xfbfc7818, 0x5d8b73ac,
            0x03a0a617, 0xa5d7ada3, 0x943fb73e, 0x3248bc8a, 0xf7ef8204, 0x519889b0, 0x6070932d, 0xc6079899, 0x304fe870, 0x9638e3c4, 0xa7d0f959, 0x01a7f2ed, 0xc400cc63, 0x6277c7d7, 0x539fdd4a, 0xf5e8d6fe,
            0x647e3ad9, 0xc209316d, 0xf3e12bf0, 0x55962044, 0x90311eca, 0x3646157e, 0x07ae0fe3, 0xa1d90457, 0x579174be, 0xf1e67f0a, 0xc00e6597, 0x66796e23, 0xa3de50ad, 0x05a95b19, 0x34414184, 0x92364a30
        },
        {
            0x00000000, 0xccaa009e, 0x4225077d, 0x8e8f07e3, 0x844a0efa, 0x48e00e64, 0xc66f0987, 0x0ac50919, 0xd3e51bb5, 0x1f4f1b2b, 0x91c01cc8, 0x5d6a1c56, 0x57af154f, 0x9b0515d1, 0x158a1232, 0xd92012ac,
            0x7cbb312b, 0xb01131b5, 0x3e9e3656, 0xf23436c8, 0xf8f13fd1, 0x345b3f4f, 0xbad438ac, 0x767e3832, 0xaf5e2a9e, 0x63f42a00, 0xed7b2de3, 0x21d12d7d, 0x2b142464, 0xe7be24fa, 0x69312319, 0xa59b2387,
            0xf9766256, 0x35dc62c8, 0xbb53652b, 0x77f965b5, 0x7d3c6cac, 0xb1966c32, 0x3f196bd1, 0xf3b36b4f, 0x2a9379e3, 0xe639797d, 0x68b67e9e, 0xa41c7e00, 0xaed97719, 0x62737787, 0xecfc7064, 0x205670fa,
            0x85cd537d, 0x496753e3, 0xc7e85400, 0x0b42549e, 0x01875d87, 0xcd2d5d19, 0x43a25afa, 0x8f085a64, 0x562848c8, 0x9a824856, 0x140d4fb5, 0xd8a74f2b, 0xd2624632, 0x1ec846ac, 0x9047414f, 0x5ced41d1,
            0x299dc2ed, 0xe537c273, 0x6bb8c590, 0xa712c50e, 0xadd7cc17, 0x617dcc89, 0xeff2cb6a, 0x2358cbf4, 0xfa78d958, 0x36d2d9c6, 0xb85dde25, 0x74f7debb, 0x7e32d7a2, 0xb298d73c, 0x3c17d0df, 0xf0bdd041,
            0x5526f3c6, 0x998cf358, 0x1703f4bb, 0xdba9f425, 0xd16cfd3c, 0x1dc6fda2, 0x9349fa41, 0x5fe3fadf, 0x86c3e873, 0x4a69e8ed, 0xc4e6ef0e, 0x084cef90, 0x0289e689, 0xce23e617, 0x40ace1f4, 0x8c06e16a,
            0xd0eba0bb, 0x1c41a025, 0x92cea7c6, 0x5e64a758, 0x54a1ae41, 0x980baedf, 0x1684a93c, 0xda2ea9a2, 0x030ebb0e, 0xcfa4bb90, 0x412bbc73, 0x8d81bced, 0x8744b5f4, 0x4beeb56a, 0xc561b289, 0x09cbb217,
            0xac509190, 0x60fa910e, 0xee7596ed, 0x22df9673, 0x281a9f6a, 0xe4b09ff4, 0x6a3f9817, 0xa6959889, 0x7fb58a25, 0xb31f8abb, 0x3d908d58, 0xf13a8dc6, 0xfbff84df, 0x37558441, 0xb9da83a2, 0x7570833c,
            0x533b85da, 0x9f918544, 0x111e82a7, 0xddb48239, 0xd7718b20, 0x1bdb8bbe, 0x95548c5d, 0x59fe8cc3, 0x80de9e6f, 0x4c749ef1, 0xc2fb9912, 0x0e51998c, 0x04949095, 0xc83e900b, 0x46b197e8, 0x8a1b9776,
            0x2f80b4f1, 0xe32ab46f, 0x6da5b38c, 0xa10fb312, 0xabcaba0b, 0x6760ba95, 0xe9efbd76, 0x2545bde8, 0xfc65af44, 0x30cfafda, 0xbe40a839, 0x72eaa8a7, 0x782fa1be, 0xb485a120, 0x3a0aa6c3, 0xf6a0a65d,
            0xaa4de78c, 0x66e7e712, 0xe868e0f1, 0x24c2e06f, 0x2e07e976, 0xe2ade9e8, 0x6c22ee0b, 0xa088ee95, 0x79a8fc39, 0xb502fca7, 0x3b8dfb44, 0xf727fbda, 0xfde2f2c3, 0x3148f25d, 0xbfc7f5be, 0x736df520,
            0xd6f6d6a7, 0x1a5cd639, 0x94d3d1da, 0x5879d144, 0x52bcd85d, 0x9e16d8c3, 0x1099df20, 0xdc33dfbe, 0x0513cd12, 0xc9b9cd8c, 0x4736ca6f, 0x8b9ccaf1, 0x8159c3e8, 0x4df3c376, 0xc37cc495, 0x0fd6c40b,
            0x7aa64737, 0xb60c47a9, 0x3883404a, 0xf42940d4, 0xfeec49cd, 0x32464953, 0xbcc94eb0, 0x70634e2e, 0xa9435c82, 0x65e95c1c, 0xeb665bff, 0x27cc5b61, 0x2d095278, 0xe1a352e6, 0x6f2c5505, 0xa386559b,
            0x061d761c, 0xcab77682, 0x44387161, 0x889271ff, 0x825778e6, 0x4efd7878, 0xc0727f9b, 0x0cd87f05, 0xd5f86da9, 0x19526d37, 0x97dd6ad4, 0x5b776a4a, 0x51b26353, 0x9d1863cd, 0x1397642e, 0xdf3d64b0,
            0x83d02561, 0x4f7a25ff, 0xc1f5221c, 0x0d5f2282, 0x079a2b9b, 0xcb302b05, 0x45bf2ce6, 0x89152c78, 0x50353ed4, 0x9c9f3e4a, 0x121039a9, 0xdeba3937, 0xd47f302e, 0x18d530b0, 0x965a3753, 0x5af037cd,
            0xff6b144a, 0x33c114d4, 0xbd4e1337, 0x71e413a9, 0x7b211ab0, 0xb78b1a2e, 0x39041dcd, 0xf5ae1d53, 0x2c8e0fff, 0xe0240f61, 0x6eab0882, 0xa201081c, 0xa8c40105, 0x646e019b, 0xeae10678, 0x264b06e6
        }
    };
}


================================================
FILE: UAssetAPI/CustomVersion.cs
================================================
using System;
using System.Collections.Generic;
using UAssetAPI.UnrealTypes;

namespace UAssetAPI;

/// <summary>
/// A custom version. Controls more specific serialization than the main engine object version does.
/// </summary>
public class CustomVersion : ICloneable
{
    /// <summary>
    /// Static map of custom version GUIDs to the object or enum that they represent in the Unreal Engine. This list is not necessarily exhaustive, so feel free to add to it if need be.
    /// </summary>
    public static readonly Dictionary<Guid, string> GuidToCustomVersionStringMap = new Dictionary<Guid, string>()
    {
        { UnusedCustomVersionKey, "UnusedCustomVersionKey" },
        { UAPUtils.GUID(0xB0D832E4, 0x1F894F0D, 0xACCF7EB7, 0x36FD4AA2), "FBlueprintsObjectVersion" },
        { UAPUtils.GUID(0xE1C64328, 0xA22C4D53, 0xA36C8E86, 0x6417BD8C), "FBuildObjectVersion" },
        { UAPUtils.GUID(0x375EC13C, 0x06E448FB, 0xB50084F0, 0x262A717E), "FCoreObjectVersion" },
        { UAPUtils.GUID(0xE4B068ED, 0xF49442E9, 0xA231DA0B, 0x2E46BB41), "FEditorObjectVersion" },
        { UAPUtils.GUID(0xCFFC743F, 0x43B04480, 0x939114DF, 0x171D2073), "FFrameworkObjectVersion" },
        { UAPUtils.GUID(0xB02B49B5, 0xBB2044E9, 0xA30432B7, 0x52E40360), "FMobileObjectVersion" },
        { UAPUtils.GUID(0xA4E4105C, 0x59A149B5, 0xA7C540C4, 0x547EDFEE), "FNetworkingObjectVersion" },
        { UAPUtils.GUID(0x39C831C9, 0x5AE647DC, 0x9A449C17, 0x3E1C8E7C), "FOnlineObjectVersion" },
        { UAPUtils.GUID(0x78F01B33, 0xEBEA4F98, 0xB9B484EA, 0xCCB95AA2), "FPhysicsObjectVersion" },
        { UAPUtils.GUID(0x6631380F, 0x2D4D43E0, 0x8009CF27, 0x6956A95A), "FPlatformObjectVersion" },
        { UAPUtils.GUID(0x12F88B9F, 0x88754AFC, 0xA67CD90C, 0x383ABD29), "FRenderingObjectVersion" },
        { UAPUtils.GUID(0x7B5AE74C, 0xD2704C10, 0xA9585798, 0x0B212A5A), "FSequencerObjectVersion" },
        { UAPUtils.GUID(0xD7296918, 0x1DD64BDD, 0x9DE264A8, 0x3CC13884), "FVRObjectVersion" },
        { UAPUtils.GUID(0xC2A15278, 0xBFE74AFE, 0x6C1790FF, 0x531DF755), "FLoadTimesObjectVersion" },
        { UAPUtils.GUID(0x6EACA3D4, 0x40EC4CC1, 0xb7868BED, 0x9428FC5), "FGeometryObjectVersion" },
        { UAPUtils.GUID(0x29E575DD, 0xE0A34627, 0x9D10D276, 0x232CDCEA), "FAnimPhysObjectVersion" },
        { UAPUtils.GUID(0xAF43A65D, 0x7FD34947, 0x98733E8E, 0xD9C1BB05), "FAnimObjectVersion" },
        { UAPUtils.GUID(0x6B266CEC, 0x1EC74B8F, 0xA30BE4D9, 0x0942FC07), "FReflectionCaptureObjectVersion" },
        { UAPUtils.GUID(0x0DF73D61, 0xA23F47EA, 0xB72789E9, 0x0C41499A), "FAutomationObjectVersion" },
        { UAPUtils.GUID(0x601D1886, 0xAC644F84, 0xAA16D3DE, 0x0DEAC7D6), "FFortniteMainBranchObjectVersion" },
        { UAPUtils.GUID(0x9DFFBCD6, 0x494F0158, 0xE2211282, 0x3C92A888), "FEnterpriseObjectVersion" },
        { UAPUtils.GUID(0xF2AED0AC, 0x9AFE416F, 0x8664AA7F, 0xFA26D6FC), "FNiagaraObjectVersion" },
        { UAPUtils.GUID(0x174F1F0B, 0xB4C645A5, 0xB13F2EE8, 0xD0FB917D), "FDestructionObjectVersion" },
        { UAPUtils.GUID(0x35F94A83, 0xE258406C, 0xA31809F5, 0x9610247C), "FExternalPhysicsCustomObjectVersion" },
        { UAPUtils.GUID(0xB68FC16E, 0x8B1B42E2, 0xB453215C, 0x058844FE), "FExternalPhysicsMaterialCustomObjectVersion" },
        { UAPUtils.GUID(0xB2E18506, 0x4273CFC2, 0xA54EF4BB, 0x758BBA07), "FCineCameraObjectVersion" },
        { UAPUtils.GUID(0x64F58936, 0xFD1B42BA, 0xBA967289, 0xD5D0FA4E), "FVirtualProductionObjectVersion" },
        { UAPUtils.GUID(0x6f0ed827, 0xa6094895, 0x9c91998d, 0x90180ea4), "FMediaFrameworkObjectVersion" },
        { UAPUtils.GUID(0xAFE08691, 0x3A0D4952, 0xB673673B, 0x7CF22D1E), "FPoseDriverCustomVersion" },
        { UAPUtils.GUID(0xCB8AB0CD, 0xE78C4BDE, 0xA8621393, 0x14E9EF62), "FTempCustomVersion" },
        { UAPUtils.GUID(0x2EB5FDBD, 0x01AC4D10, 0x8136F38F, 0x3393A5DA), "FAnimationCustomVersion" },
        { UAPUtils.GUID(0x717F9EE7, 0xE9B0493A, 0x88B39132, 0x1B388107), "FAssetRegistryVersion" },
        { UAPUtils.GUID(0xFB680AF2, 0x59EF4BA3, 0xBAA819B5, 0x73C8443D), "FClothingAssetCustomVersion" },
        { UAPUtils.GUID(0x9C54D522, 0xA8264FBE, 0x94210746, 0x61B482D0), "FReleaseObjectVersion" },
        { UAPUtils.GUID(0x4A56EB40, 0x10F511DC, 0x92D3347E, 0xB2C96AE7), "FParticleSystemCustomVersion" },
        { UAPUtils.GUID(0xD78A4A00, 0xE8584697, 0xBAA819B5, 0x487D46B4), "FSkeletalMeshCustomVersion" },
        { UAPUtils.GUID(0x5579F886, 0x933A4C1F, 0x83BA087B, 0x6361B92F), "FRecomputeTangentCustomVersion" },
        { UAPUtils.GUID(0x612FBE52, 0xDA53400B, 0x910D4F91, 0x9FB1857C), "FOverlappingVerticesCustomVersion" },
        { UAPUtils.GUID(0x430C4D19, 0x71544970, 0x87699B69, 0xDF90B0E5), "FFoliageCustomVersion" },
        { UAPUtils.GUID(0xaafe32bd, 0x53954c14, 0xb66a5e25, 0x1032d1dd), "FProceduralFoliageCustomVersion" },
        { UAPUtils.GUID(0xab965196, 0x45d808fc, 0xb7d7228d, 0x78ad569e), "FLiveLinkCustomVersion" },
        { UAPUtils.GUID(0xE7086368, 0x6B234C58, 0x84391B70, 0x16265E91), "FFortniteReleaseBranchCustomObjectVersion" },
        { UAPUtils.GUID(0xD89B5E42, 0x24BD4D46, 0x8412ACA8, 0xDF641779), "FUE5ReleaseStreamObjectVersion" },
        { UAPUtils.GUID(0xFCF57AFA, 0x50764283, 0xB9A9E658, 0xFFA02D32), "FNiagaraCustomVersion" },
        { UAPUtils.GUID(0x697DD581, 0xE64f41AB, 0xAA4A51EC, 0xBEB7B628), "FUE5MainStreamObjectVersion" }

        // etc.
    };

    /// <summary>
    /// A GUID that represents an unused custom version.
    /// </summary>
    public static readonly Guid UnusedCustomVersionKey = UAPUtils.GUID(0, 0, 0, 0xF99D40C1);

    /// <summary>
    /// Returns the name of the object or enum that a custom version GUID represents, as specified in <see cref="GuidToCustomVersionStringMap"/>.
    /// </summary>
    /// <param name="guid">A GUID that represents a custom version.</param>
    /// <returns>A string that represents the friendly name of the corresponding custom version.</returns>
    public static string GetCustomVersionFriendlyNameFromGuid(Guid guid)
    {
        return GuidToCustomVersionStringMap.ContainsKey(guid) ? GuidToCustomVersionStringMap[guid] : null;
    }

    /// <summary>
    /// Returns the GUID of the custom version that the object or enum name provided represents.
    /// </summary>
    /// <param name="friendlyName">The name of a custom version object or enum.</param>
    /// <returns>A GUID that represents the custom version</returns>
    public static Guid GetCustomVersionGuidFromFriendlyName(string friendlyName)
    {
        foreach (KeyValuePair<Guid, string> entry in GuidToCustomVersionStringMap)
        {
            if (entry.Value == friendlyName) return entry.Key;
        }
        return UnusedCustomVersionKey;
    }

    public FString Name = null;
    public Guid Key;
    public string FriendlyName = null;
    public int Version;
    public bool IsSerialized = true;

    public CustomVersion SetIsSerialized(bool val)
    {
        this.IsSerialized = val;
        return this;
    }

    public object Clone()
    {
        return new CustomVersion(Key, Version)
        {
            Name = Name,
            FriendlyName = FriendlyName,
            IsSerialized = IsSerialized
        };
    }

    /// <summary>
    /// Initializes a new instance of the <see cref="CustomVersion"/> class given an object or enum name and a version number.
    /// </summary>
    /// <param name="friendlyName">The friendly name to use when initializing this custom version.</param>
    /// <param name="version">The version number to use when initializing this custom version.</param>
    public CustomVersion(string friendlyName, int version)
    {
        Key = GetCustomVersionGuidFromFriendlyName(friendlyName);
        FriendlyName = friendlyName;
        Version = version;
    }

    /// <summary>
    /// Initializes a new instance of the <see cref="CustomVersion"/> class given a custom version GUID and a version number.
    /// </summary>
    /// <param name="key">The GUID to use when initializing this custom version.</param>
    /// <param name="version">The version number to use when initializing this custom version.</param>
    public CustomVersion(Guid key, int version)
    {
        Key = key;
        if (GuidToCustomVersionStringMap.ContainsKey(key)) FriendlyName = GuidToCustomVersionStringMap[key];
        Version = version;
    }

    /// <summary>
    /// Initializes a new instance of the <see cref="CustomVersion"/> class.
    /// </summary>
    public CustomVersion()
    {
        Key = UnusedCustomVersionKey;
        Version = 0;
    }
}

================================================
FILE: UAssetAPI/CustomVersions/CustomVersions.cs
================================================
using System;
using UAssetAPI.UnrealTypes;

namespace UAssetAPI.CustomVersions
{
    /// <summary>
    /// Represents the engine version at the time that a custom version was implemented.
    /// </summary>
    [AttributeUsage(AttributeTargets.Field)]
    public class IntroducedAttribute : Attribute
    {
        public EngineVersion IntroducedVersion;

        public IntroducedAttribute(EngineVersion introducedVersion)
        {
            IntroducedVersion = introducedVersion;
        }
    }

    /// <summary>
    /// Custom serialization version for changes made in the //Fortnite/Main stream.
    /// </summary>
    public enum FFortniteMainBranchObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>World composition tile offset changed from 2d to 3d</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        WorldCompositionTile3DOffset,

        /// <summary>Minor material serialization optimization</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        MaterialInstanceSerializeOptimization_ShaderFName,

        /// <summary>Refactored cull distances to account for HLOD, explicit override and globals in priority</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        CullDistanceRefactor_RemovedDefaultDistance,
        [Introduced(EngineVersion.VER_UE4_20)]
        CullDistanceRefactor_NeverCullHLODsByDefault,
        [Introduced(EngineVersion.VER_UE4_20)]
        CullDistanceRefactor_NeverCullALODActorsByDefault,

        /// <summary>Support to remove morphtarget generated by bRemapMorphtarget</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        SaveGeneratedMorphTargetByEngine,

        /// <summary>Convert reduction setting options</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        ConvertReductionSettingOptions,

        /// <summary>Serialize the type of blending used for landscape layer weight static params</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        StaticParameterTerrainLayerWeightBlendType,

        /// <summary>Fix up None Named animation curve names,</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        FixUpNoneNameAnimationCurves,

        /// <summary>Ensure ActiveBoneIndices to have parents even not skinned for old assets</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        EnsureActiveBoneIndicesToContainParents,

        /// <summary>Serialize the instanced static mesh render data, to avoid building it at runtime</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        SerializeInstancedStaticMeshRenderData,

        /// <summary>Cache material quality node usage</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        CachedMaterialQualityNodeUsage,

        /// <summary>Font outlines no longer apply to drop shadows for new objects but we maintain the opposite way for backwards compat</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        FontOutlineDropShadowFixup,

        /// <summary>New skeletal mesh import workflow (Geometry only or animation only re-import )</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        NewSkeletalMeshImporterWorkflow,

        /// <summary>Migrate data from previous data structure to new one to support materials per LOD on the Landscape</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        NewLandscapeMaterialPerLOD,

        /// <summary>New Pose Asset data type</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        RemoveUnnecessaryTracksFromPose,

        /// <summary>Migrate Foliage TLazyObjectPtr to TSoftObjectPtr</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        FoliageLazyObjPtrToSoftObjPtr,

        /// <summary>TimelineTemplates store their derived names instead of dynamically generating. This code tied to this version was reverted and redone at a later date</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        REVERTED_StoreTimelineNamesInTemplate,

        /// <summary>Added BakePoseOverride for LOD setting</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        AddBakePoseOverrideForSkeletalMeshReductionSetting,

        /// <summary>TimelineTemplates store their derived names instead of dynamically generating</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        StoreTimelineNamesInTemplate,

        /// <summary>New Pose Asset data type</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        WidgetStopDuplicatingAnimations,

        /// <summary>Allow reducing of the base LOD, we need to store some imported model data so we can reduce again from the same data.</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        AllowSkeletalMeshToReduceTheBaseLOD,

        /// <summary>Curve Table size reduction</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        ShrinkCurveTableSize,

        /// <summary>Widgets upgraded with WidgetStopDuplicatingAnimations, may not correctly default-to-self for the widget parameter.</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        WidgetAnimationDefaultToSelfFail,

        /// <summary>HUDWidgets now require an element tag</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        FortHUDElementNowRequiresTag,

        /// <summary>Animation saved as bulk data when cooked</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        FortMappedCookedAnimation,

        /// <summary>Support Virtual Bone in Retarget Manager</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        SupportVirtualBoneInRetargeting,

        /// <summary>Fixup bad defaults in water metadata</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        FixUpWaterMetadata,

        /// <summary>Move the location of water metadata</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        MoveWaterMetadataToActor,

        /// <summary>Replaced lake collision component</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        ReplaceLakeCollision,

        /// <summary>Anim layer node names are now conformed by Guid</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        AnimLayerGuidConformation,

        /// <summary>Ocean collision component has become dynamic</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        MakeOceanCollisionTransient,

        /// <summary>FFieldPath will serialize the owner struct reference and only a short path to its property</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        FFieldPathOwnerSerialization,

        /// <summary>Simplified WaterBody post process material handling</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        FixUpUnderwaterPostProcessMaterial,

        /// <summary>A single water exclusion volume can now exclude N water bodies</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        SupportMultipleWaterBodiesPerExclusionVolume,

        /// <summary>Serialize rigvm operators one by one instead of the full byte code array to ensure determinism</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        RigVMByteCodeDeterminism,

        /// <summary>Serialize the physical materials generated by the render material</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        LandscapePhysicalMaterialRenderData,

        /// <summary>RuntimeVirtualTextureVolume fix transforms</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        FixupRuntimeVirtualTextureVolume,

        /// <summary>Retrieve water body collision components that were lost in cooked builds</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        FixUpRiverCollisionComponents,

        /// <summary>Fix duplicate spline mesh components on rivers</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        FixDuplicateRiverSplineMeshCollisionComponents,

        /// <summary>Indicates level has stable actor guids</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        ContainsStableActorGUIDs,

        /// <summary>Levelset Serialization support for BodySetup.</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        LevelsetSerializationSupportForBodySetup,

        /// <summary>Moving Chaos solver properties to allow them to exist in the project physics settings</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        ChaosSolverPropertiesMoved,

        /// <summary>Moving some UFortGameFeatureData properties and behaviors into the UGameFeatureAction pattern</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        GameFeatureData_MovedComponentListAndCheats,

        /// <summary>Add centrifugal forces for cloth</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        ChaosClothAddfictitiousforces,

        /// <summary>Chaos Convex StructureData supports different index sizes based on num verts/planes. Chaos FConvex uses array of FVec3s for vertices instead of particles (Merged from //UE4/Main)</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        ChaosConvexVariableStructureDataAndVerticesArray,

        /// <summary>Remove the WaterVelocityHeightTexture dependency on MPC_Landscape and LandscapeWaterIndo</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        RemoveLandscapeWaterInfo,

        // CHANGES BEYOND HERE ARE UE5 ONLY //

        /// <summary>Added the weighted value property type to store the cloths weight maps' low/high ranges</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothAddWeightedValue,

        /// <summary>Added the Long Range Attachment stiffness weight map</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothAddTetherStiffnessWeightMap,

        /// <summary>Fix corrupted LOD transition maps</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothFixLODTransitionMaps,

        /// <summary>Enable a few more weight maps to better art direct the cloth simulation</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothAddTetherScaleAndDragLiftWeightMaps,

        /// <summary>Enable material (edge, bending, and area stiffness) weight maps</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothAddMaterialWeightMaps,

        /// <summary>Added bShowCurve for movie scene float channel serialization</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        SerializeFloatChannelShowCurve,

        /// <summary>Minimize slack waste by using a single array for grass data</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        LandscapeGrassSingleArray,

        /// <summary>Add loop counters to sequencer's compiled sub-sequence data</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        AddedSubSequenceEntryWarpCounter,

        /// <summary>Water plugin is now component-based rather than actor based</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        WaterBodyComponentRefactor,

        /// <summary>Cooked BPGC storing editor-only asset tags</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        BPGCCookedEditorTags,

        /// <summary>Terrain layer weights are no longer considered material parameters</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        TTerrainLayerWeightsAreNotParameters,

        /// <summary>
        /// Anim Dynamics Node Gravity Override vector is now defined in world space, not simulation space.
        /// Legacy behavior can be maintained with a flag, which is set false by default for new nodes,
        /// true for nodes predating this change.
        /// </summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        GravityOverrideDefinedInWorldSpace,

        /// <summary>Anim Dynamics Node Physics parameters for each body in a chain are now stored in an array and can be edited.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        AnimDynamicsEditableChainParameters,

        /// <summary>Decoupled the generation of the water texture from the Water Brush and the landscape</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WaterZonesRefactor,

        /// <summary>Add faster damping calculations to the cloth simulation and rename previous Damping parameter to LocalDamping.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        ChaosClothFasterDamping,

        /// <summary>Migrated function handlers to the CDO/archetype data</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        MigratedFunctionHandlersToDefaults,

        /// <summary>Storing inertia tensor as vec3 instead of matrix.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        ChaosInertiaConvertedToVec3,

        /// <summary>Migrated event definitions to the CDO/archetype data</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        MigratedEventDefinitionToDefaults,

        /// <summary>Serialize LevelInstanceActorGuid on new ILevelInstanceInterface implementation</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        LevelInstanceActorGuidSerialize,

        /// <summary>Single-frame/key AnimDataModel patch-up</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        SingleFrameAndKeyAnimModel,

        /// <summary>Remapped bEvaluateWorldPositionOffset to bEvaluateWorldPositionOffsetInRayTracing</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        RemappedEvaluateWorldPositionOffsetInRayTracing,

        /// <summary>Water body collision settings are now those of the base UPrimitiveComponent, rather than duplicated in UWaterBodyComponent</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WaterBodyComponentCollisionSettingsRefactor,

        /// <summary>
        /// Introducing widget inherited named slots.  This wouldn't have required a version bump, except in the previous
        /// version, users could make NamedSlots and then Seed them with any random widgets, as a sorta 'default' setup.
        /// In order to preserve that, we're bumping the version so that we can set a new field on UNamedSlot to control
        /// if a widget exposes its named slot to everyone (even if it has content), which by default they wont any longer.
        /// </summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WidgetInheritedNamedSlots,

        /// <summary>Added water HLOD material</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WaterHLODSupportAdded,

        /// <summary>Moved parameters affecting Skeleton pose rendering from the PoseWatch class to the PoseWatchPoseElement class.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        PoseWatchMigrateSkeletonDrawParametersToPoseElement,

        /// <summary>Reset default value for Water exclusion volumes to make them more intuitive and support the "it just works" philosophy.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WaterExclusionVolumeExcludeAllDefault,

        /// <summary>Added water non-tessellated LOD</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WaterNontessellatedLODSupportAdded,

        /// <summary>Added FHierarchicalSimplification::SimplificationMethod</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        HierarchicalSimplificationMethodEnumAdded,

        /// <summary>Changed how world partition streaming cells are named</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WorldPartitionStreamingCellsNamingShortened,

        /// <summary>Serialize ContentBundleGuid in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WorldPartitionActorDescSerializeContentBundleGuid,

        /// <summary>Serialize IsActorRuntimeOnly in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WorldPartitionActorDescSerializeActorIsRuntimeOnly,

        /// <summary>Add Nanite Material Override option to materials and material instances.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        NaniteMaterialOverride,

        /// <summary>Serialize HLOD stats in HLODActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        WorldPartitionHLODActorDescSerializeStats,

        /// <summary>WorldPartitionStreamingSourceComponent property deprecation</summary>
        [Introduced(EngineVersion.VER_UE5_2)]
        WorldPartitionStreamingSourceComponentTargetDeprecation,

        /// <summary>Fixed localization gathering for external actor packages</summary>
        [Introduced(EngineVersion.VER_UE5_2)]
        FixedLocalizationGatherForExternalActorPackage,

        /// <summary>Change HLODActors to RuntimeCells mapping to use a GUID instead of the cell name</summary>
        [Introduced(EngineVersion.VER_UE5_2)]
        WorldPartitionHLODActorUseSourceCellGuid,

        /// <summary>Add an attribute to geometry collection to track internal faces, rather than relying on material ID numbering</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        ChaosGeometryCollectionInternalFacesAttribute,

        /// <summary>Dynamic cast nodes use an enumerated pure node state to include a value for the default setting</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        DynamicCastNodesUsePureStateEnum,

        /// <summary>Add FWorldPartitionActorFilter to FLevelInstanceActorDesc/FDataLayerInstanceDesc</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorFilter,

        /// <summary>Change the non-spatialized radius to blend to a pure 2D spatialized sound vs omnidirectional</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        AudioAttenuationNonSpatializedRadiusBlend,

        /// <summary>Serialize actor class descriptors</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorClassDescSerialize,

        /// <summary>FActorContainerID is now an FGuid instead of a uint64</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionFActorContainerIDu64ToGuid,

        /// <summary>FDataLayerInstanceDesc support for private data layers</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionPrivateDataLayers,

        /// <summary>Reduce size and improve behaviour of Chaos::FImplicitObjectUnion</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        ChaosImplicitObjectUnionBVHRefactor,

        /// <summary>FLevelInstanceActorDesc DeltaSerialize Filter</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        LevelInstanceActorDescDeltaSerializeFilter,

        /// <summary>Fix the Nanite landscape mesh non-deterministic DDC keys</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        FixNaniteLandscapeMeshDDCKey,

        /// <summary>Change how connection graphs are stored on Geometry Collections to an edge-array representation</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        ChaosGeometryCollectionConnectionEdgeGroup,

        /// <summary>Moved the water info mesh data and static water body meshes into new static mesh components for water bodies.</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WaterBodyStaticMeshComponents,

        /// <summary>Serialize invalid bounds in world partition actor descriptors</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorDescSerializeInvalidBounds,

        /// <summary>Upgrade Navigation Links to use 64 bits for the ID</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        NavigationLinkID32To64,

        /// <summary>Serialize editor only references in world partition actor descriptors</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorDescSerializeEditorOnlyReferences,

        /// <summary>Add support for soft object paths in actor descriptors</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorDescSerializeSoftObjectPathSupport,

        /// <summary>Don't serialize class descriptor GUIDs</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionClasDescGuidTransient,

        /// <summary>Serialize ActorDesc bIsMainWorldOnly</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorDescIsMainWorldOnly,

        /// <summary>FWorldPartitionActorFilter go back to FString serialize of AssetPaths to avoid FArchiveReplaceOrClearExternalReferences clearing CDO references on BP Compile</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorFilterStringAssetPath,

        /// <summary>Add FPackedLevelActorDesc for APackedLevelActor and support for APackedLevelActor Filters</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        PackedLevelActorDesc,

        /// <summary>Add customizable values for several UWorldPartitionRuntimeSpatialHash cvars</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionRuntimeSpatialHashCVarOverrides,

        /// <summary>WorldPartition HLOD now contains a source actors object</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionHLODSourceActorsRefactor,

        [Introduced(EngineVersion.VER_UE5_3)]
        WaterBodyStaticMeshRename,

        /// <summary>Geometry Collection now by-default converts vertex colors to sRGB when creating render data</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        GeometryCollectionConvertVertexColorToSRGB,

        /// <summary>Water bodies before this version need to update their water zone on load since they won't have been serialized yet.</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WaterOwningZonePointerFixup,

        /// <summary>Set flags on water static meshes to duplicate transient to avoid underlying static mesh duplication issue</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WaterBodyStaticMeshDuplicateTransient,

        /// <summary>Update paths to use the SkeletalClass</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        MVVMConvertPropertyPathToSkeletalClass,

        /// <summary>Fixup all flags/outering on static meshes on water bodies by rebuilding them completely</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WaterBodyStaticMeshFixup,

        /// <summary>Binding extensions for anim graph nodes</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AnimGraphNodeBindingExtensions,

        /// <summary>Function data stores a map from work to debug operands</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        RigVMSaveDebugMapInGraphFunctionData,

        /// <summary>Fix missing binding extensions for some anim graph nodes</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        FixMissingAnimGraphNodeBindingExtensions,

        /// <summary>EditableWhenInherited: Skip custom serialization on non Archetypes</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        ISMComponentEditableWhenInheritedSkipSerialization,

        /// <summary>GrassTypes are now per-component, rather than per-landscape proxy :</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        LandscapeSupportPerComponentGrassTypes,

        /// <summary>World partition actor data layers activation logic operator support defaults for old maps</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        WorldPartitionDataLayersLogicOperatorAdded,

        /// <summary>Started sorting Possessables, Spawnables, and MovieSceneBindings for better search performance.</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        MovieSceneSortedBindings,

        /// <summary>Remove the UAnimCurveCompressionCodec::InstanceGuid which causes cook determinism issues</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        RemoveAnimCurveCompressionCodecInstanceGuid,

        /// <summary>Serialize the source HLOD Layer for HLOD actor descriptors.</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        WorldPartitionHLODActorDescSerializeSourceHLODLayer,

        /// <summary>Serialize custom editor bounds for HLOD actor descriptors.</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        WorldPartitionHLODActorDescSerializeEditorBounds,

        /// <summary>Changed default Local Exposure Contrast from 1.0 to 0.8 (reverted)</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        LocalExposureDefaultChangeFrom1_Reverted,

        /// <summary>Added support of external packaging of Data Layer Instances</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AddDataLayerInstanceExternalPackage,

        /// <summary>Update paths to keep a flag if they are the widget BP</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        MVVMPropertyPathSelf,

        /// <summary>Enabled ObjectPtr property serialization for Dataflow nodes</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AddDataflowObjectSerialization,

        /// <summary>Add anim notify rate scaling, defaults to on for new content, off for old content</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AnimNotifyAddRateScale,

        /// <summary>Fix tangents for non-uniform build scales, and add a flag to optionally match the previous (incorrect) tangents</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        FixedTangentTransformForNonuniformBuildScale,

        /// <summary>AnimNode Layers will now start in a Shared Group, instead of being each one on a different group at runtime</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AnimNodeRootDefaultGroupChange,

        /// <summary>Move AnimNext graphs to sub-entries of assets</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AnimNextMoveGraphsToEntries,

        /// <summary>Removed debug information containing compressed data author, time etc. from animation DDC data as it introduces indeterminism</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        AnimationSequenceCompressedDataRemoveDebugData,

        /// <summary>Changes to Orthographic Camera default settings</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        OrthographicCameraDefaultSettings,

        /// <summary>Added settings to Landscape HLODs</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        LandscapeAddedHLODSettings,

        /// <summary>Skeletal Mesh uses Mesh Description to store mesh bulk data.</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        MeshDescriptionForSkeletalMesh,

        /// <summary>Skeletal Mesh optionally cooks half edge data per lod</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        SkeletalHalfEdgeData,

        /// <summary>Combine graph contexts for AnimNext graphs</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        AnimNextCombineGraphContexts,

        /// <summary>Combine parameter blocks and graphs</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        AnimNextCombineParameterBlocksAndGraphs,

        /// <summary>Move workspaces to a seperate plugin</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        AnimNextMoveWorkspaces,

        /// <summary>Level Instance Property overrides</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LevelInstancePropertyOverrides,

        /// <summary>Added FVolumetricLightMapGridDesc in MapBuildData</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        VolumetricLightMapGridDescSupport,

        /// <summary>Introduce new structure for customizing the landscape edit layer behavior</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        IntroduceLandscapeEditLayerClass,

        /// <summary>Change workspaces to store asset references as external objects</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        AnimNextWorkspaceEntryConversion,

        /// <summary>Add support for anytype in dataflow</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        DataflowAnyTypeSupport,

        /// <summary>Adding a new flag in RBAN Solver Setting to be able to use manifolds</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        PhysicsAssetUseManifoldFlags,

        /// <summary>Added support for to record sim and query data of Shape Instance data in CVD</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        SimAndQueryDataSupportInChaosVisualDebugger,

        /// <summary>Add the imported asset dependencies to the Cloth Asset USD Import node</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        ChaosClothAssetUSDImportNodeAddAssetDependencies,

        /// <summary>Changed HitLighting to HitLightingForReflections, and HitLighting now means hit lighting for entire Lumen</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LumenRayLightingModeOverrideEnum,

        /// <summary>PCGPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        PCGPartitionActorDesc,

        /// <summary>Target layers are now defined in the Landscape actor and not continuously synced from the assigned material.</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LandscapeTargetLayersInLandscapeActor,

        /// <summary>Fix to get full name of templated type ( Tarray > TArray{Float} for example )</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        DataflowTemplatedTypeFix,

        /// <summary>Changes for LevelInstance support in StaticLighting</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LevelInstanceStaticLightingSupport,

        /// <summary>PCGGridDescriptor</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        PCGGridDescriptor,

        /// <summary>AnimNext graphs now have public/private state</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        AnimNextGraphAccessSpecifiers,

        /// <summary>Added a more stable pixel depth offset mode.</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        MaterialPixelDepthOffsetMode,

        /// <summary>Added hideable pins to dataflow</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        DataflowHideablePins,

        /// <summary>Added multiple section import to the cloth asset skeletal mesh import node</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        ClothAssetSkeletalMeshMultiSectionImport,

        /// <summary>Serialize EditorBounds in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        WorldPartitionActorDescSerializeEditorBounds,

        /// <summary>Fixup for the data that has been damaged by LandscapeTargetLayersInLandscapeActor (loss of landscape layer info object assignments)</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        FixupLandscapeTargetLayersInLandscapeActor,

        //Allow custom import of morph target
        [Introduced(EngineVersion.VER_UE5_5)]
        MorphTargetCustomImport,

        /// <summary>Fix chaos cloth buckling stiffness parameter bug </summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        ChaosClothAllowZeroBucklingStiffness,

        /// <summary>LevelSequenceUpgradeDynamicBindings was removed but was intended for this position. Putting this here to make sure versioning of subsequent assets remains the same</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LevelSequenceUpgradeDynamicBindings_NoOp,

        /// <summary>AddToFrontend GFA now defaults to unload plugin on exit frontend</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        GameFeatureDataActionAddToFrontendDefaultToUnload,

        /// <summary>Upgraded movie scene 'dynamic bindings' to use the new Custom Bindings system</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LevelSequenceUpgradeDynamicBindings,

        /// <summary>Changed the precision for the stored rotation on kinematic targets to match the precision used in particles </summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        ChaosStoreKinematicTargetRotationAsSinglePrecision,

        /// <summary>PCG changes around the ApplyOnActor node, where we collapsed the TargetActor to the input pin.</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        PCGApplyOnActorNodeMoveTargetActorEdgeToInput,

        /// <summary>
        /// Deprecation of the bPlaying flag on FTimeline struct types in favor of a better
        /// PlayingStateTracker type to improve replication reliability
        /// </summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        TimelinePlayingStateTrackerDeprecation,

        /// <summary>Enable SkipOnlyEditorOnly style cooking of UStaticMeshComponent::MeshPaintTexture</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        MeshPaintTextureUsesEditorOnly,

        /// <summary>Fixup and synchronize some landscape properties that have moved to the property sharing/overriding system :</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        LandscapeBodyInstanceAsSharedProperty,

        /// <summary>Multiple changes to AnimNext modules, variables etc.</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        AnimNextModuleRefactor,

        /// <summary>Subsurface profile now has a guid to be able to select one of many in a Substrate material.</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        SubsurfaceProfileGuid,

        /// <summary>Added support for to record the new solver iteration settings in CVD</summary>
        [Introduced(EngineVersion.VER_UE5_5)]
        SolverIterationsDataSupportInChaosVisualDebugger,

        /// <summary>Updated FColorMaterialInput to use FLinearColor instead of FColor</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        MaterialInputUsesLinearColor,

        /// <summary>Updated editor only AFunctionalTest running logic to run tests editor world if the actors don't support PIE</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        FunctionalTestCanRunInEditorWorld,

        /// <summary>Added support for display name in the Visual Logger</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        VisualLoggerSupportDisplayName,

        /// <summary>Added support for the GyroscopicTorque flag in CVD</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        GyroscopicTorquesSupportInChaosVisualDebugger,

        /// <summary>Added managed array property serialization</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AddManagedArrayCollectionPropertySerialization,

        /// <summary>Landscape texture patches in Texture Asset source mode now use proper resolution when calculating transform</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        LandscapeTexturePatchUsesTextureAssetResolution,

        /// <summary>Added support for relative transform in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        WorldPartitionActorDescSerializeRelativeTransform,

        /// <summary>Make sure scene graph entities are not public by default</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        SceneGraphEntitiesPrivateByDefault,

        /// <summary>Added debug color for physical materials</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        DebugColorForPhysicalMaterials,

        /// <summary>Added PreprocessedFontGeometry to FFontFaceData</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AddedPreprocessedFontGeometry,

        /// <summary>Added Dynamic Mesh Sculpt Layer serialization</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        DynamicMeshSerializeSculptLayers,

        /// <summary>Fix reachable garbage object warnings from some legacy ASpatialHashRuntimeGridInfo actors</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        SpatialHashRuntimeGridInfoSpriteFixup,

        /// <summary>Removed UAnimSequence::bUseRawDataOnly flag alongside compression refactor</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AnimSequenceRawDataOnlyFlagRemoval,

        /// <summary>HLOD relevancy of Level Instances was previously ignored, now taken into account. Reset to the default behavior.</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        ResetLevelInstanceHLODRelevancy,

        /// <summary>Updated default scene capture post-processing settings to reflect the underlying implementation overrides</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        SceneCaptureDefaultSettings,

        /// <summary>Add Cloth Asset Base class serialization</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AddClothAssetBase,

        /// <summary>Add inline constant default values to the PCG graph nodes.</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        PCGInlineConstantDefaultValues,

        /// <summary>Add MaterialSubstrateSubsurfaceType type to UMaterialExpressionSubstrateSlabBSDF for replacing bUseSSSDifffusion</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AddMaterialSubstrateSubsurfaceType,

        /// <summary>Added option to visualize runtime virtual textures' streamed mips only in PIE </summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AddedRuntimeVirtualTextureUseStreamingMipsInEditorMode,

        /// <summary>Media plate holdout composite components have been replaced by a checkbox</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        MediaPlateHoldoutComponentRemoval,

        /// <summary>Changed PCG landscape cache default from "serialize at cook" to "never serialize"</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        PCGLandscapeCacheDefaultSerializationChanged,

        /// <summary>FSoftObjectPath::SubPathString changed to FUtf8String</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        SoftObjectPathUtf8SubPaths,

        /// <summary>FSoftObjectPath::SubPathString could be saved with trailing NULs and need truncating</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        SoftObjectPathTrailingNULsMaintained,

        /// <summary>Water body components no longer need to maintain their own PhysicalMaterial property since they are primitive components. After this version, leverage that one instead.</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        WaterBodyPhysicalMaterialPropertyRemoval,

        /// <summary>PCG fixed attribute set -> point conversion passing through empty point data as-is and violating output pin type.</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        PCGAttributeSetToPointAlwaysConverts,

        //Add per material slot overlay material data
        [Introduced(EngineVersion.VER_UE5_6)]
        MeshMaterialSlotOverlayMaterialAdded,

        /// <summary>Convert Sustrate glint density properly</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        ConvertGlintDensity,

        /// <summary>Introduced skinweight validation to avoid render crashes and disappearing simulation meshes</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        ClothAssetSkinweightsValidation,

        /// <summary>Switching verse from right handed to left handed</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        VerseRightToLeftHandedness,

        /// <summary>Added additional data required to record and represent particle data from the game thread (Kinematic targets, and SQ rejection reasons)</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        AdditionalGameThreadDataSupportInChaosVisualDebugger,

        /// <summary>Upgrade UMG widget blueprints using legacy animation API</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        UpgradeWidgetBlueprintLegacySequencePlayer,

        /// <summary>Changed clockwise detection algorithm for PCGSplineDirection node with the correct one, but add a version to not break previous nodes.</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        PCGSplineDirectionClockwiseFix,

        /// <summary>Rect Lights set in EV units had the wrong intensity (older files need a flag set to keep the old look)</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        RectLightFixedEVUnitConversion,

        /// <summary>Add particle bounds to data exported to CVD</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        ParticleInflatedBoundsInChaosVisualDebugger,

        /// <summary>Migrate properties from FLandscapeLayer to ULandscapeEditLayer</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        MigrateLandscapeEditLayerProperties,

        /// <summary>Added more context data to CVD's traced shapes so we can play it back at the solver stage level (not just game thread frames) </summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        ThreadContextDataInChaosVisualDebuggerDebugDrawData,

        /// <summary>Changed default grid mode in surface sampler to a version that's more intuitive and less error-prone</summary>
        [Introduced(EngineVersion.VER_UE5_6)]
        PCGChangedSurfaceSamplerDefaultGridCreationMode,

        /// <summary>Media plate overlay composite technique replacement with holdout composite</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        MediaPlateOverlayTechniqueRemoval,

        /// <summary>Added particle flag to allow/disallow partial island sleeping in the island the particle is in</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        PerParticleFlagToAllowPartialIslandSleepInConnectedIsland,

        /// <summary>Material Function Blend Deserialize Top/Bottom input nodes with clearer enum marker.</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        MaterialFunctionBlendTopBottomInputEnum,

        /// <summary>Cooked CPU-side morph target points are now stored internally in the same compressed format as the GPU morph data. </summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        MorphTargetCookedCPUDataCompressed,

        /// <summary>AnimNext variables converted to references</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        AnimNextVariableReferences,

        /// <summary>The default distortion rendering mode used by the Lens Component is now the Lens Distortion Scene View Extension</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        LensComponentDefaultToDistortionSVE,

        /// <summary>Animation default blend option changed from Linear to HermiteCubic (aka SmoothStep, ease in / ease out)</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        ChangeDefaultAlphaBlendType,

        /// <summary>Moved Position/Velocity/Projection Iteration Counts from FChaosVDFRigidParticleControlFlags to FChaosVDParticleDynamicMisc</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        PerParticleIterationCountMovedToDynamicMisc,

        /// <summary>Added missing custom serialization for some properties in the ParticleDynamicMisc structure used by the Chaos Visual Debugger</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        AddedMissingSerializationForPropertiesInDynamicMisc,

        /// <summary>Change default value for deprecated bEnableWorldPartitionGenerationSources</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        PCGDeprecateWorldPartitionGenerationSources,

        /// <summary>Refactored the composite (plugin) actor scene capture management.</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        CompositeActorSceneCaptureRefactor,

        /// <summary>Moved HLOD Layer properties to an editor only optional object</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        HLODLayerEditorOnlyObject,

        /// <summary>Deduplicated particle debug names serialization in the Chaos Visual Debugger</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        DeduplicatedDebugNameSerializationInCVD,

        /// <summary>Add BloomGaussianIntensity and BloomConvolutionIntensity</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        SpecializeBloomIntensity,

        /// <summary>Add support for world partition actor component descriptors</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        WorldPartitionActorComponentDesc,

        /// <summary>Migrate Non-Edit layer landscapes to use the edit layer (ULandscapeEditLayer) system</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        MigrateLandscapeNonEditLayerToEditLayer,

        /// <summary>FDynamicMeshAttributeSet has Morph Targets.</summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        DynamicMeshAttributesMorphTargets,

        /// <summary>Introduce landscape advanced weight blending </summary>
        [Introduced(EngineVersion.VER_UE5_7)]
        LandscapeAdvancedWeightBlending,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    };

    /// <summary>
    /// Custom serialization version for changes made in Dev-Framework stream.
    /// </summary>
    public enum FFrameworkObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>BodySetup's default instance collision profile is used by default when creating a new instance.</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        UseBodySetupCollisionProfile,

        /// <summary>Regenerate subgraph arrays correctly in animation blueprints to remove duplicates and add missing graphs that appear read only when edited</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        AnimBlueprintSubgraphFix,

        /// <summary>Static and skeletal mesh sockets now use the specified scale</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        MeshSocketScaleUtilization,

        /// <summary>Attachment rules are now explicit in how they affect location, rotation and scale</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        ExplicitAttachmentRules,

        /// <summary>Moved compressed anim data from uasset to the DDC</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        MoveCompressedAnimDataToTheDDC,

        /// <summary>Some graph pins created using legacy code seem to have lost the RF_Transactional flag, which causes issues with undo. Restore the flag at this version</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        FixNonTransactionalPins,

        /// <summary>Create new struct for SmartName, and use that for CurveName</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        SmartNameRefactor,

        /// <summary>Add Reference Skeleton to Rig</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        AddSourceReferenceSkeletonToRig,

        /// <summary>Refactor ConstraintInstance so that we have an easy way to swap behavior paramters</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        ConstraintInstanceBehaviorParameters,

        /// <summary>Pose Asset support mask per bone</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        PoseAssetSupportPerBoneMask,

        /// <summary>Physics Assets now use SkeletalBodySetup instead of BodySetup</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        PhysAssetUseSkeletalBodySetup,

        /// <summary>Remove SoundWave CompressionName</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        RemoveSoundWaveCompressionName,

        /// <summary>Switched render data for clothing over to unreal data, reskinned to the simulation mesh</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        AddInternalClothingGraphicalSkinning,

        /// <summary>Wheel force offset is now applied at the wheel instead of vehicle COM</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        WheelOffsetIsFromWheel,

        /// <summary>Move curve metadata to be saved in skeleton. Individual asset still saves some flag - i.e. disabled curve and editable or not, but major flag - i.e. material types - moves to skeleton and handle in one place</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        MoveCurveTypesToSkeleton,

        /// <summary>Cache destructible overlaps on save</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        CacheDestructibleOverlaps,

        /// <summary>Added serialization of materials applied to geometry cache objects</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        GeometryCacheMissingMaterials,

        /// <summary>Switch static and skeletal meshes to calculate LODs based on resolution-independent screen size</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        LODsUseResolutionIndependentScreenSize,

        /// <summary>Blend space post load verification</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        BlendSpacePostLoadSnapToGrid,

        /// <summary>Addition of rate scales to blend space samples</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        SupportBlendSpaceRateScale,

        /// <summary>LOD hysteresis also needs conversion from the LODsUseResolutionIndependentScreenSize version</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        LODHysteresisUseResolutionIndependentScreenSize,

        /// <summary>AudioComponent override subtitle priority default change</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        ChangeAudioComponentOverrideSubtitlePriorityDefault,

        /// <summary>Serialize hard references to sound files when possible</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        HardSoundReferences,

        /// <summary>Enforce const correctness in Animation Blueprint function graphs</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        EnforceConstInAnimBlueprintFunctionGraphs,

        /// <summary>Upgrade the InputKeySelector to use a text style</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        InputKeySelectorTextStyle,

        /// <summary>Represent a pins container type as an enum not 3 independent booleans</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        EdGraphPinContainerType,

        /// <summary>Switch asset pins to store as string instead of hard object reference</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        ChangeAssetPinsToString,

        /// <summary>Fix Local Variables so that the properties are correctly flagged as blueprint visible</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        LocalVariablesBlueprintVisible,

        /// <summary>Stopped serializing UField_Next so that UFunctions could be serialized in dependently of a UClass in order to allow us to do all UFunction loading in a single pass (after classes and CDOs are created)</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        RemoveUField_Next,

        /// <summary>Fix User Defined structs so that all members are correct flagged blueprint visible</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        UserDefinedStructsBlueprintVisible,

        /// <summary>FMaterialInput and FEdGraphPin store their name as FName instead of FString</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        PinsStoreFName,

        /// <summary>User defined structs store their default instance, which is used for initializing instances</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        UserDefinedStructsStoreDefaultInstance,

        /// <summary>Function terminator nodes serialize an FMemberReference rather than a name/class pair</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        FunctionTerminatorNodesUseMemberReference,

        /// <summary>Custom event and non-native interface event implementations add 'const' to reference parameters</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        EditableEventsUseConstRefParameters,

        /// <summary>No longer serialize the legacy flag that indicates this state, as it is now implied since we don't serialize the skeleton CDO</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        BlueprintGeneratedClassIsAlwaysAuthoritative,

        /// <summary>Enforce visibility of blueprint functions - e.g. raise an error if calling a private function from another blueprint:</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        EnforceBlueprintFunctionVisibility,

        /// <summary>ActorComponents now store their serialization index</summary>
        [Introduced(EngineVersion.VER_UE4_25)]
        StoringUCSSerializationIndex,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    };

    /// <summary>
    /// Custom serialization version for changes made in Dev-Core stream.
    /// </summary>
    public enum FCoreObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        [Introduced(EngineVersion.VER_UE4_12)]
        MaterialInputNativeSerialize,

        [Introduced(EngineVersion.VER_UE4_15)]
        EnumProperties,

        [Introduced(EngineVersion.VER_UE4_22)]
        SkeletalMaterialEditorDataStripping,

        [Introduced(EngineVersion.VER_UE4_25)]
        FProperties,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    };

    /// <summary>
    /// Custom serialization version for changes made in Dev-Editor stream.
    /// </summary>
    public enum FEditorObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>Localizable text gathered and stored in packages is now flagged with a localizable text gathering process version</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        GatheredTextProcessVersionFlagging,

        /// <summary>Fixed several issues with the gathered text cache stored in package headers</summary>
        [Introduced(EngineVersion.VER_UE4_12)]
        GatheredTextPackageCacheFixesV1,

        /// <summary>Added support for "root" meta-data (meta-data not associated with a particular object in a package)</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        RootMetaDataSupport,

        /// <summary>Fixed issues with how Blueprint bytecode was cached</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        GatheredTextPackageCacheFixesV2,

        /// <summary>Updated FFormatArgumentData to allow variant data to be marshaled from a BP into C++</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        TextFormatArgumentDataIsVariant,

        /// <summary>Changes to SplineComponent</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        SplineComponentCurvesInStruct,

        /// <summary>Updated ComboBox to support toggling the menu open, better controller support</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        ComboBoxControllerSupportUpdate,

        /// <summary>Refactor mesh editor materials</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        RefactorMeshEditorMaterials,

        /// <summary>Added UFontFace assets</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        AddedFontFaceAssets,

        /// <summary>Add UPROPERTY for TMap of Mesh section, so the serialize will be done normally (and export to text will work correctly)</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        UPropertryForMeshSection,

        /// <summary>Update the schema of all widget blueprints to use the WidgetGraphSchema</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        WidgetGraphSchema,

        /// <summary>Added a specialized content slot to the background blur widget</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        AddedBackgroundBlurContentSlot,

        /// <summary>Updated UserDefinedEnums to have stable keyed display names</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        StableUserDefinedEnumDisplayNames,

        /// <summary>Added "Inline" option to UFontFace assets</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        AddedInlineFontFaceAssets,

        /// <summary>Fix a serialization issue with static mesh FMeshSectionInfoMap FProperty</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        UPropertryForMeshSectionSerialize,

        /// <summary>Adding a version bump for the new fast widget construction in case of problems.</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        FastWidgetTemplates,

        /// <summary>Update material thumbnails to be more intelligent on default primitive shape for certain material types</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        MaterialThumbnailRenderingChanges,

        /// <summary>Introducing a new clipping system for Slate/UMG</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        NewSlateClippingSystem,

        /// <summary>MovieScene Meta Data added as native Serialization</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        MovieSceneMetaDataSerialization,

        /// <summary>Text gathered from properties now adds two variants: a version without the package localization ID (for use at runtime), and a version with it (which is editor-only)</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        GatheredTextEditorOnlyPackageLocId,

        /// <summary>Added AlwaysSign to FNumberFormattingOptions</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        AddedAlwaysSignNumberFormattingOption,

        /// <summary>Added additional objects that must be serialized as part of this new material feature</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        AddedMaterialSharedInputs,

        /// <summary>Added morph target section indices</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        AddedMorphTargetSectionIndices,

        /// <summary>Serialize the instanced static mesh render data, to avoid building it at runtime</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        SerializeInstancedStaticMeshRenderData,

        /// <summary>Change to MeshDescription serialization (moved to release)</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        MeshDescriptionNewSerialization_MovedToRelease,

        /// <summary>New format for mesh description attributes</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        MeshDescriptionNewAttributeFormat,

        /// <summary>Switch root component of SceneCapture actors from MeshComponent to SceneComponent</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        ChangeSceneCaptureRootComponent,

        /// <summary>StaticMesh serializes MeshDescription instead of RawMesh</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        StaticMeshDeprecatedRawMesh,

        /// <summary>MeshDescriptionBulkData contains a Guid used as a DDC key</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        MeshDescriptionBulkDataGuid,

        /// <summary>Change to MeshDescription serialization (removed FMeshPolygon::HoleContours)</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        MeshDescriptionRemovedHoles,

        /// <summary>Change to the WidgetCompoent WindowVisibilty default value</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        ChangedWidgetComponentWindowVisibilityDefault,

        /// <summary>Avoid keying culture invariant display strings during serialization to avoid non-deterministic cooking issues</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        CultureInvariantTextSerializationKeyStability,

        /// <summary>Change to UScrollBar and UScrollBox thickness property (removed implicit padding of 2, so thickness value must be incremented by 4).</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        ScrollBarThicknessChange,

        /// <summary>Deprecated LandscapeHoleMaterial</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        RemoveLandscapeHoleMaterial,

        /// <summary>MeshDescription defined by triangles instead of arbitrary polygons</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        MeshDescriptionTriangles,

        /// <summary>Add weighted area and angle when computing the normals</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        ComputeWeightedNormals,

        /// <summary>SkeletalMesh now can be rebuild in editor, no more need to re-import</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        SkeletalMeshBuildRefactor,

        /// <summary>Move all SkeletalMesh source data into a private uasset in the same package has the skeletalmesh</summary>
        [Introduced(EngineVersion.VER_UE4_25)]
        SkeletalMeshMoveEditorSourceDataToPrivateAsset,

        /// <summary>Parse text only if the number is inside the limits of its type</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        NumberParsingOptionsNumberLimitsAndClamping,

        /// <summary>Make sure we can have more then 255 material in the skeletal mesh source data</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        SkeletalMeshSourceDataSupport16bitOfMaterialNumber,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    };

    /// <summary>
    /// Custom serialization version for changes made in Dev-AnimPhys stream
    /// </summary>
    public enum FAnimPhysObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded,

        /// <summary>convert animnode look at to use just default axis instead of enum, which doesn't do much</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        ConvertAnimNodeLookAtAxis,

        /// <summary>Change FKSphylElem and FKBoxElem to use Rotators not Quats for easier editing</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        BoxSphylElemsUseRotators,

        /// <summary>Change thumbnail scene info and asset import data to be transactional</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        ThumbnailSceneInfoAndAssetImportDataAreTransactional,

        /// <summary>Enabled clothing masks rather than painting parameters directly</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        AddedClothingMaskWorkflow,

        /// <summary>Remove UID from smart name serialize, it just breaks determinism</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        RemoveUIDFromSmartNameSerialize,

        /// <summary>Convert FName Socket to FSocketReference and added TargetReference that support bone and socket</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        CreateTargetReference,

        /// <summary>Tune soft limit stiffness and damping coefficients</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        TuneSoftLimitStiffnessAndDamping,

        /// <summary>Fix possible inf/nans in clothing particle masses</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        FixInvalidClothParticleMasses,

        /// <summary>Moved influence count to cached data</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        CacheClothMeshInfluences,

        /// <summary>Remove GUID from Smart Names entirely + remove automatic name fixup</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        SmartNameRefactorForDeterministicCooking,

        /// <summary>rename the variable and allow individual curves to be set</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        RenameDisableAnimCurvesToAllowAnimCurveEvaluation,

        /// <summary>link curve to LOD, so curve metadata has to include LODIndex</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        AddLODToCurveMetaData,

        /// <summary>Fixed blend profile references persisting after paste when they aren't compatible</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        FixupBadBlendProfileReferences,

        /// <summary>Allowing multiple audio plugin settings</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        AllowMultipleAudioPluginSettings,

        /// <summary>Change RetargetSource reference to SoftObjectPtr</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        ChangeRetargetSourceReferenceToSoftObjectPtr,

        /// <summary>Save editor only full pose for pose asset</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        SaveEditorOnlyFullPoseForPoseAsset,

        /// <summary>Asset change and cleanup to facilitate new streaming system</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        GeometryCacheAssetDeprecation,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    /// <summary>
    /// Custom serialization version for changes made in Release streams.
    /// </summary>
    public enum FReleaseObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>Static Mesh extended bounds radius fix</summary>
        [Introduced(EngineVersion.VER_UE4_11)]
        StaticMeshExtendedBoundsFix,

        /// <summary>Physics asset bodies are either in the sync scene or the async scene, but not both</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        NoSyncAsyncPhysAsset,

        /// <summary>ULevel was using TTransArray incorrectly (serializing the entire array in addition to individual mutations). converted to a TArray</summary>
        [Introduced(EngineVersion.VER_UE4_13)]
        LevelTransArrayConvertedToTArray,

        /// <summary>Add Component node templates now use their own unique naming scheme to ensure more reliable archetype lookups.</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        AddComponentNodeTemplateUniqueNames,

        /// <summary>Fix a serialization issue with static mesh FMeshSectionInfoMap FProperty</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        UPropertryForMeshSectionSerialize,

        /// <summary>Existing HLOD settings screen size to screen area conversion</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        ConvertHLODScreenSize,

        /// <summary>Adding mesh section info data for existing billboard LOD models</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        SpeedTreeBillboardSectionInfoFixup,

        /// <summary>Change FMovieSceneEventParameters::StructType to be a string asset reference from a TWeakObjectPtr UScriptStruct</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        EventSectionParameterStringAssetRef,

        /// <summary>Remove serialized irradiance map data from skylight.</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        SkyLightRemoveMobileIrradianceMap,

        /// <summary>rename bNoTwist to bAllowTwist</summary>
        [Introduced(EngineVersion.VER_UE4_17)]
        RenameNoTwistToAllowTwistInTwoBoneIK,

        /// <summary>Material layers serialization refactor</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        MaterialLayersParameterSerializationRefactor,

        /// <summary>Added disable flag to skeletal mesh data</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        AddSkeletalMeshSectionDisable,

        /// <summary>Removed objects that were serialized as part of this material feature</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        RemovedMaterialSharedInputCollection,

        /// <summary>HISMC Cluster Tree migration to add new data</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        HISMCClusterTreeMigration,

        /// <summary>Default values on pins in blueprints could be saved incoherently</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        PinDefaultValuesVerified,

        /// <summary>During copy and paste transition getters could end up with broken state machine references</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        FixBrokenStateMachineReferencesInTransitionGetters,

        /// <summary>Change to MeshDescription serialization</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        MeshDescriptionNewSerialization,

        /// <summary>Change to not clamp RGB values > 1 on linear color curves</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        UnclampRGBColorCurves,

        /// <summary>BugFix for FAnimObjectVersion::LinkTimeAnimBlueprintRootDiscovery.</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        LinkTimeAnimBlueprintRootDiscoveryBugFix,

        /// <summary>Change trail anim node variable deprecation</summary>
        [Introduced(EngineVersion.VER_UE4_21)]
        TrailNodeBlendVariableNameChange,

        /// <summary>Make sure the Blueprint Replicated Property Conditions are actually serialized properly.</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        PropertiesSerializeRepCondition,

        /// <summary>DepthOfFieldFocalDistance at 0 now disables DOF instead of DepthOfFieldFstop at 0.</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        FocalDistanceDisablesDOF,

        /// <summary>Removed versioning, but version entry must still exist to keep assets saved with this version loadable</summary>
        [Introduced(EngineVersion.VER_UE4_23)]
        Unused_SoundClass2DReverbSend,

        /// <summary>Groom asset version</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        GroomAssetVersion1,

        /// <summary>Groom asset version</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        GroomAssetVersion2,

        /// <summary>Store applied version of Animation Modifier to use when reverting</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        SerializeAnimModifierState,

        /// <summary>Groom asset version</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        GroomAssetVersion3,

        /// <summary>Upgrade filmback</summary>
        [Introduced(EngineVersion.VER_UE4_24)]
        DeprecateFilmbackSettings,

        /// <summary>custom collision type</summary>
        [Introduced(EngineVersion.VER_UE4_25)]
        CustomImplicitCollisionType,

        /// <summary>FFieldPath will serialize the owner struct reference and only a short path to its property</summary>
        [Introduced(EngineVersion.VER_UE4_25)]
        FFieldPathOwnerSerialization,

        /// <summary>Dummy version to allow us to Fix up the fact that ReleaseObjectVersion was changed elsewhere</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        ReleaseUE4VersionFixup,

        /// <summary>Pin types include a flag that propagates the 'CPF_UObjectWrapper' flag to generated properties</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        PinTypeIncludesUObjectWrapperFlag,

        /// <summary>Added Weight member to FMeshToMeshVertData</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        WeightFMeshToMeshVertData,

        /// <summary>Animation graph node bindings displayed as pins</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        AnimationGraphNodeBindingsDisplayedAsPins,

        /// <summary>Serialized rigvm offset segment paths</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        SerializeRigVMOffsetSegmentPaths,

        /// <summary>Upgrade AbcGeomCacheImportSettings for velocities</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        AbcVelocitiesSupport,

        /// <summary>Add margin support to Chaos Convex</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        MarginAddedToConvexAndBox,

        /// <summary>Add structure data to Chaos Convex</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        StructureDataAddedToConvex,

        /// <summary>Changed axis UI for LiveLink AxisSwitch Pre Processor</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        AddedFrontRightUpAxesToLiveLinkPreProcessor,

        /// <summary>Some sequencer event sections that were copy-pasted left broken links to the director BP</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        FixupCopiedEventSections,

        /// <summary>Serialize the number of bytes written when serializing function arguments</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        RemoteControlSerializeFunctionArgumentsSize,

        /// <summary>Add loop counters to sequencer's compiled sub-sequence data</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        AddedSubSequenceEntryWarpCounter,

        /// <summary>Remove default resolution limit of 512 pixels for cubemaps generated from long-lat sources</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        LonglatTextureCubeDefaultMaxResolution,

        // bake center of mass into chaos cache
        [Introduced(EngineVersion.VER_UE5_0)]
        GeometryCollectionCacheRemovesMassToLocal,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    /// <summary>
    /// Version used for serializing asset registry caches, both runtime and editor
    /// </summary>
    public enum FAssetRegistryVersion
    {
        /// <summary>From before file versioning was implemented</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        PreVersioning = 0,

        /// <summary>The first version of the runtime asset registry to include file versioning.</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        HardSoftDependencies,

        /// <summary>Added FAssetRegistryState and support for piecemeal serialization</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AddAssetRegistryState,

        /// <summary>AssetData serialization format changed, versions before this are not readable</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        ChangedAssetData,

        /// <summary>Removed MD5 hash from package data</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        RemovedMD5Hash,

        /// <summary>Added hard/soft manage references</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AddedHardManage,

        /// <summary>Added MD5 hash of cooked package to package data</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AddedCookedMD5Hash,

        /// <summary>Added UE::AssetRegistry::EDependencyProperty to each dependency</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AddedDependencyFlags,

        /// <summary>Major tag format change that replaces USE_COMPACT_ASSET_REGISTRY:</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        FixedTags,

        /// <summary>Added Version information to AssetPackageData</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        WorkspaceDomain,

        /// <summary>Added ImportedClasses to AssetPackageData</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        PackageImportedClasses,

        /// <summary>A new version number of UE5 was added to FPackageFileSummary</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        PackageFileSummaryVersionChange,

        /// <summary>Change to linker export/import resource serializationn</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        ObjectResourceOptionalVersionChange,

        /// <summary>Added FIoHash for each FIoChunkId in the package to the AssetPackageData.</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AddedChunkHashes,

        /// <summary>Classes are serialized as path names rather than short object names, e.g. /Script/Engine.StaticMesh</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        ClassPaths,

        /// <summary>Asset bundles are serialized as FTopLevelAssetPath instead of FSoftObjectPath, deprecated FAssetData::ObjectPath</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        RemoveAssetPathFNames,

        /// <summary>Added header with bFilterEditorOnlyData flag</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AddedHeader,

        /// <summary>Added Extension to AssetPackageData.</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        AssetPackageDataHasExtension,		

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    public enum FSequencerObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>Per-platform overrides player overrides for media sources changed name and type.</summary>
        [Introduced(EngineVersion.VER_UE4_14)]
        RenameMediaSourcePlatformPlayers,

        /// <summary>Enable root motion isn't the right flag to use, but force root lock</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        ConvertEnableRootMotionToForceRootLock,

        /// <summary>Convert multiple rows to tracks</summary>
        [Introduced(EngineVersion.VER_UE4_15)]
        ConvertMultipleRowsToTracks,

        /// <summary>When finished now defaults to restore state</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        WhenFinishedDefaultsToRestoreState,

        /// <summary>EvaluationTree added</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        EvaluationTree,

        /// <summary>When finished now defaults to project default</summary>
        [Introduced(EngineVersion.VER_UE4_19)]
        WhenFinishedDefaultsToProjectDefault,

        /// <summary>Use int range rather than float range in FMovieSceneSegment</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        FloatToIntConversion,

        /// <summary>Purged old spawnable blueprint classes from level sequence assets</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        PurgeSpawnableBlueprints,

        /// <summary>Finish UMG evaluation on end</summary>
        [Introduced(EngineVersion.VER_UE4_20)]
        FinishUMGEvaluation,

        /// <summary>Manual serialization of float channel</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        SerializeFloatChannel,

        /// <summary>Change the linear keys so they act the old way and interpolate always.</summary>
        [Introduced(EngineVersion.VER_UE4_22)]
        ModifyLinearKeysForOldInterp,

        /// <summary>Full Manual serialization of float channel</summary>
        [Introduced(EngineVersion.VER_UE4_25)]
        SerializeFloatChannelCompletely,

        /// <summary>Set ContinuouslyRespawn to false by default, added FMovieSceneSpawnable::bNetAddressableName</summary>
        [Introduced(EngineVersion.VER_UE4_27)]
        SpawnableImprovements,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    public enum FFortniteReleaseBranchCustomObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>Custom 14.10 File Object Version</summary>
        [Introduced(EngineVersion.VER_UE4_26)]
        DisableLevelset_v14_10,

        /// <summary>Add the long range attachment tethers to the cloth asset to avoid a large hitch during the cloth's initialization.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothAddTethersToCachedData,

        /// <summary>Chaos::TKinematicTarget no longer stores a full transform, only position/rotation.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosKinematicTargetRemoveScale,

        /// <summary>Move UCSModifiedProperties out of ActorComponent and in to sparse storage</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        ActorComponentUCSModifiedPropertiesSparseStorage,

        /// <summary>Fixup Nanite meshes which were using the wrong material and didn't have proper UVs :</summary>
        [Introduced(EngineVersion.VER_UE5_2)]
        FixupNaniteLandscapeMeshes,

        /// <summary>Remove any cooked collision data from nanite landscape / editor spline meshes since collisions are not needed there :</summary>
        [Introduced(EngineVersion.VER_UE5_2)]
        RemoveUselessLandscapeMeshesCookedCollisionData,

        /// <summary>Serialize out UAnimCurveCompressionCodec::InstanceGUID to maintain deterministic DDC key generation in cooked-editor</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        SerializeAnimCurveCompressionCodecGuidOnCook,

        /// <summary>Fix the Nanite landscape mesh being reused because of a bad name</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        FixNaniteLandscapeMeshNames,

        /// <summary>Fixup and synchronize shared properties modified before the synchronicity enforcement</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        LandscapeSharedPropertiesEnforcement,

        /// <summary>Include the cell size when computing the cell guid</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionRuntimeCellGuidWithCellSize,

        /// <summary>Enable SkipOnlyEditorOnly style cooking of NaniteOverrideMaterial</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        NaniteMaterialOverrideUsesEditorOnly,

        /// <summary>Store game thread particles data in single precision</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        SinglePrecisonParticleData,

        /// <summary>UPCGPoint custom serialization</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        PCGPointStructuredSerializer,

        /// <summary>Deprecation of Nav Movement Properties and moving them to a new struct</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        NavMovementComponentMovingPropertiesToStruct,

        /// <summary>Add bone serialization for dynamic mesh attributes</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        DynamicMeshAttributesSerializeBones,

        /// <summary>-----new versions can be added above this line-------------------------------------------------</summary>
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    public enum FUE5ReleaseStreamObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>Added Lumen reflections to new reflection enum, changed defaults</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        ReflectionMethodEnum,

        /// <summary>Serialize HLOD info in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        WorldPartitionActorDescSerializeHLODInfo,

        /// <summary>Removing Tessellation from materials and meshes.</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        RemovingTessellation,

        /// <summary>LevelInstance serialize runtime behavior</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        LevelInstanceSerializeRuntimeBehavior,

        /// <summary>Refactoring Pose Asset runtime data structures</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        PoseAssetRuntimeRefactor,

        /// <summary>Serialize the folder path of actor descs</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        WorldPartitionActorDescSerializeActorFolderPath,

        /// <summary>Change hair strands vertex format</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        HairStrandsVertexFormatChange,

        /// <summary>Added max linear and angular speed to Chaos bodies</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        AddChaosMaxLinearAngularSpeed,

        /// <summary>PackedLevelInstance version</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        PackedLevelInstanceVersion,

        /// <summary>PackedLevelInstance bounds fix</summary>
        [Introduced(EngineVersion.VER_UE5_0EA)]
        PackedLevelInstanceBoundsFix,

        /// <summary>Custom property anim graph nodes (linked anim graphs, control rig etc.) now use optional pin manager</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        CustomPropertyAnimGraphNodesUseOptionalPinManager,

        /// <summary>Add native double and int64 support to FFormatArgumentData</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        TextFormatArgumentData64bitSupport,

        /// <summary>Material layer stacks are no longer considered 'static parameters'</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        MaterialLayerStacksAreNotParameters,

        /// <summary>CachedExpressionData is moved from UMaterial to UMaterialInterface</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        MaterialInterfaceSavedCachedData,

        /// <summary>Add support for multiple cloth deformer LODs to be able to raytrace cloth with a different LOD than the one it is rendered with</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        AddClothMappingLODBias,

        /// <summary>Add support for different external actor packaging schemes</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        AddLevelActorPackagingScheme,

        /// <summary>Add support for linking to the attached parent actor in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        WorldPartitionActorDescSerializeAttachParent,

        /// <summary>Converted AActor GridPlacement to bIsSpatiallyLoaded flag</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ConvertedActorGridPlacementToSpatiallyLoadedFlag,

        /// <summary>Fixup for bad default value for GridPlacement_DEPRECATED</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ActorGridPlacementDeprecateDefaultValueFixup,

        /// <summary>PackedLevelActor started using FWorldPartitionActorDesc (not currently checked against but added as a security)</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        PackedLevelActorUseWorldPartitionActorDesc,

        /// <summary>Add support for actor folder objects</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        AddLevelActorFolders,

        /// <summary>Remove FSkeletalMeshLODModel bulk datas</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        RemoveSkeletalMeshLODModelBulkDatas,

        /// <summary>Exclude brightness from the EncodedHDRCubemap,</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ExcludeBrightnessFromEncodedHDRCubemap,

        /// <summary>Unified volumetric cloud component quality sample count slider between main and reflection views for consistency</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        VolumetricCloudSampleCountUnification,

        /// <summary>Pose asset GUID generated from source AnimationSequence</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        PoseAssetRawDataGUID,

        /// <summary>Convolution bloom now take into account FPostProcessSettings::BloomIntensity for scatter dispersion.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ConvolutionBloomIntensity,

        /// <summary>Serialize FHLODSubActors instead of FGuids in WorldPartition HLODActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        WorldPartitionHLODActorDescSerializeHLODSubActors,

        /// <summary>Large Worlds - serialize double types as doubles</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        LargeWorldCoordinates,

        /// <summary>Deserialize old BP float and double types as real numbers for pins</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        BlueprintPinsUseRealNumbers,

        /// <summary>Changed shadow defaults for directional light components, version needed to not affect old things</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        UpdatedDirectionalLightShadowDefaults,

        /// <summary>Refresh geometry collections that had not already generated convex bodies.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        GeometryCollectionConvexDefaults,

        /// <summary>Add faster damping calculations to the cloth simulation and rename previous Damping parameter to LocalDamping.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosClothFasterDamping,

        /// <summary>Serialize LandscapeActorGuid in FLandscapeActorDesc sub class.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        WorldPartitionLandscapeActorDescSerializeLandscapeActorGuid,

        /// <summary>add inertia tensor and rotation of mass to convex </summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        AddedInertiaTensorAndRotationOfMassAddedToConvex,

        /// <summary>Storing inertia tensor as vec3 instead of matrix.</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        ChaosInertiaConvertedToVec3,

        /// <summary>For Blueprint real numbers, ensure that legacy float data is serialized as single-precision</summary>
        [Introduced(EngineVersion.VER_UE5_0)]
        SerializeFloatPinDefaultValuesAsSinglePrecision,

        /// <summary>Upgrade the BlendMasks array in existing LayeredBoneBlend nodes</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        AnimLayeredBoneBlendMasks,

        /// <summary>Uses RG11B10 format to store the encoded reflection capture data on mobile</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        StoreReflectionCaptureEncodedHDRDataInRG11B10Format,

        /// <summary>Add WithSerializer type trait and implementation for FRawAnimSequenceTrack</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        RawAnimSequenceTrackSerializer,

        /// <summary>Removed font from FEditableTextBoxStyle, and added FTextBlockStyle instead.</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        RemoveDuplicatedStyleInfo,

        /// <summary>Added member reference to linked anim graphs</summary>
        [Introduced(EngineVersion.VER_UE5_1)]
        LinkedAnimGraphMemberReference,

        /// <summary>Changed default tangent behavior for new dynamic mesh components</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        DynamicMeshComponentsDefaultUseExternalTangents,

        /// <summary>Added resize methods to media capture</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        MediaCaptureNewResizeMethods,

        /// <summary>Function data stores a map from work to debug operands</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        RigVMSaveDebugMapInGraphFunctionData,

        /// <summary>Changed default Local Exposure Contrast Scale from 1.0 to 0.8</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        LocalExposureDefaultChangeFrom1,

        /// <summary>Serialize bActorIsListedInSceneOutliner in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        WorldPartitionActorDescSerializeActorIsListedInSceneOutliner,

        /// <summary>Disabled opencolorio display configuration by default</summary>
        [Introduced(EngineVersion.VER_UE5_3)]
        OpenColorIODisabledDisplayConfigurationDefault,

        /// <summary>Serialize ExternalDataLayerAsset in WorldPartitionActorDesc</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        WorldPartitionExternalDataLayers,

        /// <summary>Fix Chaos Cloth fictitious angular scale bug that requires existing parameter rescaling.</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        ChaosClothFictitiousAngularVelocitySubframeFix,

        /// <summary>Store physics thread particles data in single precision</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        SinglePrecisonParticleDataPT,

        /// <summary>Orthographic Near and Far Plane Auto-resolve enabled by default</summary>
        [Introduced(EngineVersion.VER_UE5_4)]
        OrthographicAutoNearFarPlane,

        /// <summary>-----new versions can be added above this line-------------------------------------------------</summary>
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    public enum FNiagaraObjectVersion
    {
        /// <summary>Before any version changes were made</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        [Introduced(EngineVersion.VER_UE4_21)]
        SkeletalMeshVertexSampling = 1,

        /// <summary>-----new versions can be added above this line-------------------------------------------------</summary>
        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION_PLUS_ONE)]
        VersionPlusOne,

        [Introduced(EngineVersion.VER_UE4_AUTOMATIC_VERSION)]
        LatestVersion = VersionPlusOne - 1
    }

    public enum FNiagaraCustomVersion
    {
        /// <summary>Before any version changes were made in niagara</summary>
        [Introduced(EngineVersion.VER_UE4_OLDEST_LOADABLE_PACKAGE)]
        BeforeCustomVersionWasAdded = 0,

        /// <summary>Reworked vm external function binding to be more robust.</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        VMExternalFunctionBindingRework,

        /// <summary>Making all Niagara files reference the version number, allowing post loading recompilation if necessary.</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        PostLoadCompilationEnabled,

        /// <summary>Moved some runtime cost from external functions into the binding step and used variadic templates to neaten that code greatly.</summary>
        [Introduced(EngineVersion.VER_UE4_16)]
        VMExternalFunctionBindingReworkPartDeux,

        /// <summary>Moved per instance data needed for certain data interfaces out to it's own struct.</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        DataInterfacePerInstanceRework,

        /// <summary>Added shader maps and corresponding infrastructure</summary>
        [Introduced(EngineVersion.VER_UE4_18)]
        NiagaraShaderMaps,

        /// <summary>Combined Spawn, Update, and Event scripts into one graph.</summary>
        [Introduced(En
Download .txt
gitextract_6utsa1vi/

├── .github/
│   ├── ISSUE_TEMPLATE/
│   │   ├── bug_report.md
│   │   ├── config.yml
│   │   └── feature_request.md
│   ├── pull_request_template.md
│   └── workflows/
│       ├── build.yml
│       └── main.yml
├── .gitignore
├── LICENSE
├── NOTICE.md
├── README.md
├── UAssetAPI/
│   ├── AC7Decrypt.cs
│   ├── AssetBinaryReader.cs
│   ├── AssetBinaryWriter.cs
│   ├── CRCGenerator.cs
│   ├── CustomVersion.cs
│   ├── CustomVersions/
│   │   └── CustomVersions.cs
│   ├── ExportTypes/
│   │   ├── AssetImportDataExport.cs
│   │   ├── ClassExport.cs
│   │   ├── DataTableExport.cs
│   │   ├── EnumExport.cs
│   │   ├── Export.cs
│   │   ├── FieldExport.cs
│   │   ├── FunctionExport.cs
│   │   ├── LevelExport.cs
│   │   ├── MetaDataExport.cs
│   │   ├── NormalExport.cs
│   │   ├── PropertyExport.cs
│   │   ├── RawExport.cs
│   │   ├── StringTableExport.cs
│   │   ├── StructExport.cs
│   │   └── UserDefinedStructExport.cs
│   ├── FieldTypes/
│   │   ├── EArrayDim.cs
│   │   ├── ELifetimeCondition.cs
│   │   ├── FField.cs
│   │   └── UField.cs
│   ├── Import.cs
│   ├── JSON/
│   │   ├── ByteArrayJsonConverter.cs
│   │   ├── FNameJsonConverter.cs
│   │   ├── FPackageIndexJsonConverter.cs
│   │   ├── FSignedZeroJsonConverter.cs
│   │   ├── FStringJsonConverter.cs
│   │   ├── FStringTableJsonConverter.cs
│   │   ├── GuidJsonConverter.cs
│   │   ├── TMapJsonConverter.cs
│   │   └── UAssetContractResolver.cs
│   ├── Kismet/
│   │   ├── Bytecode/
│   │   │   ├── EBlueprintTextLiteralType.cs
│   │   │   ├── EExprToken.cs
│   │   │   ├── EScriptInstrumentationType.cs
│   │   │   ├── ExpressionSerializer.cs
│   │   │   ├── Expressions/
│   │   │   │   ├── EX_AddMulticastDelegate.cs
│   │   │   │   ├── EX_ArrayConst.cs
│   │   │   │   ├── EX_ArrayGetByRef.cs
│   │   │   │   ├── EX_Assert.cs
│   │   │   │   ├── EX_BindDelegate.cs
│   │   │   │   ├── EX_BitFieldConst.cs
│   │   │   │   ├── EX_Breakpoint.cs
│   │   │   │   ├── EX_ByteConst.cs
│   │   │   │   ├── EX_CallMath.cs
│   │   │   │   ├── EX_CallMulticastDelegate.cs
│   │   │   │   ├── EX_CastBase.cs
│   │   │   │   ├── EX_ClassContext.cs
│   │   │   │   ├── EX_ClassSparseDataVariable.cs
│   │   │   │   ├── EX_ClearMulticastDelegate.cs
│   │   │   │   ├── EX_ComputedJump.cs
│   │   │   │   ├── EX_Context.cs
│   │   │   │   ├── EX_Context_FailSilent.cs
│   │   │   │   ├── EX_CrossInterfaceCast.cs
│   │   │   │   ├── EX_DefaultVariable.cs
│   │   │   │   ├── EX_DeprecatedOp4A.cs
│   │   │   │   ├── EX_DoubleConst.cs
│   │   │   │   ├── EX_DynamicCast.cs
│   │   │   │   ├── EX_EndArray.cs
│   │   │   │   ├── EX_EndArrayConst.cs
│   │   │   │   ├── EX_EndFunctionParms.cs
│   │   │   │   ├── EX_EndMap.cs
│   │   │   │   ├── EX_EndMapConst.cs
│   │   │   │   ├── EX_EndOfScript.cs
│   │   │   │   ├── EX_EndParmValue.cs
│   │   │   │   ├── EX_EndSet.cs
│   │   │   │   ├── EX_EndSetConst.cs
│   │   │   │   ├── EX_EndStructConst.cs
│   │   │   │   ├── EX_False.cs
│   │   │   │   ├── EX_FieldPathConst.cs
│   │   │   │   ├── EX_FinalFunction.cs
│   │   │   │   ├── EX_FloatConst.cs
│   │   │   │   ├── EX_InstanceDelegate.cs
│   │   │   │   ├── EX_InstanceVariable.cs
│   │   │   │   ├── EX_InstrumentationEvent.cs
│   │   │   │   ├── EX_Int64Const.cs
│   │   │   │   ├── EX_IntConst.cs
│   │   │   │   ├── EX_IntConstByte.cs
│   │   │   │   ├── EX_IntOne.cs
│   │   │   │   ├── EX_IntZero.cs
│   │   │   │   ├── EX_InterfaceContext.cs
│   │   │   │   ├── EX_InterfaceToObjCast.cs
│   │   │   │   ├── EX_Jump.cs
│   │   │   │   ├── EX_JumpIfNot.cs
│   │   │   │   ├── EX_Let.cs
│   │   │   │   ├── EX_LetBase.cs
│   │   │   │   ├── EX_LetBool.cs
│   │   │   │   ├── EX_LetDelegate.cs
│   │   │   │   ├── EX_LetMulticastDelegate.cs
│   │   │   │   ├── EX_LetObj.cs
│   │   │   │   ├── EX_LetValueOnPersistentFrame.cs
│   │   │   │   ├── EX_LetWeakObjPtr.cs
│   │   │   │   ├── EX_LocalFinalFunction.cs
│   │   │   │   ├── EX_LocalOutVariable.cs
│   │   │   │   ├── EX_LocalVariable.cs
│   │   │   │   ├── EX_LocalVirtualFunction.cs
│   │   │   │   ├── EX_MapConst.cs
│   │   │   │   ├── EX_MetaCast.cs
│   │   │   │   ├── EX_NameConst.cs
│   │   │   │   ├── EX_NoInterface.cs
│   │   │   │   ├── EX_NoObject.cs
│   │   │   │   ├── EX_Nothing.cs
│   │   │   │   ├── EX_NothingInt32.cs
│   │   │   │   ├── EX_ObjToInterfaceCast.cs
│   │   │   │   ├── EX_ObjectConst.cs
│   │   │   │   ├── EX_PopExecutionFlow.cs
│   │   │   │   ├── EX_PopExecutionFlowIfNot.cs
│   │   │   │   ├── EX_PrimitiveCast.cs
│   │   │   │   ├── EX_PropertyConst.cs
│   │   │   │   ├── EX_PushExecutionFlow.cs
│   │   │   │   ├── EX_RemoveMulticastDelegate.cs
│   │   │   │   ├── EX_Return.cs
│   │   │   │   ├── EX_RotationConst.cs
│   │   │   │   ├── EX_Self.cs
│   │   │   │   ├── EX_SetArray.cs
│   │   │   │   ├── EX_SetConst.cs
│   │   │   │   ├── EX_SetMap.cs
│   │   │   │   ├── EX_SetSet.cs
│   │   │   │   ├── EX_Skip.cs
│   │   │   │   ├── EX_SkipOffsetConst.cs
│   │   │   │   ├── EX_SoftObjectConst.cs
│   │   │   │   ├── EX_StringConst.cs
│   │   │   │   ├── EX_StructConst.cs
│   │   │   │   ├── EX_StructMemberContext.cs
│   │   │   │   ├── EX_SwitchValue.cs
│   │   │   │   ├── EX_TextConst.cs
│   │   │   │   ├── EX_Tracepoint.cs
│   │   │   │   ├── EX_TransformConst.cs
│   │   │   │   ├── EX_True.cs
│   │   │   │   ├── EX_UInt64Const.cs
│   │   │   │   ├── EX_UnicodeStringConst.cs
│   │   │   │   ├── EX_VariableBase.cs
│   │   │   │   ├── EX_Vector3fConst.cs
│   │   │   │   ├── EX_VectorConst.cs
│   │   │   │   ├── EX_VirtualFunction.cs
│   │   │   │   └── EX_WireTracepoint.cs
│   │   │   ├── FScriptText.cs
│   │   │   ├── KismetExpression.cs
│   │   │   └── KismetPropertyPointer.cs
│   │   └── KismetSerializer.cs
│   ├── MainSerializer.cs
│   ├── Pak/
│   │   ├── Interop.cs
│   │   └── RePak.cs
│   ├── Properties/
│   │   ├── AssemblyInfo.cs
│   │   ├── Resources.Designer.cs
│   │   └── Resources.resx
│   ├── PropertyTypes/
│   │   ├── Objects/
│   │   │   ├── ArrayPropertyData.cs
│   │   │   ├── BoolPropertyData.cs
│   │   │   ├── BytePropertyData.cs
│   │   │   ├── DelegatePropertyData.cs
│   │   │   ├── DoublePropertyData.cs
│   │   │   ├── EnumPropertyData.cs
│   │   │   ├── FieldPathPropertyData.cs
│   │   │   ├── FloatPropertyData.cs
│   │   │   ├── Int16PropertyData.cs
│   │   │   ├── Int64PropertyData.cs
│   │   │   ├── Int8PropertyData.cs
│   │   │   ├── IntPropertyData.cs
│   │   │   ├── InterfacePropertyData.cs
│   │   │   ├── MapPropertyData.cs
│   │   │   ├── MulticastDelegatePropertyData.cs
│   │   │   ├── NamePropertyData.cs
│   │   │   ├── ObjectPropertyData.cs
│   │   │   ├── PropertyData.cs
│   │   │   ├── SetPropertyData.cs
│   │   │   ├── SoftObjectPropertyData.cs
│   │   │   ├── StrPropertyData.cs
│   │   │   ├── TextHistoryType.cs
│   │   │   ├── TextPropertyData.cs
│   │   │   ├── UInt16PropertyData.cs
│   │   │   ├── UInt32PropertyData.cs
│   │   │   ├── UInt64PropertyData.cs
│   │   │   ├── UnknownPropertyData.cs
│   │   │   └── WeakObjectPropertyData.cs
│   │   └── Structs/
│   │       ├── ClothLODDataPropertyData.cs
│   │       ├── ClothTetherDataPropertyData.cs
│   │       ├── Core/
│   │       │   ├── ColorPropertyData.cs
│   │       │   ├── DateTimePropertyData.cs
│   │       │   ├── GuidPropertyData.cs
│   │       │   └── TimespanPropertyData.cs
│   │       ├── Engine/
│   │       │   ├── FontCharacterPropertyData.cs
│   │       │   ├── KeyHandleMapPropertyData.cs
│   │       │   ├── MaterialInputProperties.cs
│   │       │   ├── MaterialOverrideNanitePropertyData.cs
│   │       │   ├── NavAgentSelectorPropertyData.cs
│   │       │   ├── PerPlatformProperties.cs
│   │       │   ├── PerQualityProperties.cs
│   │       │   ├── RichCurveKeyPropertyData.cs
│   │       │   ├── SkeletalMeshSamplingLODBuiltDataPropertyData.cs
│   │       │   ├── SkeletalMeshSamplingRegionBuiltDataPropertyData.cs
│   │       │   ├── SmartNamePropertyData.cs
│   │       │   ├── StringCurveKeyPropertyData.cs
│   │       │   ├── ViewTargetBlendParamsPropertyData.cs
│   │       │   └── WeightedRandomSamplerPropertyData.cs
│   │       ├── GameplayTagContainerPropertyData.cs
│   │       ├── LevelSequenceObjectReferenceMapPropertyData.cs
│   │       ├── Math/
│   │       │   ├── BoxPropertyData.cs
│   │       │   ├── IntPointPropertyData.cs
│   │       │   ├── IntVector2PropertyData.cs
│   │       │   ├── IntVectorPropertyData.cs
│   │       │   ├── LinearColorPropertyData.cs
│   │       │   ├── MatrixPropertyData.cs
│   │       │   ├── PlanePropertyData.cs
│   │       │   ├── QuatPropertyData.cs
│   │       │   ├── RotatorPropertyData.cs
│   │       │   ├── TwoVectorsPropertyData.cs
│   │       │   ├── Vector2DPropertyData.cs
│   │       │   ├── Vector2fPropertyData.cs
│   │       │   ├── Vector3fPropertyData.cs
│   │       │   ├── Vector4PropertyData.cs
│   │       │   ├── Vector4fPropertyData.cs
│   │       │   ├── VectorNetQuantizePropertyData.cs
│   │       │   └── VectorPropertyData.cs
│   │       ├── Movies/
│   │       │   ├── FrameNumberPropertyData.cs
│   │       │   ├── MovieScene.cs
│   │       │   ├── MovieSceneChannel.cs
│   │       │   ├── MovieSceneDoubleChannelPropertyData.cs
│   │       │   ├── MovieSceneEvalTemplatePtrPropertyData.cs
│   │       │   ├── MovieSceneEvaluationFieldEntityTreePropertyData.cs
│   │       │   ├── MovieSceneEvaluationTree.cs
│   │       │   ├── MovieSceneEvaluationTreeNode.cs
│   │       │   ├── MovieSceneEventParametersPropertyData.cs
│   │       │   ├── MovieSceneFloatChannelPropertyData.cs
│   │       │   ├── MovieSceneFloatValuePropertyData.cs
│   │       │   ├── MovieSceneFrameRangePropertyData.cs
│   │       │   ├── MovieSceneGenerationLedgerPropertyData.cs
│   │       │   ├── MovieSceneSegment.cs
│   │       │   ├── MovieSceneSegmentPropertyData.cs
│   │       │   ├── MovieSceneTrackIdentifierPropertyData.cs
│   │       │   ├── MovieSceneValue.cs
│   │       │   └── NameCurveKeyPropertyData.cs
│   │       ├── Niagara/
│   │       │   ├── NiagaraDataInterfaceGPUParamInfoPropertyData.cs
│   │       │   └── NiagaraVariablePropertyData.cs
│   │       ├── Ranges/
│   │       │   └── FloatRangePropertyData.cs
│   │       ├── RawStructPropertyData.cs
│   │       ├── Slate/
│   │       │   ├── DeprecateSlateVector2DPropertyData.cs
│   │       │   └── FontDataPropertyData.cs
│   │       ├── SoftObjectPathPropertyData.cs
│   │       └── StructPropertyData.cs
│   ├── UAPUtils.cs
│   ├── UAsset.cs
│   ├── UAssetAPI.csproj
│   ├── UnrealTypes/
│   │   ├── EngineVersion.cs
│   │   ├── FFieldPath.cs
│   │   ├── FGatherableTextData.cs
│   │   ├── FLocMetadataObject.cs
│   │   ├── FName.cs
│   │   ├── FObjectDataResource.cs
│   │   ├── FObjectThumbnail.cs
│   │   ├── FPackageIndex.cs
│   │   ├── FPropertyTypeName.cs
│   │   ├── FString.cs
│   │   ├── FTextSourceData.cs
│   │   ├── FTextSourceSiteContext.cs
│   │   ├── FUniversalObjectLocatorFragment.cs
│   │   ├── FWorldTileInfo.cs
│   │   ├── Flags.cs
│   │   ├── ObjectVersion.cs
│   │   ├── Objects/
│   │   │   ├── Core/
│   │   │   │   └── Math/
│   │   │   │       ├── FIntVector.cs
│   │   │   │       ├── FIntVector2.cs
│   │   │   │       ├── FLinearColor.cs
│   │   │   │       ├── FMatrix.cs
│   │   │   │       ├── FPlane.cs
│   │   │   │       ├── FQuat.cs
│   │   │   │       ├── FRotator.cs
│   │   │   │       ├── FTransform.cs
│   │   │   │       ├── FTwoVectors.cs
│   │   │   │       ├── FVector.cs
│   │   │   │       ├── FVector2D.cs
│   │   │   │       ├── FVector2f.cs
│   │   │   │       ├── FVector3f.cs
│   │   │   │       ├── FVector4.cs
│   │   │   │       ├── FVector4f.cs
│   │   │   │       ├── TBox.cs
│   │   │   │       └── TPerQualityLevel.cs
│   │   │   ├── Engine/
│   │   │   │   ├── CoreUObject/
│   │   │   │   │   ├── CoreUObjectEnums.cs
│   │   │   │   │   └── CoreUObjectStructs.cs
│   │   │   │   ├── EngineEnums.cs
│   │   │   │   ├── FFontCharacter.cs
│   │   │   │   ├── FRichCurveKey.cs
│   │   │   │   ├── FSkeletalMeshSamplingRegionBuiltData.cs
│   │   │   │   ├── FWeightedRandomSampler.cs
│   │   │   │   ├── GameFramework/
│   │   │   │   │   └── UniqueNetIdReplPropertyData.cs
│   │   │   │   └── Niagara/
│   │   │   │       └── FNiagaraDataInterfaceGPUParamInfo.cs
│   │   │   └── SlateCore/
│   │   │       └── FFontData.cs
│   │   ├── TMap.cs
│   │   └── UE4VersionToObjectVersion.cs
│   └── Unversioned/
│       ├── FFragment.cs
│       ├── FUnversionedHeader.cs
│       ├── Oodle.cs
│       ├── SaveGame.cs
│       ├── Usmap.cs
│       └── UsmapBinaryReader.cs
├── UAssetAPI.Benchmark/
│   ├── App.config
│   ├── Program.cs
│   ├── Properties/
│   │   └── AssemblyInfo.cs
│   ├── TestAssets/
│   │   ├── B_Gamemode.uasset
│   │   ├── Begin_Player.uasset
│   │   ├── HUB_Restaurant.uexp
│   │   ├── HUB_Restaurant.umap
│   │   ├── PlayerBase01.uexp
│   │   ├── PlayerBase01.umap
│   │   ├── Staging_T2.uexp
│   │   ├── Staging_T2.umap
│   │   └── _asset_versions.json
│   └── UAssetAPI.Benchmark.csproj
├── UAssetAPI.Tests/
│   ├── AssetUnitTests.cs
│   ├── CoolPropertyData.cs
│   ├── Properties/
│   │   ├── AssemblyInfo.cs
│   │   ├── Resources.Designer.cs
│   │   └── Resources.resx
│   ├── TestAssets/
│   │   ├── TestACE7/
│   │   │   ├── ex02_IGC_03_Subtitle.uasset
│   │   │   ├── ex02_IGC_03_Subtitle.uexp
│   │   │   ├── plwp_6aam_a0.uasset
│   │   │   └── plwp_6aam_a0.uexp
│   │   ├── TestCustomProperty/
│   │   │   └── AlternateStartActor.uasset
│   │   ├── TestCustomSerializationStructsInMap/
│   │   │   ├── wtf.uasset
│   │   │   └── wtf.uexp
│   │   ├── TestDuplicateNameMapEntries/
│   │   │   ├── BIOME_AzureWeald.uasset
│   │   │   └── BIOME_AzureWeald.uexp
│   │   ├── TestEditorAssets/
│   │   │   ├── TestActorBP.uasset
│   │   │   ├── TestMaterial.uasset
│   │   │   └── TestSoundClass.uasset
│   │   ├── TestImproperNameMapHashes/
│   │   │   ├── OC_Gatling_DamageB_B.uasset
│   │   │   └── OC_Gatling_DamageB_B.uexp
│   │   ├── TestJson/
│   │   │   ├── ABP_SMG_A.uasset
│   │   │   ├── ABP_SMG_A.uexp
│   │   │   ├── AssetDatabase_AutoGenerated.uasset
│   │   │   ├── AssetDatabase_AutoGenerated.uexp
│   │   │   ├── Atlas_6x4_Semi.uasset
│   │   │   ├── Atlas_6x4_Semi.uexp
│   │   │   ├── BlinkerLight_01.uasset
│   │   │   ├── BlinkerLight_01.uexp
│   │   │   ├── FrontDomeLight_2m.uasset
│   │   │   ├── FrontDomeLight_2m.uexp
│   │   │   ├── Items.uasset
│   │   │   ├── Items.uexp
│   │   │   ├── MGA_HeavyWeapon_Parent.uasset
│   │   │   ├── MGA_HeavyWeapon_Parent.uexp
│   │   │   ├── MTVehicleBaseBP.uasset
│   │   │   ├── MTVehicleBaseBP.uexp
│   │   │   ├── Map_FrontEnd_Hotel_LS_Night.uexp
│   │   │   ├── Map_FrontEnd_Hotel_LS_Night.umap
│   │   │   ├── MotorTown.usmap
│   │   │   ├── Outriders.usmap
│   │   │   ├── RaceSimDataAsset.uasset
│   │   │   ├── RaceSimDataAsset.uexp
│   │   │   ├── ReverseLight_01.uasset
│   │   │   ├── ReverseLight_01.uexp
│   │   │   ├── TaliLight_01.uasset
│   │   │   ├── TaliLight_01.uexp
│   │   │   ├── TurboAcres_Environment.uasset
│   │   │   ├── TurboAcres_Environment.uexp
│   │   │   ├── WPN_LockOnRifle.uasset
│   │   │   └── WPN_LockOnRifle.uexp
│   │   ├── TestManyAssets/
│   │   │   ├── Astroneer/
│   │   │   │   ├── Augment_BroadBrush.uasset
│   │   │   │   ├── DebugMenu.uasset
│   │   │   │   ├── LargeResourceCanister_IT.uasset
│   │   │   │   ├── ResourceProgressCurve.uasset
│   │   │   │   └── Staging_T2.umap
│   │   │   ├── Biodigital/
│   │   │   │   ├── Roboto.uasset
│   │   │   │   └── RobotoTiny.uasset
│   │   │   ├── Bloodstained/
│   │   │   │   ├── PB_DT_ItemMaster.uasset
│   │   │   │   ├── PB_DT_RandomizerRoomCheck.uasset
│   │   │   │   ├── m01SIP_000_BG.umap
│   │   │   │   ├── m01SIP_000_Gimmick.umap
│   │   │   │   ├── m02VIL_004_Gimmick.umap
│   │   │   │   └── m05SAN_000_Gimmick.umap
│   │   │   ├── BurningDaylight/
│   │   │   │   ├── TestMap.uexp
│   │   │   │   └── TestMap.umap
│   │   │   ├── CodeVein/
│   │   │   │   ├── SK_Inner_Female1.uasset
│   │   │   │   └── SK_Inner_Female1.uexp
│   │   │   ├── F1Manager2023/
│   │   │   │   ├── F1Manager2023.usmap
│   │   │   │   ├── FixedStaff.uasset
│   │   │   │   ├── FixedStaff.uexp
│   │   │   │   ├── MI_F1_Driver_LoganSargeant_Visor.uasset
│   │   │   │   ├── MI_F1_Driver_LoganSargeant_Visor.uexp
│   │   │   │   ├── StaffPhotoData.uasset
│   │   │   │   └── StaffPhotoData.uexp
│   │   │   ├── LiesOfP/
│   │   │   │   ├── ItemInfo.uasset
│   │   │   │   ├── ItemInfo.uexp
│   │   │   │   ├── LiesOfP.usmap
│   │   │   │   ├── SkillHitInfo.uasset
│   │   │   │   ├── SkillHitInfo.uexp
│   │   │   │   ├── SkillInfo.uasset
│   │   │   │   └── SkillInfo.uexp
│   │   │   ├── Liminal/
│   │   │   │   ├── FinalCinematic.uasset
│   │   │   │   ├── FinalCinematic.uexp
│   │   │   │   ├── InCathedralCinematic.uasset
│   │   │   │   ├── InCathedralCinematic.uexp
│   │   │   │   ├── InventoryStruct.uasset
│   │   │   │   └── InventoryStruct.uexp
│   │   │   ├── MISC_426/
│   │   │   │   ├── MainChar_BellySlice_BR.uasset
│   │   │   │   ├── MainChar_BellySlice_BR.uexp
│   │   │   │   ├── RaceSimDataAsset.uasset
│   │   │   │   └── RaceSimDataAsset.uexp
│   │   │   ├── MidAir/
│   │   │   │   ├── AM_MedChar_Reload_RingLauncher.uasset
│   │   │   │   ├── AM_MedChar_Reload_RingLauncher.uexp
│   │   │   │   ├── WBP_PartyPlayerRow.uasset
│   │   │   │   └── WBP_PartyPlayerRow.uexp
│   │   │   ├── MutantYearZero/
│   │   │   │   ├── ChroniclerpathCutscene.uasset
│   │   │   │   ├── ChroniclerpathCutscene.uexp
│   │   │   │   ├── MainCut.uasset
│   │   │   │   └── MainCut.uexp
│   │   │   ├── Palia/
│   │   │   │   ├── DT_FishConfigs.uasset
│   │   │   │   ├── DT_FishConfigs.uexp
│   │   │   │   ├── DT_FishingLevelConfigs.uasset
│   │   │   │   ├── DT_FishingLevelConfigs.uexp
│   │   │   │   ├── DT_FishingLevelSegmentConfigs.uasset
│   │   │   │   ├── DT_FishingLevelSegmentConfigs.uexp
│   │   │   │   ├── DT_FishingLootConfigs.uasset
│   │   │   │   ├── DT_FishingLootConfigs.uexp
│   │   │   │   ├── DT_FishingNibbleConfig.uasset
│   │   │   │   ├── DT_FishingNibbleConfig.uexp
│   │   │   │   ├── DT_FishingNibbleLevelConfig.uasset
│   │   │   │   ├── DT_FishingNibbleLevelConfig.uexp
│   │   │   │   ├── DT_ShopConfigs.uasset
│   │   │   │   ├── DT_ShopConfigs.uexp
│   │   │   │   └── Palia.usmap
│   │   │   ├── Palworld/
│   │   │   │   ├── BP_BuildObject_BaseCampWorkHard.uasset
│   │   │   │   ├── BP_BuildObject_BaseCampWorkHard.uexp
│   │   │   │   ├── BP_InteractableBox.uasset
│   │   │   │   ├── BP_InteractableBox.uexp
│   │   │   │   └── Palworld.usmap
│   │   │   ├── SnakePass/
│   │   │   │   ├── MP00_GateTutorial.uasset
│   │   │   │   └── MP00_Intro.uasset
│   │   │   ├── StarlitSeason/
│   │   │   │   ├── CharacterCostume_chr0001_DataTable.uasset
│   │   │   │   └── CharacterCostume_chr0001_DataTable.uexp
│   │   │   ├── Tekken/
│   │   │   │   └── BP_TekkenPlayer_Modular.uasset
│   │   │   ├── TheBeastInside/
│   │   │   │   ├── DV_ItemDescription.uasset
│   │   │   │   ├── DV_ItemDescription.uexp
│   │   │   │   ├── MF_CharacterEffects.uasset
│   │   │   │   └── MF_CharacterEffects.uexp
│   │   │   ├── TheOccupation/
│   │   │   │   ├── LiftStruct.uasset
│   │   │   │   └── RecieverPneumaticTerminals.uasset
│   │   │   ├── ToTheCore/
│   │   │   │   ├── BP_MimicCrate.uasset
│   │   │   │   └── BP_MimicCrate.uexp
│   │   │   └── VERSIONED/
│   │   │       └── Assault_M1A1Thompson_WW2_DrumSuppressor.uasset
│   │   ├── TestMaterials/
│   │   │   ├── M_COM_DetailMaster_B.uasset
│   │   │   ├── as_mt_base.uasset
│   │   │   └── as_mt_base.uexp
│   │   ├── TestUE5_1/
│   │   │   └── UnderlyingEnumTypes/
│   │   │       ├── NewDataTable.uasset
│   │   │       ├── NewDataTable.uexp
│   │   │       └── UnderlyingEnumTypes.usmap
│   │   ├── TestUE5_3/
│   │   │   ├── Engine/
│   │   │   │   ├── DefaultRecorderBoneCompression.uasset
│   │   │   │   ├── DefaultRecorderBoneCompression.uexp
│   │   │   │   ├── Engine.usmap
│   │   │   │   ├── Entry.uexp
│   │   │   │   ├── Entry.umap
│   │   │   │   ├── Entry_MODIFIED_INVALID_ENUM_INDEX.uexp
│   │   │   │   ├── Entry_MODIFIED_INVALID_ENUM_INDEX.umap
│   │   │   │   ├── OpenWorld.uexp
│   │   │   │   └── OpenWorld.umap
│   │   │   └── RON/
│   │   │       ├── AmmoDataTable.uasset
│   │   │       ├── AmmoDataTable.uexp
│   │   │       └── ReadyOrNot.usmap
│   │   ├── TestUE5_4/
│   │   │   ├── Bellwright/
│   │   │   │   ├── Bellwright.usmap
│   │   │   │   └── Content/
│   │   │   │       └── Mist/
│   │   │   │           └── Characters/
│   │   │   │               └── NPC/
│   │   │   │                   └── Villager/
│   │   │   │                       ├── HighSkill/
│   │   │   │                       │   ├── ApprenticeBlacksmithNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeBlacksmithNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeCarpenterNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeCarpenterNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeEngineerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeEngineerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeFarmerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeFarmerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeHealerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeHealerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeInkeeperNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeInkeeperNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeLabourerNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeLabourerNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeWeaverNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeWeaverNPCTemplate.uexp
│   │   │   │                       │   ├── ApprenticeWoodsmanNPCTemplate.uasset
│   │   │   │                       │   ├── ApprenticeWoodsmanNPCTemplate.uexp
│   │   │   │                       │   ├── HighNoTraitsVillagerIdleNPCTemplate.uasset
│   │   │   │                       │   ├── HighNoTraitsVillagerIdleNPCTemplate.uexp
│   │   │   │                       │   ├── HighVillagerIdleNPCTemplate.uasset
│   │   │   │                       │   └── HighVillagerIdleNPCTemplate.uexp
│   │   │   │                       ├── LowSkill/
│   │   │   │                       │   ├── LowBeggarNPCTemplate.uasset
│   │   │   │                       │   ├── LowBeggarNPCTemplate.uexp
│   │   │   │                       │   ├── LowVillagerIdleNPCTemplate.uasset
│   │   │   │                       │   ├── LowVillagerIdleNPCTemplate.uexp
│   │   │   │                       │   ├── LowVillagerIdleNoTraitsNPCTemplate.uasset
│   │   │   │                       │   └── LowVillagerIdleNoTraitsNPCTemplate.uexp
│   │   │   │                       └── MediumSkill/
│   │   │   │                           ├── MediumNoTraitsVillagerIdleNPCTemplate.uasset
│   │   │   │                           ├── MediumNoTraitsVillagerIdleNPCTemplate.uexp
│   │   │   │                           ├── MediumVillagerIdleNPCTemplate.uasset
│   │   │   │                           ├── MediumVillagerIdleNPCTemplate.uexp
│   │   │   │                           ├── NoviceBlacksmithNPCTemplate.uasset
│   │   │   │                           ├── NoviceBlacksmithNPCTemplate.uexp
│   │   │   │                           ├── NoviceCarpenterNPCTemplate.uasset
│   │   │   │                           ├── NoviceCarpenterNPCTemplate.uexp
│   │   │   │                           ├── NoviceEngineerNPCTemplate.uasset
│   │   │   │                           ├── NoviceEngineerNPCTemplate.uexp
│   │   │   │                           ├── NoviceFarmerNPCTemplate.uasset
│   │   │   │                           ├── NoviceFarmerNPCTemplate.uexp
│   │   │   │                           ├── NoviceHealerNPCTemplate.uasset
│   │   │   │                           ├── NoviceHealerNPCTemplate.uexp
│   │   │   │                           ├── NoviceInkeeperNPCTemplate.uasset
│   │   │   │                           ├── NoviceInkeeperNPCTemplate.uexp
│   │   │   │                           ├── NoviceLabourerNPCTemplate.uasset
│   │   │   │                           ├── NoviceLabourerNPCTemplate.uexp
│   │   │   │                           ├── NoviceWeaverNPCTemplate.uasset
│   │   │   │                           ├── NoviceWeaverNPCTemplate.uexp
│   │   │   │                           ├── NoviceWoodsmanNPCTemplate.uasset
│   │   │   │                           └── NoviceWoodsmanNPCTemplate.uexp
│   │   │   ├── Billiards/
│   │   │   │   ├── 5.4.3-34507850+++UE5+Release-5.4-DeepSpace7.usmap
│   │   │   │   ├── BP_Table_Lamp.uasset
│   │   │   │   └── BP_Table_Lamp.uexp
│   │   │   ├── BlankGame/
│   │   │   │   ├── BP_CubePawn.combined
│   │   │   │   ├── BP_CubePawn.uasset
│   │   │   │   ├── BP_CubePawn.uexp
│   │   │   │   ├── BlankGame_Dumper-7.usmap
│   │   │   │   ├── MI_BlueCube.uasset
│   │   │   │   ├── MI_BlueCube.uexp
│   │   │   │   ├── M_Cube.uasset
│   │   │   │   ├── M_Cube.uexp
│   │   │   │   ├── SM_BlueCube.uasset
│   │   │   │   └── SM_BlueCube.uexp
│   │   │   ├── JOY/
│   │   │   │   ├── 5.4.3-34507850+++UE5+Release-5.4-JOY.usmap
│   │   │   │   ├── BP_GameMode_Base.uasset
│   │   │   │   └── BP_GameMode_Base.uexp
│   │   │   └── TheForeverWinter/
│   │   │       ├── DA_DailyGiftList.uasset
│   │   │       ├── DA_DailyGiftList.uexp
│   │   │       └── TheForeverWinter.usmap
│   │   ├── TestUE5_5/
│   │   │   └── BlankGame/
│   │   │       ├── BP_Test.uasset
│   │   │       ├── BP_Test.uexp
│   │   │       ├── BlankUE5_5.usmap
│   │   │       ├── M_Cube_1.uasset
│   │   │       ├── M_Cube_1.uexp
│   │   │       ├── SM_Cube.uasset
│   │   │       ├── SM_Cube.ubulk
│   │   │       ├── SM_Cube.uexp
│   │   │       ├── T_Test.uasset
│   │   │       ├── T_Test.ubulk
│   │   │       ├── T_Test.uexp
│   │   │       ├── T_pl01_001_body_D.uasset
│   │   │       ├── T_pl01_001_body_D.uexp
│   │   │       ├── WBP_Hello.uasset
│   │   │       └── WBP_Hello.uexp
│   │   ├── TestUE5_6/
│   │   │   └── BpThirdPerson/
│   │   │       ├── BP_ThirdPersonCharacter.uasset
│   │   │       ├── BP_ThirdPersonCharacter.uexp
│   │   │       ├── ExplicitEnumValuesExample.usmap
│   │   │       ├── MI_Quinn_01.uasset
│   │   │       ├── MI_Quinn_01.uexp
│   │   │       ├── M_Mannequin.uasset
│   │   │       ├── M_Mannequin.uexp
│   │   │       ├── SKM_Quinn_Simple.uasset
│   │   │       ├── SKM_Quinn_Simple.uexp
│   │   │       ├── SM_Cube.uasset
│   │   │       ├── SM_Cube.ubulk
│   │   │       └── SM_Cube.uexp
│   │   └── TestUnknownProperties/
│   │       ├── BP_DetPack_Charge.uasset
│   │       └── BP_DetPack_Charge.uexp
│   └── UAssetAPI.Tests.csproj
├── UAssetAPI.sln
└── docs/
    ├── book.toml
    ├── correct_pages.py
    ├── correct_summary.py
    ├── css/
    │   └── custom.css
    ├── generate_docs.bat
    ├── generate_docs.sh
    └── src/
        ├── README.md
        ├── SUMMARY.md
        ├── SUMMARY_header.md
        ├── api/
        │   ├── uassetapi.ac7decrypt.md
        │   ├── uassetapi.ac7xorkey.md
        │   ├── uassetapi.assetbinaryreader.md
        │   ├── uassetapi.assetbinarywriter.md
        │   ├── uassetapi.crcgenerator.md
        │   ├── uassetapi.customserializationflags.md
        │   ├── uassetapi.customversion.md
        │   ├── uassetapi.customversions.fanimphysobjectversion.md
        │   ├── uassetapi.customversions.fassetregistryversion.md
        │   ├── uassetapi.customversions.fcoreobjectversion.md
        │   ├── uassetapi.customversions.feditorobjectversion.md
        │   ├── uassetapi.customversions.ffortnitemainbranchobjectversion.md
        │   ├── uassetapi.customversions.ffortnitereleasebranchcustomobjectversion.md
        │   ├── uassetapi.customversions.fframeworkobjectversion.md
        │   ├── uassetapi.customversions.fniagaracustomversion.md
        │   ├── uassetapi.customversions.fniagaraobjectversion.md
        │   ├── uassetapi.customversions.freleaseobjectversion.md
        │   ├── uassetapi.customversions.fsequencerobjectversion.md
        │   ├── uassetapi.customversions.fue5releasestreamobjectversion.md
        │   ├── uassetapi.customversions.introducedattribute.md
        │   ├── uassetapi.exporttypes.classexport.md
        │   ├── uassetapi.exporttypes.datatableexport.md
        │   ├── uassetapi.exporttypes.eclassserializationcontrolextension.md
        │   ├── uassetapi.exporttypes.ecppform.md
        │   ├── uassetapi.exporttypes.eexportfilterflags.md
        │   ├── uassetapi.exporttypes.enumexport.md
        │   ├── uassetapi.exporttypes.export.md
        │   ├── uassetapi.exporttypes.fieldexport.md
        │   ├── uassetapi.exporttypes.fstringtable.md
        │   ├── uassetapi.exporttypes.functionexport.md
        │   ├── uassetapi.exporttypes.furl.md
        │   ├── uassetapi.exporttypes.levelexport.md
        │   ├── uassetapi.exporttypes.metadataexport.md
        │   ├── uassetapi.exporttypes.normalexport.md
        │   ├── uassetapi.exporttypes.objectmetadataentry.md
        │   ├── uassetapi.exporttypes.propertyexport.md
        │   ├── uassetapi.exporttypes.rawexport.md
        │   ├── uassetapi.exporttypes.serializedinterfacereference.md
        │   ├── uassetapi.exporttypes.stringtableexport.md
        │   ├── uassetapi.exporttypes.structexport.md
        │   ├── uassetapi.exporttypes.udatatable.md
        │   ├── uassetapi.exporttypes.uenum.md
        │   ├── uassetapi.exporttypes.userdefinedstructexport.md
        │   ├── uassetapi.fengineversion.md
        │   ├── uassetapi.fgenerationinfo.md
        │   ├── uassetapi.fieldtypes.earraydim.md
        │   ├── uassetapi.fieldtypes.elifetimecondition.md
        │   ├── uassetapi.fieldtypes.farrayproperty.md
        │   ├── uassetapi.fieldtypes.fboolproperty.md
        │   ├── uassetapi.fieldtypes.fbyteproperty.md
        │   ├── uassetapi.fieldtypes.fclassproperty.md
        │   ├── uassetapi.fieldtypes.fdelegateproperty.md
        │   ├── uassetapi.fieldtypes.fenumproperty.md
        │   ├── uassetapi.fieldtypes.ffield.md
        │   ├── uassetapi.fieldtypes.fgenericproperty.md
        │   ├── uassetapi.fieldtypes.finterfaceproperty.md
        │   ├── uassetapi.fieldtypes.fmapproperty.md
        │   ├── uassetapi.fieldtypes.fmulticastdelegateproperty.md
        │   ├── uassetapi.fieldtypes.fmulticastinlinedelegateproperty.md
        │   ├── uassetapi.fieldtypes.fnumericproperty.md
        │   ├── uassetapi.fieldtypes.fobjectproperty.md
        │   ├── uassetapi.fieldtypes.foptionalproperty.md
        │   ├── uassetapi.fieldtypes.fproperty.md
        │   ├── uassetapi.fieldtypes.fsetproperty.md
        │   ├── uassetapi.fieldtypes.fsoftclassproperty.md
        │   ├── uassetapi.fieldtypes.fsoftobjectproperty.md
        │   ├── uassetapi.fieldtypes.fstructproperty.md
        │   ├── uassetapi.fieldtypes.fweakobjectproperty.md
        │   ├── uassetapi.fieldtypes.uarrayproperty.md
        │   ├── uassetapi.fieldtypes.uassetclassproperty.md
        │   ├── uassetapi.fieldtypes.uassetobjectproperty.md
        │   ├── uassetapi.fieldtypes.uboolproperty.md
        │   ├── uassetapi.fieldtypes.ubyteproperty.md
        │   ├── uassetapi.fieldtypes.uclassproperty.md
        │   ├── uassetapi.fieldtypes.udelegateproperty.md
        │   ├── uassetapi.fieldtypes.udoubleproperty.md
        │   ├── uassetapi.fieldtypes.uenumproperty.md
        │   ├── uassetapi.fieldtypes.ufield.md
        │   ├── uassetapi.fieldtypes.ufloatproperty.md
        │   ├── uassetapi.fieldtypes.ugenericproperty.md
        │   ├── uassetapi.fieldtypes.uint16property.md
        │   ├── uassetapi.fieldtypes.uint64property.md
        │   ├── uassetapi.fieldtypes.uint8property.md
        │   ├── uassetapi.fieldtypes.uinterfaceproperty.md
        │   ├── uassetapi.fieldtypes.uintproperty.md
        │   ├── uassetapi.fieldtypes.ulazyobjectproperty.md
        │   ├── uassetapi.fieldtypes.umapproperty.md
        │   ├── uassetapi.fieldtypes.umulticastdelegateproperty.md
        │   ├── uassetapi.fieldtypes.umulticastinlinedelegateproperty.md
        │   ├── uassetapi.fieldtypes.umulticastsparsedelegateproperty.md
        │   ├── uassetapi.fieldtypes.unameproperty.md
        │   ├── uassetapi.fieldtypes.unumericproperty.md
        │   ├── uassetapi.fieldtypes.uobjectproperty.md
        │   ├── uassetapi.fieldtypes.uproperty.md
        │   ├── uassetapi.fieldtypes.usetproperty.md
        │   ├── uassetapi.fieldtypes.usoftclassproperty.md
        │   ├── uassetapi.fieldtypes.usoftobjectproperty.md
        │   ├── uassetapi.fieldtypes.ustrproperty.md
        │   ├── uassetapi.fieldtypes.ustructproperty.md
        │   ├── uassetapi.fieldtypes.utextproperty.md
        │   ├── uassetapi.fieldtypes.uuint16property.md
        │   ├── uassetapi.fieldtypes.uuint32property.md
        │   ├── uassetapi.fieldtypes.uuint64property.md
        │   ├── uassetapi.fieldtypes.uweakobjectproperty.md
        │   ├── uassetapi.import.md
        │   ├── uassetapi.inamemap.md
        │   ├── uassetapi.invalidmappingsexception.md
        │   ├── uassetapi.json.bytearrayjsonconverter.md
        │   ├── uassetapi.json.fnamejsonconverter.md
        │   ├── uassetapi.json.fpackageindexjsonconverter.md
        │   ├── uassetapi.json.fsignedzerojsonconverter.md
        │   ├── uassetapi.json.fstringjsonconverter.md
        │   ├── uassetapi.json.fstringtablejsonconverter.md
        │   ├── uassetapi.json.guidjsonconverter.md
        │   ├── uassetapi.json.tmapjsonconverter-2.md
        │   ├── uassetapi.json.uassetcontractresolver.md
        │   ├── uassetapi.kismet.bytecode.eblueprinttextliteraltype.md
        │   ├── uassetapi.kismet.bytecode.ecasttoken.md
        │   ├── uassetapi.kismet.bytecode.eexprtoken.md
        │   ├── uassetapi.kismet.bytecode.escriptinstrumentationtype.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_addmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_arrayconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_arraygetbyref.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_assert.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_binddelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_bitfieldconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_breakpoint.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_byteconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_callmath.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_callmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_castbase.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_classcontext.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_classsparsedatavariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_clearmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_computedjump.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_context.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_context_failsilent.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_crossinterfacecast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_defaultvariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_deprecatedop4a.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_doubleconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_dynamiccast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endarray.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endarrayconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endfunctionparms.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endmap.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endmapconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endofscript.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endparmvalue.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endset.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endsetconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_endstructconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_false.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_fieldpathconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_finalfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_floatconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_instancedelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_instancevariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_instrumentationevent.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_int64const.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intconstbyte.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_interfacecontext.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_interfacetoobjcast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intone.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_intzero.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_jump.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_jumpifnot.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_let.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letbase.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letbool.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letmulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letobj.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letvalueonpersistentframe.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_letweakobjptr.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localfinalfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localoutvariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localvariable.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_localvirtualfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_mapconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_metacast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nameconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nointerface.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_noobject.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nothing.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_nothingint32.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_objectconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_objtointerfacecast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_popexecutionflow.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_popexecutionflowifnot.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_primitivecast.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_propertyconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_pushexecutionflow.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_removemulticastdelegate.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_return.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_rotationconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_self.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setarray.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setmap.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_setset.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_skip.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_skipoffsetconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_softobjectconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_stringconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_structconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_structmembercontext.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_switchvalue.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_textconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_tracepoint.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_transformconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_true.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_uint64const.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_unicodestringconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_variablebase.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_vector3fconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_vectorconst.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_virtualfunction.md
        │   ├── uassetapi.kismet.bytecode.expressions.ex_wiretracepoint.md
        │   ├── uassetapi.kismet.bytecode.expressions.fkismetswitchcase.md
        │   ├── uassetapi.kismet.bytecode.expressionserializer.md
        │   ├── uassetapi.kismet.bytecode.fscripttext.md
        │   ├── uassetapi.kismet.bytecode.kismetexpression-1.md
        │   ├── uassetapi.kismet.bytecode.kismetexpression.md
        │   ├── uassetapi.kismet.bytecode.kismetpropertypointer.md
        │   ├── uassetapi.kismet.kismetserializer.md
        │   ├── uassetapi.mainserializer.md
        │   ├── uassetapi.namemapoutofrangeexception.md
        │   ├── uassetapi.pakbuilder.md
        │   ├── uassetapi.pakcompression.md
        │   ├── uassetapi.pakreader.md
        │   ├── uassetapi.pakversion.md
        │   ├── uassetapi.pakwriter.md
        │   ├── uassetapi.propertytypes.objects.ancestryinfo.md
        │   ├── uassetapi.propertytypes.objects.arraypropertydata.md
        │   ├── uassetapi.propertytypes.objects.assetobjectpropertydata.md
        │   ├── uassetapi.propertytypes.objects.boolpropertydata.md
        │   ├── uassetapi.propertytypes.objects.bytepropertydata.md
        │   ├── uassetapi.propertytypes.objects.bytepropertytype.md
        │   ├── uassetapi.propertytypes.objects.delegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.doublepropertydata.md
        │   ├── uassetapi.propertytypes.objects.enumpropertydata.md
        │   ├── uassetapi.propertytypes.objects.eoverriddenpropertyoperation.md
        │   ├── uassetapi.propertytypes.objects.epropertytagextension.md
        │   ├── uassetapi.propertytypes.objects.epropertytagflags.md
        │   ├── uassetapi.propertytypes.objects.etextflag.md
        │   ├── uassetapi.propertytypes.objects.etransformtype.md
        │   ├── uassetapi.propertytypes.objects.fdelegate.md
        │   ├── uassetapi.propertytypes.objects.fformatargumentdata.md
        │   ├── uassetapi.propertytypes.objects.fformatargumentvalue.md
        │   ├── uassetapi.propertytypes.objects.fieldpathpropertydata.md
        │   ├── uassetapi.propertytypes.objects.floatpropertydata.md
        │   ├── uassetapi.propertytypes.objects.fnumberformattingoptions.md
        │   ├── uassetapi.propertytypes.objects.fsoftobjectpath.md
        │   ├── uassetapi.propertytypes.objects.ftoplevelassetpath.md
        │   ├── uassetapi.propertytypes.objects.int16propertydata.md
        │   ├── uassetapi.propertytypes.objects.int64propertydata.md
        │   ├── uassetapi.propertytypes.objects.int8propertydata.md
        │   ├── uassetapi.propertytypes.objects.interfacepropertydata.md
        │   ├── uassetapi.propertytypes.objects.intpropertydata.md
        │   ├── uassetapi.propertytypes.objects.istruct-1.md
        │   ├── uassetapi.propertytypes.objects.mappropertydata.md
        │   ├── uassetapi.propertytypes.objects.multicastdelegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.multicastinlinedelegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.multicastsparsedelegatepropertydata.md
        │   ├── uassetapi.propertytypes.objects.namepropertydata.md
        │   ├── uassetapi.propertytypes.objects.objectpropertydata.md
        │   ├── uassetapi.propertytypes.objects.propertydata-1.md
        │   ├── uassetapi.propertytypes.objects.propertydata.md
        │   ├── uassetapi.propertytypes.objects.propertyserializationcontext.md
        │   ├── uassetapi.propertytypes.objects.setpropertydata.md
        │   ├── uassetapi.propertytypes.objects.softobjectpropertydata.md
        │   ├── uassetapi.propertytypes.objects.strpropertydata.md
        │   ├── uassetapi.propertytypes.objects.texthistorytype.md
        │   ├── uassetapi.propertytypes.objects.textpropertydata.md
        │   ├── uassetapi.propertytypes.objects.uint16propertydata.md
        │   ├── uassetapi.propertytypes.objects.uint32propertydata.md
        │   ├── uassetapi.propertytypes.objects.uint64propertydata.md
        │   ├── uassetapi.propertytypes.objects.unknownpropertydata.md
        │   ├── uassetapi.propertytypes.objects.weakobjectpropertydata.md
        │   ├── uassetapi.propertytypes.structs.box2dpropertydata.md
        │   ├── uassetapi.propertytypes.structs.box2fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.boxpropertydata.md
        │   ├── uassetapi.propertytypes.structs.clothloddatacommonpropertydata.md
        │   ├── uassetapi.propertytypes.structs.clothloddatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.clothtetherdatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.colormaterialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.colorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.datetimepropertydata.md
        │   ├── uassetapi.propertytypes.structs.deprecateslatevector2dpropertydata.md
        │   ├── uassetapi.propertytypes.structs.esectionevaluationflags.md
        │   ├── uassetapi.propertytypes.structs.expressioninputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.fentityandmetadataindex.md
        │   ├── uassetapi.propertytypes.structs.fentry.md
        │   ├── uassetapi.propertytypes.structs.fevaluationtreeentryhandle.md
        │   ├── uassetapi.propertytypes.structs.flevelsequencelegacyobjectreference.md
        │   ├── uassetapi.propertytypes.structs.floatrangepropertydata.md
        │   ├── uassetapi.propertytypes.structs.fmeshtomeshvertdata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenechannel-1.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenedoublechannel.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenedoublevalue.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationfieldentitytree.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationkey.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationtree.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationtreenode.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneevaluationtreenodehandle.md
        │   ├── uassetapi.propertytypes.structs.fmoviesceneeventparameters.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenefloatchannel.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenefloatvalue.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesegment.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsectiondata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsectionfielddata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsequencetree.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenesubsequencetreeentry.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenetangentdata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenetrackfielddata.md
        │   ├── uassetapi.propertytypes.structs.fmoviescenevalue-1.md
        │   ├── uassetapi.propertytypes.structs.fnamecurvekey.md
        │   ├── uassetapi.propertytypes.structs.fnavagentselector.md
        │   ├── uassetapi.propertytypes.structs.fontcharacterpropertydata.md
        │   ├── uassetapi.propertytypes.structs.fontdatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.framenumberpropertydata.md
        │   ├── uassetapi.propertytypes.structs.fsectionevaluationdatatree.md
        │   ├── uassetapi.propertytypes.structs.fstringcurvekey.md
        │   ├── uassetapi.propertytypes.structs.gameplaytagcontainerpropertydata.md
        │   ├── uassetapi.propertytypes.structs.guidpropertydata.md
        │   ├── uassetapi.propertytypes.structs.intpointpropertydata.md
        │   ├── uassetapi.propertytypes.structs.intvector2propertydata.md
        │   ├── uassetapi.propertytypes.structs.intvectorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.keyhandlemappropertydata.md
        │   ├── uassetapi.propertytypes.structs.levelsequenceobjectreferencemappropertydata.md
        │   ├── uassetapi.propertytypes.structs.linearcolorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.materialattributesinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.materialoverridenanitepropertydata.md
        │   ├── uassetapi.propertytypes.structs.matrixpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenedoublechannelpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneevaltemplateptrpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneevaluationfieldentitytreepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneevaluationkeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneeventparameterspropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenefloatchannelpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenefloatvaluepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviesceneframerangepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenegenerationledgerpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesegmentidentifierpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesegmentpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesequenceidpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesequenceinstancedataptrpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesubsectionfielddatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenesubsequencetreepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetemplatepropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetrackfielddatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetrackidentifierpropertydata.md
        │   ├── uassetapi.propertytypes.structs.moviescenetrackimplementationptrpropertydata.md
        │   ├── uassetapi.propertytypes.structs.namecurvekeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.navagentselectorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaradatachannelvariablepropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaradatainterfacegpuparaminfopropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaravariablebasepropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaravariablepropertydata.md
        │   ├── uassetapi.propertytypes.structs.niagaravariablewithoffsetpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformboolpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformfloatpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformframeratepropertydata.md
        │   ├── uassetapi.propertytypes.structs.perplatformintpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perqualitylevelfloatpropertydata.md
        │   ├── uassetapi.propertytypes.structs.perqualitylevelintpropertydata.md
        │   ├── uassetapi.propertytypes.structs.planepropertydata.md
        │   ├── uassetapi.propertytypes.structs.quatpropertydata.md
        │   ├── uassetapi.propertytypes.structs.rawstructpropertydata.md
        │   ├── uassetapi.propertytypes.structs.richcurvekeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.rotatorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.scalarmaterialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.sectionevaluationdatatreepropertydata.md
        │   ├── uassetapi.propertytypes.structs.skeletalmeshareaweightedtrianglesamplerpropertydata.md
        │   ├── uassetapi.propertytypes.structs.skeletalmeshsamplinglodbuiltdatapropertydata.md
        │   ├── uassetapi.propertytypes.structs.smartnamepropertydata.md
        │   ├── uassetapi.propertytypes.structs.softassetpathpropertydata.md
        │   ├── uassetapi.propertytypes.structs.softclasspathpropertydata.md
        │   ├── uassetapi.propertytypes.structs.softobjectpathpropertydata.md
        │   ├── uassetapi.propertytypes.structs.stringassetreferencepropertydata.md
        │   ├── uassetapi.propertytypes.structs.stringclassreferencepropertydata.md
        │   ├── uassetapi.propertytypes.structs.stringcurvekeypropertydata.md
        │   ├── uassetapi.propertytypes.structs.structpropertydata.md
        │   ├── uassetapi.propertytypes.structs.tevaluationtreeentrycontainer-1.md
        │   ├── uassetapi.propertytypes.structs.timespanpropertydata.md
        │   ├── uassetapi.propertytypes.structs.tmoviesceneevaluationtree-1.md
        │   ├── uassetapi.propertytypes.structs.twovectorspropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector2dpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector2fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector2materialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector3fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector4fpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vector4propertydata.md
        │   ├── uassetapi.propertytypes.structs.vectormaterialinputpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantize100propertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantize10propertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantizenormalpropertydata.md
        │   ├── uassetapi.propertytypes.structs.vectornetquantizepropertydata.md
        │   ├── uassetapi.propertytypes.structs.vectorpropertydata.md
        │   ├── uassetapi.propertytypes.structs.viewtargetblendfunction.md
        │   ├── uassetapi.propertytypes.structs.viewtargetblendparamspropertydata.md
        │   ├── uassetapi.propertytypes.structs.weightedrandomsamplerpropertydata.md
        │   ├── uassetapi.repakinterop.md
        │   ├── uassetapi.streamcallbacks.md
        │   ├── uassetapi.structtypes.skeletalmeshsamplingregionbuiltdatapropertydata.md
        │   ├── uassetapi.uaputils.md
        │   ├── uassetapi.uasset.md
        │   ├── uassetapi.unknownengineversionexception.md
        │   ├── uassetapi.unrealbinaryreader.md
        │   ├── uassetapi.unrealbinarywriter.md
        │   ├── uassetapi.unrealtypes.comparer2-1.md
        │   ├── uassetapi.unrealtypes.dictionaryenumerator-2.md
        │   ├── uassetapi.unrealtypes.eaxis.md
        │   ├── uassetapi.unrealtypes.eclassflags.md
        │   ├── uassetapi.unrealtypes.efonthinting.md
        │   ├── uassetapi.unrealtypes.efontloadingpolicy.md
        │   ├── uassetapi.unrealtypes.efunctionflags.md
        │   ├── uassetapi.unrealtypes.einterpcurvemode.md
        │   ├── uassetapi.unrealtypes.emappednametype.md
        │   ├── uassetapi.unrealtypes.engineenums.animationcompressionformat.md
        │   ├── uassetapi.unrealtypes.engineenums.animationkeyformat.md
        │   ├── uassetapi.unrealtypes.engineenums.animphyscollisiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.animphystwistaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.beam2sourcetargetmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.beam2sourcetargettangentmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.beammodifiertype.md
        │   ├── uassetapi.unrealtypes.engineenums.cylinderheightaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.distributionparammode.md
        │   ├── uassetapi.unrealtypes.engineenums.eactorupdateoverlapsmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eadditiveanimationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eadditivebaseposetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eadmanagerdelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.eairabsorptionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.ealphablendoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ealphachannelmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eangularconstraintmotion.md
        │   ├── uassetapi.unrealtypes.engineenums.eangulardrivemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimalphainputtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimassetcurveflags.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimcurvetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimgrouprole.md
        │   ├── uassetapi.unrealtypes.engineenums.eaniminterpolationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimlinkmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eanimnotifyeventtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eantialiasingmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eapplicationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.easpectratioaxisconstraint.md
        │   ├── uassetapi.unrealtypes.engineenums.eattachlocation.md
        │   ├── uassetapi.unrealtypes.engineenums.eattachmentrule.md
        │   ├── uassetapi.unrealtypes.engineenums.eattenuationdistancemodel.md
        │   ├── uassetapi.unrealtypes.engineenums.eattenuationshape.md
        │   ├── uassetapi.unrealtypes.engineenums.eattractorparticleselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiocomponentplaystate.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiofadercurve.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiooutputtarget.md
        │   ├── uassetapi.unrealtypes.engineenums.eaudiorecordingexporttype.md
        │   ├── uassetapi.unrealtypes.engineenums.eautoexposuremethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eautoexposuremethodui.md
        │   ├── uassetapi.unrealtypes.engineenums.eautopossessai.md
        │   ├── uassetapi.unrealtypes.engineenums.eautoreceiveinput.md
        │   ├── uassetapi.unrealtypes.engineenums.eaxisoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ebeam2method.md
        │   ├── uassetapi.unrealtypes.engineenums.ebeamtapermethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eblendablelocation.md
        │   ├── uassetapi.unrealtypes.engineenums.eblendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eblendspaceaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.ebloommethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintcompilemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintnativizationflag.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintpinstyletype.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprintstatus.md
        │   ├── uassetapi.unrealtypes.engineenums.eblueprinttype.md
        │   ├── uassetapi.unrealtypes.engineenums.ebodycollisionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.eboneaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonecontrolspace.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonefilteractionoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonerotationsource.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonespaces.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonetranslationretargetingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ebonevisibilitystatus.md
        │   ├── uassetapi.unrealtypes.engineenums.ebrushtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecameraalphablendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecameraanimplayspace.md
        │   ├── uassetapi.unrealtypes.engineenums.ecameraprojectionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecamerashakeattenuation.md
        │   ├── uassetapi.unrealtypes.engineenums.ecanbecharacterbase.md
        │   ├── uassetapi.unrealtypes.engineenums.ecancreateconnectionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.echannelmaskparametercolor.md
        │   ├── uassetapi.unrealtypes.engineenums.eclampmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eclearsceneoptions.md
        │   ├── uassetapi.unrealtypes.engineenums.eclothmassmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecloudstoragedelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisionchannel.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisionenabled.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.ecollisiontraceflag.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponentcreationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponentmobility.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponentsockettype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecomponenttype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecompositetexturemode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecompositingsamplecount.md
        │   ├── uassetapi.unrealtypes.engineenums.econstraintframe.md
        │   ├── uassetapi.unrealtypes.engineenums.econstrainttransform.md
        │   ├── uassetapi.unrealtypes.engineenums.econtrolconstraint.md
        │   ├── uassetapi.unrealtypes.engineenums.econtrolleranalogstick.md
        │   ├── uassetapi.unrealtypes.engineenums.ecopytype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecsgoper.md
        │   ├── uassetapi.unrealtypes.engineenums.ecurveblendoption.md
        │   ├── uassetapi.unrealtypes.engineenums.ecurvetablemode.md
        │   ├── uassetapi.unrealtypes.engineenums.ecustomdepthstencil.md
        │   ├── uassetapi.unrealtypes.engineenums.ecustommaterialoutputtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ecustomtimestepsynchronizationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.edecalblendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.edecompressiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.edefaultbackbufferpixelformat.md
        │   ├── uassetapi.unrealtypes.engineenums.edemoplayfailure.md
        │   ├── uassetapi.unrealtypes.engineenums.edepthoffieldfunctionvalue.md
        │   ├── uassetapi.unrealtypes.engineenums.edepthoffieldmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.edetachmentrule.md
        │   ├── uassetapi.unrealtypes.engineenums.edetailmode.md
        │   ├── uassetapi.unrealtypes.engineenums.edistributionvectorlockflags.md
        │   ├── uassetapi.unrealtypes.engineenums.edistributionvectormirrorflags.md
        │   ├── uassetapi.unrealtypes.engineenums.edofmode.md
        │   ├── uassetapi.unrealtypes.engineenums.edrawdebugitemtype.md
        │   ├── uassetapi.unrealtypes.engineenums.edrawdebugtrace.md
        │   ├── uassetapi.unrealtypes.engineenums.edynamicforcefeedbackaction.md
        │   ├── uassetapi.unrealtypes.engineenums.eearlyzpass.md
        │   ├── uassetapi.unrealtypes.engineenums.eeasingfunc.md
        │   ├── uassetapi.unrealtypes.engineenums.eedgraphpindirection.md
        │   ├── uassetapi.unrealtypes.engineenums.eemitterdynamicparametervalue.md
        │   ├── uassetapi.unrealtypes.engineenums.eemitternormalsmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eemitterrendermode.md
        │   ├── uassetapi.unrealtypes.engineenums.eendplayreason.md
        │   ├── uassetapi.unrealtypes.engineenums.eevaluatecurvetableresult.md
        │   ├── uassetapi.unrealtypes.engineenums.eevaluatordatasource.md
        │   ├── uassetapi.unrealtypes.engineenums.eevaluatormode.md
        │   ├── uassetapi.unrealtypes.engineenums.efastarrayserializerdeltaflags.md
        │   ├── uassetapi.unrealtypes.engineenums.efilterinterpolationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.efontcachetype.md
        │   ├── uassetapi.unrealtypes.engineenums.efontimportcharacterset.md
        │   ├── uassetapi.unrealtypes.engineenums.eformatargumenttype.md
        │   ├── uassetapi.unrealtypes.engineenums.efrictioncombinemode.md
        │   ├── uassetapi.unrealtypes.engineenums.efullyloadpackagetype.md
        │   ├── uassetapi.unrealtypes.engineenums.efunctioninputtype.md
        │   ├── uassetapi.unrealtypes.engineenums.egbufferformat.md
        │   ├── uassetapi.unrealtypes.engineenums.egrammaticalgender.md
        │   ├── uassetapi.unrealtypes.engineenums.egrammaticalnumber.md
        │   ├── uassetapi.unrealtypes.engineenums.egraphaxisstyle.md
        │   ├── uassetapi.unrealtypes.engineenums.egraphdatastyle.md
        │   ├── uassetapi.unrealtypes.engineenums.egraphtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ehascustomnavigablegeometry.md
        │   ├── uassetapi.unrealtypes.engineenums.ehitproxypriority.md
        │   ├── uassetapi.unrealtypes.engineenums.ehoriztextaligment.md
        │   ├── uassetapi.unrealtypes.engineenums.eimportancelevel.md
        │   ├── uassetapi.unrealtypes.engineenums.eimportanceweight.md
        │   ├── uassetapi.unrealtypes.engineenums.eindirectlightingcachequality.md
        │   ├── uassetapi.unrealtypes.engineenums.einertializationbonestate.md
        │   ├── uassetapi.unrealtypes.engineenums.einertializationspace.md
        │   ├── uassetapi.unrealtypes.engineenums.einertializationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.einitialoscillatoroffset.md
        │   ├── uassetapi.unrealtypes.engineenums.einputevent.md
        │   ├── uassetapi.unrealtypes.engineenums.einterpmoveaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.einterptobehaviourtype.md
        │   ├── uassetapi.unrealtypes.engineenums.einterptrackmoverotmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ekinematicbonesupdatetophysics.md
        │   ├── uassetapi.unrealtypes.engineenums.elandscapecullingprecision.md
        │   ├── uassetapi.unrealtypes.engineenums.elegendposition.md
        │   ├── uassetapi.unrealtypes.engineenums.elerpinterpolationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.elightingbuildquality.md
        │   ├── uassetapi.unrealtypes.engineenums.elightmappaddingtype.md
        │   ├── uassetapi.unrealtypes.engineenums.elightmaptype.md
        │   ├── uassetapi.unrealtypes.engineenums.elightunits.md
        │   ├── uassetapi.unrealtypes.engineenums.elinearconstraintmotion.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationbonesocketselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationbonesocketsource.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationemitterselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.elocationskelvertsurfacesource.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialattributeblend.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialdecalresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialdomain.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialexposedtextureproperty.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialexposedviewproperty.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialfunctionusage.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialmergetype.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialparameterassociation.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialpositiontransformsource.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialproperty.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialsamplertype.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialsceneattributeinputmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialshadingmodel.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialstencilcompare.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialtessellationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialusage.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialvectorcoordtransform.md
        │   ├── uassetapi.unrealtypes.engineenums.ematerialvectorcoordtransformsource.md
        │   ├── uassetapi.unrealtypes.engineenums.ematrixcolumns.md
        │   ├── uassetapi.unrealtypes.engineenums.emaxconcurrentresolutionrule.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshbufferaccess.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshcamerafacingoptions.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshcamerafacingupaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshfeatureimportance.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshinstancingreplacementmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshlodselectiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshmergetype.md
        │   ├── uassetapi.unrealtypes.engineenums.emeshscreenalignment.md
        │   ├── uassetapi.unrealtypes.engineenums.emicrotransactiondelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.emicrotransactionresult.md
        │   ├── uassetapi.unrealtypes.engineenums.emobilemsaasamplecount.md
        │   ├── uassetapi.unrealtypes.engineenums.emoduletype.md
        │   ├── uassetapi.unrealtypes.engineenums.emonochannelupmixmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.emontagenotifyticktype.md
        │   ├── uassetapi.unrealtypes.engineenums.emontageplayreturntype.md
        │   ├── uassetapi.unrealtypes.engineenums.emontagesubstepresult.md
        │   ├── uassetapi.unrealtypes.engineenums.emousecapturemode.md
        │   ├── uassetapi.unrealtypes.engineenums.emouselockmode.md
        │   ├── uassetapi.unrealtypes.engineenums.emovecomponentaction.md
        │   ├── uassetapi.unrealtypes.engineenums.emovementmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enaturalsoundfalloffmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enavdatagatheringmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enavdatagatheringmodeconfig.md
        │   ├── uassetapi.unrealtypes.engineenums.enavigationoptionflag.md
        │   ├── uassetapi.unrealtypes.engineenums.enavigationqueryresult.md
        │   ├── uassetapi.unrealtypes.engineenums.enavlinkdirection.md
        │   ├── uassetapi.unrealtypes.engineenums.enavpathevent.md
        │   ├── uassetapi.unrealtypes.engineenums.enetdormancy.md
        │   ├── uassetapi.unrealtypes.engineenums.enetrole.md
        │   ├── uassetapi.unrealtypes.engineenums.enetworkfailure.md
        │   ├── uassetapi.unrealtypes.engineenums.enetworklagstate.md
        │   ├── uassetapi.unrealtypes.engineenums.enetworksmoothingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enodeadvancedpins.md
        │   ├── uassetapi.unrealtypes.engineenums.enodeenabledstate.md
        │   ├── uassetapi.unrealtypes.engineenums.enodetitletype.md
        │   ├── uassetapi.unrealtypes.engineenums.enoisefunction.md
        │   ├── uassetapi.unrealtypes.engineenums.enormalmode.md
        │   ├── uassetapi.unrealtypes.engineenums.enotifyfiltertype.md
        │   ├── uassetapi.unrealtypes.engineenums.enotifytriggermode.md
        │   ├── uassetapi.unrealtypes.engineenums.eobjecttypequery.md
        │   ├── uassetapi.unrealtypes.engineenums.eocclusioncombinemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eopacitysourcemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eoptimizationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eorbitchainmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eoscillatorwaveform.md
        │   ├── uassetapi.unrealtypes.engineenums.eoverlapfilteroption.md
        │   ├── uassetapi.unrealtypes.engineenums.epanningmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleaxislock.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleburstmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecameraoffsetupdatemethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecollisioncomplete.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecollisionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlecollisionresponse.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticledetailmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleeventtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlescreenalignment.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesignificancelevel.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesortmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesourceselectionmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesubuvinterpmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesysparamtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesysteminsignificancereaction.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesystemocclusionboundsmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticlesystemupdatemode.md
        │   ├── uassetapi.unrealtypes.engineenums.eparticleuvflipmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysbodyop.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicalmaterialmaskcolor.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicalsurface.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicstransformupdatemode.md
        │   ├── uassetapi.unrealtypes.engineenums.ephysicstype.md
        │   ├── uassetapi.unrealtypes.engineenums.epincontainertype.md
        │   ├── uassetapi.unrealtypes.engineenums.epinhidingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eplaneconstraintaxissetting.md
        │   ├── uassetapi.unrealtypes.engineenums.eplatforminterfacedatatype.md
        │   ├── uassetapi.unrealtypes.engineenums.epostcopyoperation.md
        │   ├── uassetapi.unrealtypes.engineenums.epreviewanimationblueprintapplicationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eprimaryassetcookrule.md
        │   ├── uassetapi.unrealtypes.engineenums.epriorityattenuationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.eproxynormalcomputationmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.epscpoolmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.equitpreference.md
        │   ├── uassetapi.unrealtypes.engineenums.eradialimpulsefalloff.md
        │   ├── uassetapi.unrealtypes.engineenums.erawcurvetracktypes.md
        │   ├── uassetapi.unrealtypes.engineenums.eraytracingglobalilluminationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.ereflectedandrefractedraytracedshadows.md
        │   ├── uassetapi.unrealtypes.engineenums.ereflectionsourcetype.md
        │   ├── uassetapi.unrealtypes.engineenums.ereflectionstype.md
        │   ├── uassetapi.unrealtypes.engineenums.erefractionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erelativetransformspace.md
        │   ├── uassetapi.unrealtypes.engineenums.erendererstencilmask.md
        │   ├── uassetapi.unrealtypes.engineenums.erenderfocusrule.md
        │   ├── uassetapi.unrealtypes.engineenums.ereporterlinestyle.md
        │   ├── uassetapi.unrealtypes.engineenums.ereverbsendmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvecompressionformat.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurveextrapolation.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurveinterpmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvekeytimecompressionformat.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvetangentmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erichcurvetangentweightmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionaccumulatemode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionfinishvelocitymode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionmode.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionrootlock.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionsourcesettingsflags.md
        │   ├── uassetapi.unrealtypes.engineenums.erootmotionsourcestatusflags.md
        │   ├── uassetapi.unrealtypes.engineenums.erotatorquantization.md
        │   ├── uassetapi.unrealtypes.engineenums.eroundingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eruntimevirtualtexturemainpasstype.md
        │   ├── uassetapi.unrealtypes.engineenums.eruntimevirtualtexturematerialtype.md
        │   ├── uassetapi.unrealtypes.engineenums.eruntimevirtualtexturemipvaluemode.md
        │   ├── uassetapi.unrealtypes.engineenums.esamplersourcemode.md
        │   ├── uassetapi.unrealtypes.engineenums.escenecapturecompositemode.md
        │   ├── uassetapi.unrealtypes.engineenums.escenecaptureprimitiverendermode.md
        │   ├── uassetapi.unrealtypes.engineenums.escenecapturesource.md
        │   ├── uassetapi.unrealtypes.engineenums.escenedepthprioritygroup.md
        │   ├── uassetapi.unrealtypes.engineenums.escenetextureid.md
        │   ├── uassetapi.unrealtypes.engineenums.escreenorientation.md
        │   ├── uassetapi.unrealtypes.engineenums.esendlevelcontrolmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.esettingsdof.md
        │   ├── uassetapi.unrealtypes.engineenums.esettingslockedaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.eshadowmapflags.md
        │   ├── uassetapi.unrealtypes.engineenums.eskeletalmeshgeoimportversions.md
        │   ├── uassetapi.unrealtypes.engineenums.eskeletalmeshskinningimportversions.md
        │   ├── uassetapi.unrealtypes.engineenums.eskincachedefaultbehavior.md
        │   ├── uassetapi.unrealtypes.engineenums.eskincacheusage.md
        │   ├── uassetapi.unrealtypes.engineenums.eskyatmospheretransformmode.md
        │   ├── uassetapi.unrealtypes.engineenums.eskylightsourcetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eslategesture.md
        │   ├── uassetapi.unrealtypes.engineenums.esleepfamily.md
        │   ├── uassetapi.unrealtypes.engineenums.esounddistancecalc.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundgroup.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundspatializationalgorithm.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundwavefftsize.md
        │   ├── uassetapi.unrealtypes.engineenums.esoundwaveloadingbehavior.md
        │   ├── uassetapi.unrealtypes.engineenums.esourcebuschannels.md
        │   ├── uassetapi.unrealtypes.engineenums.esourcebussendlevelcontrolmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.espawnactorcollisionhandlingmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.espeedtreegeometrytype.md
        │   ├── uassetapi.unrealtypes.engineenums.espeedtreelodtype.md
        │   ├── uassetapi.unrealtypes.engineenums.espeedtreewindtype.md
        │   ├── uassetapi.unrealtypes.engineenums.esplinecoordinatespace.md
        │   ├── uassetapi.unrealtypes.engineenums.esplinemeshaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.esplinepointtype.md
        │   ├── uassetapi.unrealtypes.engineenums.estandbytype.md
        │   ├── uassetapi.unrealtypes.engineenums.estaticmeshreductionterimationcriterion.md
        │   ├── uassetapi.unrealtypes.engineenums.estereolayershape.md
        │   ├── uassetapi.unrealtypes.engineenums.estereolayertype.md
        │   ├── uassetapi.unrealtypes.engineenums.estreamingvolumeusage.md
        │   ├── uassetapi.unrealtypes.engineenums.esubmixsendmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.esubuvboundingvertexcount.md
        │   ├── uassetapi.unrealtypes.engineenums.esuggestprojvelocitytraceoption.md
        │   ├── uassetapi.unrealtypes.engineenums.eteleporttype.md
        │   ├── uassetapi.unrealtypes.engineenums.etemperatureseveritytype.md
        │   ├── uassetapi.unrealtypes.engineenums.etextgender.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturecolorchannel.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturecompressionquality.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturelossycompressionamount.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturemipcount.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturemiploadoptions.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturemipvaluemode.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturepoweroftwosetting.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturerendertargetformat.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesamplerfilter.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesizingtype.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesourcearttype.md
        │   ├── uassetapi.unrealtypes.engineenums.etexturesourceformat.md
        │   ├── uassetapi.unrealtypes.engineenums.etickinggroup.md
        │   ├── uassetapi.unrealtypes.engineenums.etimecodeprovidersynchronizationstate.md
        │   ├── uassetapi.unrealtypes.engineenums.etimelinedirection.md
        │   ├── uassetapi.unrealtypes.engineenums.etimelinelengthmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etimelinesigtype.md
        │   ├── uassetapi.unrealtypes.engineenums.etimestretchcurvemapping.md
        │   ├── uassetapi.unrealtypes.engineenums.etracetypequery.md
        │   ├── uassetapi.unrealtypes.engineenums.etrackactivecondition.md
        │   ├── uassetapi.unrealtypes.engineenums.etracktoggleaction.md
        │   ├── uassetapi.unrealtypes.engineenums.etrail2sourcemethod.md
        │   ├── uassetapi.unrealtypes.engineenums.etrailsrenderaxisoption.md
        │   ├── uassetapi.unrealtypes.engineenums.etrailwidthmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etransitionblendmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etransitionlogictype.md
        │   ├── uassetapi.unrealtypes.engineenums.etransitiontype.md
        │   ├── uassetapi.unrealtypes.engineenums.etranslucencylightingmode.md
        │   ├── uassetapi.unrealtypes.engineenums.etranslucencytype.md
        │   ├── uassetapi.unrealtypes.engineenums.etranslucentsortpolicy.md
        │   ├── uassetapi.unrealtypes.engineenums.etravelfailure.md
        │   ├── uassetapi.unrealtypes.engineenums.etraveltype.md
        │   ├── uassetapi.unrealtypes.engineenums.etwitterintegrationdelegate.md
        │   ├── uassetapi.unrealtypes.engineenums.etwitterrequestmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.etypeadvanceanim.md
        │   ├── uassetapi.unrealtypes.engineenums.euiscalingrule.md
        │   ├── uassetapi.unrealtypes.engineenums.eupdaterateshiftbucket.md
        │   ├── uassetapi.unrealtypes.engineenums.euserdefinedstructurestatus.md
        │   ├── uassetapi.unrealtypes.engineenums.euvoutput.md
        │   ├── uassetapi.unrealtypes.engineenums.evectorfieldconstructionop.md
        │   ├── uassetapi.unrealtypes.engineenums.evectornoisefunction.md
        │   ├── uassetapi.unrealtypes.engineenums.evectorquantization.md
        │   ├── uassetapi.unrealtypes.engineenums.evertexpaintaxis.md
        │   ├── uassetapi.unrealtypes.engineenums.everticaltextaligment.md
        │   ├── uassetapi.unrealtypes.engineenums.eviewmodeindex.md
        │   ├── uassetapi.unrealtypes.engineenums.eviewtargetblendfunction.md
        │   ├── uassetapi.unrealtypes.engineenums.evirtualizationmode.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilityaggressiveness.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilitybasedanimtickoption.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilitytrackaction.md
        │   ├── uassetapi.unrealtypes.engineenums.evisibilitytrackcondition.md
        │   ├── uassetapi.unrealtypes.engineenums.evoicesamplerate.md
        │   ├── uassetapi.unrealtypes.engineenums.evolumelightingmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.ewalkableslopebehavior.md
        │   ├── uassetapi.unrealtypes.engineenums.ewindowmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ewindowtitlebarmode.md
        │   ├── uassetapi.unrealtypes.engineenums.ewindsourcetype.md
        │   ├── uassetapi.unrealtypes.engineenums.eworldpositionincludedoffsets.md
        │   ├── uassetapi.unrealtypes.engineenums.fnavigationsystemrunmode.md
        │   ├── uassetapi.unrealtypes.engineenums.modulationparammode.md
        │   ├── uassetapi.unrealtypes.engineenums.particlereplaystate.md
        │   ├── uassetapi.unrealtypes.engineenums.particlesystemlodmethod.md
        │   ├── uassetapi.unrealtypes.engineenums.reverbpreset.md
        │   ├── uassetapi.unrealtypes.engineenums.skeletalmeshoptimizationimportance.md
        │   ├── uassetapi.unrealtypes.engineenums.skeletalmeshoptimizationtype.md
        │   ├── uassetapi.unrealtypes.engineenums.skeletalmeshterminationcriterion.md
        │   ├── uassetapi.unrealtypes.engineenums.textureaddress.md
        │   ├── uassetapi.unrealtypes.engineenums.texturecompressionsettings.md
        │   ├── uassetapi.unrealtypes.engineenums.texturefilter.md
        │   ├── uassetapi.unrealtypes.engineenums.texturegroup.md
        │   ├── uassetapi.unrealtypes.engineenums.texturemipgensettings.md
        │   ├── uassetapi.unrealtypes.engineversion.md
        │   ├── uassetapi.unrealtypes.eobjectdataresourceflags.md
        │   ├── uassetapi.unrealtypes.eobjectdataresourceversion.md
        │   ├── uassetapi.unrealtypes.eobjectflags.md
        │   ├── uassetapi.unrealtypes.epackageflags.md
        │   ├── uassetapi.unrealtypes.epropertyflags.md
        │   ├── uassetapi.unrealtypes.erangeboundtypes.md
        │   ├── uassetapi.unrealtypes.ffieldpath.md
        │   ├── uassetapi.unrealtypes.ffontcharacter.md
        │   ├── uassetapi.unrealtypes.ffontdata.md
        │   ├── uassetapi.unrealtypes.fframenumber.md
        │   ├── uassetapi.unrealtypes.fframerate.md
        │   ├── uassetapi.unrealtypes.fframetime.md
        │   ├── uassetapi.unrealtypes.fgatherabletextdata.md
        │   ├── uassetapi.unrealtypes.fintvector.md
        │   ├── uassetapi.unrealtypes.fintvector2.md
        │   ├── uassetapi.unrealtypes.flinearcolor.md
        │   ├── uassetapi.unrealtypes.flocmetadataobject.md
        │   ├── uassetapi.unrealtypes.fmatrix.md
        │   ├── uassetapi.unrealtypes.fname.md
        │   ├── uassetapi.unrealtypes.fniagaradatainterfacegeneratedfunction.md
        │   ├── uassetapi.unrealtypes.fniagaradatainterfacegpuparaminfo.md
        │   ├── uassetapi.unrealtypes.fniagaravariablecommonreference.md
        │   ├── uassetapi.unrealtypes.fobjectdataresource.md
        │   ├── uassetapi.unrealtypes.fobjectthumbnail.md
        │   ├── uassetapi.unrealtypes.fpackageindex.md
        │   ├── uassetapi.unrealtypes.fplane.md
        │   ├── uassetapi.unrealtypes.fpropertytypename.md
        │   ├── uassetapi.unrealtypes.fpropertytypenameconverter.md
        │   ├── uassetapi.unrealtypes.fpropertytypenamenode.md
        │   ├── uassetapi.unrealtypes.fqualifiedframetime.md
        │   ├── uassetapi.unrealtypes.fquat.md
        │   ├── uassetapi.unrealtypes.frichcurvekey.md
        │   ├── uassetapi.unrealtypes.frotator.md
        │   ├── uassetapi.unrealtypes.fskeletalmeshareaweightedtrianglesampler.md
        │   ├── uassetapi.unrealtypes.fskeletalmeshsamplingregionbuiltdata.md
        │   ├── uassetapi.unrealtypes.fstring.md
        │   ├── uassetapi.unrealtypes.ftextsourcedata.md
        │   ├── uassetapi.unrealtypes.ftextsourcesitecontext.md
        │   ├── uassetapi.unrealtypes.ftimecode.md
        │   ├── uassetapi.unrealtypes.ftransform.md
        │   ├── uassetapi.unrealtypes.ftwovectors.md
        │   ├── uassetapi.unrealtypes.funiquenetid.md
        │   ├── uassetapi.unrealtypes.fvector.md
        │   ├── uassetapi.unrealtypes.fvector2d.md
        │   ├── uassetapi.unrealtypes.fvector2f.md
        │   ├── uassetapi.unrealtypes.fvector3f.md
        │   ├── uassetapi.unrealtypes.fvector4.md
        │   ├── uassetapi.unrealtypes.fvector4f.md
        │   ├── uassetapi.unrealtypes.fweightedrandomsampler.md
        │   ├── uassetapi.unrealtypes.fworldtileinfo.md
        │   ├── uassetapi.unrealtypes.fworldtilelayer.md
        │   ├── uassetapi.unrealtypes.fworldtilelodinfo.md
        │   ├── uassetapi.unrealtypes.iordereddictionary-2.md
        │   ├── uassetapi.unrealtypes.linearhelpers.md
        │   ├── uassetapi.unrealtypes.objectversion.md
        │   ├── uassetapi.unrealtypes.objectversionue5.md
        │   ├── uassetapi.unrealtypes.tbox-1.md
        │   ├── uassetapi.unrealtypes.tmap-2.md
        │   ├── uassetapi.unrealtypes.tperqualitylevel-1.md
        │   ├── uassetapi.unrealtypes.trange-1.md
        │   ├── uassetapi.unrealtypes.trangebound-1.md
        │   ├── uassetapi.unrealtypes.ue4versiontoobjectversion.md
        │   ├── uassetapi.unrealtypes.ue5versiontoobjectversion.md
        │   ├── uassetapi.unrealtypes.uniquenetidreplpropertydata.md
        │   ├── uassetapi.unrealtypes.universalobjectlocatorfragmentpropertydata.md
        │   ├── uassetapi.unversioned.ecompressionmethod.md
        │   ├── uassetapi.unversioned.ecustomversionserializationformat.md
        │   ├── uassetapi.unversioned.epropertytype.md
        │   ├── uassetapi.unversioned.esavegamefileversion.md
        │   ├── uassetapi.unversioned.ffragment.md
        │   ├── uassetapi.unversioned.funversionedheader.md
        │   ├── uassetapi.unversioned.oodle.md
        │   ├── uassetapi.unversioned.savegame.md
        │   ├── uassetapi.unversioned.usmap.md
        │   ├── uassetapi.unversioned.usmaparraydata.md
        │   ├── uassetapi.unversioned.usmapenum.md
        │   ├── uassetapi.unversioned.usmapenumdata.md
        │   ├── uassetapi.unversioned.usmapextensionlayoutversion.md
        │   ├── uassetapi.unversioned.usmapmapdata.md
        │   ├── uassetapi.unversioned.usmapproperty.md
        │   ├── uassetapi.unversioned.usmappropertydata.md
        │   ├── uassetapi.unversioned.usmapschema.md
        │   ├── uassetapi.unversioned.usmapschemapropertiesjsonconverter.md
        │   ├── uassetapi.unversioned.usmapstructdata.md
        │   ├── uassetapi.unversioned.usmapstructkind.md
        │   ├── uassetapi.unversioned.usmapversion.md
        │   └── uassetapi.usmapbinaryreader.md
        ├── guide/
        │   ├── basic.md
        │   ├── build.md
        │   └── extras.md
        └── samples/
            ├── plwp_6aam_a0.uasset
            └── plwp_6aam_a0.uexp
Download .txt
Showing preview only (280K chars total). Download the full file or copy to clipboard to get everything.
SYMBOL INDEX (2915 symbols across 297 files)

FILE: UAssetAPI.Benchmark/Program.cs
  class Program (line 15) | public class Program
    method BenchmarkAsset (line 17) | private static double BenchmarkAsset(string path, EngineVersion ver, U...
    method NumberToTwoDecimalPlaces (line 61) | private static string NumberToTwoDecimalPlaces(double num)
    method Run (line 74) | public static void Run(string[] args)
    method Main (line 367) | public static void Main(string[] args)

FILE: UAssetAPI.Tests/AssetUnitTests.cs
  class AssetUnitTests (line 15) | [TestClass]
    method VerifyBinaryEquality (line 21) | public void VerifyBinaryEquality(string file1, string file2)
    method AssertAllExportsParsedCorrectly (line 57) | public void AssertAllExportsParsedCorrectly(UAsset tester)
    method GetAllTestAssets (line 74) | public string[] GetAllTestAssets(string folder)
    method TestFSoftObjectPathEquality (line 84) | [TestMethod]
    method TestNameConstruction (line 159) | [TestMethod]
    method TestCDOModification (line 203) | [TestMethod]
    method TestCustomSerializationStructsInMap (line 232) | [TestMethod]
    method TestImproperNameMapHashes (line 265) | [TestMethod]
    method TestDuplicateNameMapEntries (line 295) | [TestMethod]
    method TestUnknownProperties (line 322) | [TestMethod]
    method TestManyAssetsSubsection (line 357) | private void TestManyAssetsSubsection(string game, EngineVersion versi...
    method TestUE5_3Subsection (line 370) | private void TestUE5_3Subsection(string game, EngineVersion version, U...
    method TestUE5_4Subsection (line 383) | private void TestUE5_4Subsection(string game, EngineVersion version, U...
    method TestUE5_5Subsection (line 396) | private void TestUE5_5Subsection(string game, EngineVersion version, U...
    method TestUE5_6Subsection (line 409) | private void TestUE5_6Subsection(string game, EngineVersion version, U...
    method TestGUIDs (line 425) | [TestMethod]
    method TestManyAssets (line 437) | [TestMethod]
    method TestDataTables (line 467) | [TestMethod]
    method TestJsonOnFile (line 515) | private void TestJsonOnFile(string file, EngineVersion version, string...
    method TestJson (line 538) | [TestMethod]
    method TestCustomProperty (line 559) | [TestMethod]
    method TestACE7 (line 590) | [TestMethod]
    method TestMaterials (line 628) | [TestMethod]
    method TestEditorAssets (line 645) | [TestMethod]
    method TestTraditionalUE5_3 (line 665) | [TestMethod]
    method TestTraditionalUE5_4 (line 676) | [TestMethod]
    method TestTraditionalUE5_5 (line 690) | [TestMethod]
    method TestTraditionalUE5_6 (line 700) | [TestMethod]
    method TestClone (line 709) | [TestMethod]
    method TestRepak (line 759) | [TestMethod]
    method TestUsmapWithOptionalProperty (line 789) | [TestMethod]
    method TestUsmapWithExplicitEnumValues (line 801) | [TestMethod]
    method TestUnderlyingEnumTypes (line 813) | [TestMethod]
    method PathToStream (line 866) | public static MemoryStream PathToStream(string p)
    method TestTracing (line 893) | [TestMethod]
    method AssemblyCleanup (line 911) | [AssemblyCleanup()]

FILE: UAssetAPI.Tests/CoolPropertyData.cs
  class CoolPropertyData (line 11) | public class CoolPropertyData : PropertyData<int>
    method CoolPropertyData (line 13) | public CoolPropertyData(FName name) : base(name)
    method CoolPropertyData (line 18) | public CoolPropertyData()
    method Read (line 26) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 35) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 46) | public override string ToString()
    method FromString (line 51) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI.Tests/Properties/Resources.Designer.cs
  class Resources (line 23) | [global::System.CodeDom.Compiler.GeneratedCodeAttribute("System.Resource...
    method Resources (line 32) | [global::System.Diagnostics.CodeAnalysis.SuppressMessageAttribute("Mic...

FILE: UAssetAPI/AC7Decrypt.cs
  class AC7XorKey (line 11) | public class AC7XorKey
    method SkipCount (line 18) | public void SkipCount(int count)
    method CalcNameKey (line 34) | private static int CalcNameKey(string fname)
    method CalcPKeyFromNKey (line 52) | private static void CalcPKeyFromNKey(int nkey, int dataoffset, out int...
    method AC7XorKey (line 79) | public AC7XorKey(string fname)
  class AC7Decrypt (line 89) | public class AC7Decrypt
    method AC7Decrypt (line 93) | public AC7Decrypt()
    method Decrypt (line 103) | public void Decrypt(string input, string output)
    method Encrypt (line 121) | public void Encrypt(string input, string output)
    method DecryptUAssetBytes (line 134) | public byte[] DecryptUAssetBytes(byte[] uasset, AC7XorKey xorkey)
    method EncryptUAssetBytes (line 146) | public byte[] EncryptUAssetBytes(byte[] uasset, AC7XorKey xorkey)
    method DecryptUexpBytes (line 158) | public byte[] DecryptUexpBytes(byte[] uexp, AC7XorKey xorkey)
    method EncryptUexpBytes (line 170) | public byte[] EncryptUexpBytes(byte[] uexp, AC7XorKey xorkey)
    method GetXorByte (line 181) | private static byte GetXorByte(byte tagb, ref AC7XorKey xorkey)

FILE: UAssetAPI/AssetBinaryReader.cs
  class UnrealBinaryReader (line 15) | public class UnrealBinaryReader : BinaryReader
    method UnrealBinaryReader (line 17) | public UnrealBinaryReader(Stream stream) : base(stream) { }
    method ReverseIfBigEndian (line 19) | protected byte[] ReverseIfBigEndian(byte[] data)
    method ReadInt16 (line 25) | public override short ReadInt16()
    method ReadUInt16 (line 30) | public override ushort ReadUInt16()
    method ReadInt32 (line 35) | public override int ReadInt32()
    method ReadUInt32 (line 40) | public override uint ReadUInt32()
    method ReadInt64 (line 45) | public override long ReadInt64()
    method ReadUInt64 (line 50) | public override ulong ReadUInt64()
    method ReadSingle (line 55) | public override float ReadSingle()
    method ReadDouble (line 60) | public override double ReadDouble()
    method ReadBooleanInt (line 65) | public bool ReadBooleanInt()
    method ReadString (line 76) | public override string ReadString()
    method ReadFString (line 81) | public virtual FString ReadFString()
    method ReadUtf8String (line 100) | public virtual FString ReadUtf8String()
    method ReadNameMapString (line 116) | public virtual FString ReadNameMapString(out uint hashes)
    method ReadCustomVersionContainer (line 140) | public List<CustomVersion> ReadCustomVersionContainer(ECustomVersionSe...
  class AssetBinaryReader (line 194) | public class AssetBinaryReader : UnrealBinaryReader
    method AssetBinaryReader (line 199) | public AssetBinaryReader(Stream stream, UAsset asset = null) : base(st...
    method AssetBinaryReader (line 204) | public AssetBinaryReader(Stream stream, bool inLoadUexp, UAsset asset ...
    method ReadPropertyGuid (line 210) | public virtual Guid? ReadPropertyGuid()
    method ReadFName (line 221) | public virtual FName ReadFName()
    method ReadArray (line 228) | public T[] ReadArray<T>(Func<T> readElement)
    method ReadObjectThumbnail (line 240) | public FObjectThumbnail ReadObjectThumbnail()
    method ReadLocMetadataObject (line 252) | public FLocMetadataObject ReadLocMetadataObject()
    method XFERSTRING (line 263) | public string XFERSTRING()
    method XFERUNICODESTRING (line 275) | public string XFERUNICODESTRING()
    method XFERTEXT (line 289) | public void XFERTEXT()
    method XFERNAME (line 294) | public FName XFERNAME()
    method XFER_FUNC_NAME (line 299) | public FName XFER_FUNC_NAME()
    method XFERPTR (line 304) | public FPackageIndex XFERPTR()
    method XFER_FUNC_POINTER (line 309) | public FPackageIndex XFER_FUNC_POINTER()
    method XFER_PROP_POINTER (line 314) | public KismetPropertyPointer XFER_PROP_POINTER()
    method XFER_OBJECT_POINTER (line 333) | public FPackageIndex XFER_OBJECT_POINTER()
    method ReadExpressionArray (line 338) | public KismetExpression[] ReadExpressionArray(EExprToken endToken)

FILE: UAssetAPI/AssetBinaryWriter.cs
  class UnrealBinaryWriter (line 15) | public class UnrealBinaryWriter : BinaryWriter
    method UnrealBinaryWriter (line 17) | public UnrealBinaryWriter() : base()
    method UnrealBinaryWriter (line 22) | public UnrealBinaryWriter(Stream stream) : base(stream)
    method UnrealBinaryWriter (line 27) | public UnrealBinaryWriter(Stream stream, Encoding encoding) : base(str...
    method UnrealBinaryWriter (line 32) | public UnrealBinaryWriter(Stream stream, Encoding encoding, bool leave...
    method ReverseIfBigEndian (line 37) | protected byte[] ReverseIfBigEndian(byte[] data)
    method Write (line 43) | public override void Write(short value)
    method Write (line 48) | public override void Write(ushort value)
    method Write (line 53) | public override void Write(int value)
    method Write (line 58) | public override void Write(uint value)
    method Write (line 63) | public override void Write(long value)
    method Write (line 68) | public override void Write(ulong value)
    method Write (line 73) | public override void Write(float value)
    method Write (line 78) | public override void Write(double value)
    method Write (line 83) | public override void Write(string value)
    method Write (line 88) | public virtual int Write(FString value)
    method WriteUtf8String (line 104) | public int WriteUtf8String(FString value)
    method WriteCustomVersionContainer (line 119) | public void WriteCustomVersionContainer(ECustomVersionSerializationFor...
  class AssetBinaryWriter (line 172) | public class AssetBinaryWriter : UnrealBinaryWriter
    method AssetBinaryWriter (line 176) | public AssetBinaryWriter(UAsset asset) : base()
    method AssetBinaryWriter (line 181) | public AssetBinaryWriter(Stream stream, UAsset asset) : base(stream)
    method AssetBinaryWriter (line 186) | public AssetBinaryWriter(Stream stream, Encoding encoding, UAsset asse...
    method AssetBinaryWriter (line 191) | public AssetBinaryWriter(Stream stream, Encoding encoding, bool leaveO...
    method Write (line 196) | public virtual void Write(FName name)
    method WritePropertyGuid (line 203) | public virtual void WritePropertyGuid(Guid? guid)
    method Write (line 213) | public virtual void Write(FObjectThumbnail thumbnail)
    method Write (line 222) | public virtual void Write(FLocMetadataObject metadataObject)
    method XFERSTRING (line 238) | public int XFERSTRING(string val)
    method XFERUNICODESTRING (line 246) | public int XFERUNICODESTRING(string val)
    method XFERNAME (line 254) | public int XFERNAME(FName val)
    method XFER_FUNC_NAME (line 261) | public int XFER_FUNC_NAME(FName val)
    method XFERPTR (line 269) | public int XFERPTR(FPackageIndex val)
    method XFER_FUNC_POINTER (line 276) | public int XFER_FUNC_POINTER(FPackageIndex val)
    method XFER_PROP_POINTER (line 282) | public int XFER_PROP_POINTER(KismetPropertyPointer val)
    method XFER_OBJECT_POINTER (line 301) | public int XFER_OBJECT_POINTER(FPackageIndex val)

FILE: UAssetAPI/CRCGenerator.cs
  class CRCGenerator (line 7) | public static class CRCGenerator
    method GenerateHash (line 9) | public static uint GenerateHash(FString text, bool disableCasePreservi...
    method GenerateHash (line 14) | public static uint GenerateHash(string text, bool disableCasePreservin...
    method GenerateHash (line 19) | public static uint GenerateHash(string text, Encoding encoding, bool d...
    method ToUpper (line 26) | public static char ToUpper(char input)
    method ToUpperVersion420 (line 31) | public static char ToUpperVersion420(char input)
    method ToUpper (line 36) | public static string ToUpper(string input)
    method ToLower (line 43) | public static char ToLower(char input)
    method ToLower (line 48) | public static string ToLower(string input, bool coalesceToSlash = false)
    method ToLower (line 60) | public static FString ToLower(FString input, bool coalesceToSlash = fa...
    method Strihash_DEPRECATED (line 67) | public static uint Strihash_DEPRECATED(string text, Encoding encoding,...
    method StrCrc32 (line 93) | public static uint StrCrc32(string text, uint CRC = 0)

FILE: UAssetAPI/CustomVersion.cs
  class CustomVersion (line 10) | public class CustomVersion : ICloneable
    method GetCustomVersionFriendlyNameFromGuid (line 77) | public static string GetCustomVersionFriendlyNameFromGuid(Guid guid)
    method GetCustomVersionGuidFromFriendlyName (line 87) | public static Guid GetCustomVersionGuidFromFriendlyName(string friendl...
    method SetIsSerialized (line 102) | public CustomVersion SetIsSerialized(bool val)
    method Clone (line 108) | public object Clone()
    method CustomVersion (line 123) | public CustomVersion(string friendlyName, int version)
    method CustomVersion (line 135) | public CustomVersion(Guid key, int version)
    method CustomVersion (line 145) | public CustomVersion()

FILE: UAssetAPI/CustomVersions/CustomVersions.cs
  class IntroducedAttribute (line 9) | [AttributeUsage(AttributeTargets.Field)]
    method IntroducedAttribute (line 14) | public IntroducedAttribute(EngineVersion introducedVersion)
  type FFortniteMainBranchObjectVersion (line 23) | public enum FFortniteMainBranchObjectVersion
  type FFrameworkObjectVersion (line 947) | public enum FFrameworkObjectVersion
  type FCoreObjectVersion (line 1110) | public enum FCoreObjectVersion
  type FEditorObjectVersion (line 1137) | public enum FEditorObjectVersion
  type FAnimPhysObjectVersion (line 1312) | public enum FAnimPhysObjectVersion
  type FReleaseObjectVersion (line 1395) | public enum FReleaseObjectVersion
  type FAssetRegistryVersion (line 1586) | public enum FAssetRegistryVersion
  type FSequencerObjectVersion (line 1666) | public enum FSequencerObjectVersion
  type FFortniteReleaseBranchCustomObjectVersion (line 1730) | public enum FFortniteReleaseBranchCustomObjectVersion
  type FUE5ReleaseStreamObjectVersion (line 1804) | public enum FUE5ReleaseStreamObjectVersion
  type FNiagaraObjectVersion (line 2022) | public enum FNiagaraObjectVersion
  type FNiagaraCustomVersion (line 2039) | public enum FNiagaraCustomVersion

FILE: UAssetAPI/ExportTypes/AssetImportDataExport.cs
  class AssetImportDataExport (line 5) | public class AssetImportDataExport : NormalExport
    method AssetImportDataExport (line 9) | public AssetImportDataExport(Export super) : base(super)
    method AssetImportDataExport (line 14) | public AssetImportDataExport(UAsset asset, byte[] extras) : base(asset...
    method AssetImportDataExport (line 19) | public AssetImportDataExport()
    method Read (line 24) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 31) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/ClassExport.cs
  type SerializedInterfaceReference (line 12) | public struct SerializedInterfaceReference
    method SerializedInterfaceReference (line 18) | public SerializedInterfaceReference(int @class, int pointerOffset, boo...
  class ClassExport (line 29) | public class ClassExport : StructExport
    method ClassExport (line 78) | public ClassExport(Export super) : base(super)
    method ClassExport (line 83) | public ClassExport(UAsset asset, byte[] extras) : base(asset, extras)
    method ClassExport (line 88) | public ClassExport()
    method Read (line 93) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 160) | public override void Write(AssetBinaryWriter writer)
    method SerializeInterfaces (line 206) | private void SerializeInterfaces(BinaryWriter writer)

FILE: UAssetAPI/ExportTypes/DataTableExport.cs
  class UDataTable (line 13) | public class UDataTable
    method UDataTable (line 17) | public UDataTable()
    method UDataTable (line 22) | public UDataTable(List<StructPropertyData> data)
  class DataTableExport (line 31) | public class DataTableExport : NormalExport
    method DataTableExport (line 102) | public DataTableExport(Export super) : base(super)
    method DataTableExport (line 107) | public DataTableExport(UDataTable data, UAsset asset, byte[] extras) :...
    method DataTableExport (line 112) | public DataTableExport()
    method Read (line 117) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method ResolveAncestries (line 162) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 179) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/EnumExport.cs
  type ECppForm (line 9) | public enum ECppForm
  class UEnum (line 19) | public class UEnum
    method Read (line 27) | public void Read(AssetBinaryReader reader, UAsset asset)
    method Write (line 70) | public void Write(AssetBinaryWriter writer, UAsset asset)
    method UEnum (line 109) | public UEnum()
  class EnumExport (line 118) | public class EnumExport : NormalExport
    method EnumExport (line 123) | public EnumExport(Export super) : base(super)
    method EnumExport (line 128) | public EnumExport(UAsset asset, byte[] extras) : base(asset, extras)
    method EnumExport (line 133) | public EnumExport()
    method Read (line 138) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 146) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/Export.cs
  class DisplayIndexOrderAttribute (line 13) | [AttributeUsage(AttributeTargets.Field | AttributeTargets.Property)]
    method DisplayIndexOrderAttribute (line 19) | internal DisplayIndexOrderAttribute(int displayingIndex, bool isIoStor...
  type EExportFilterFlags (line 30) | public enum EExportFilterFlags : byte
  class Export (line 40) | [JsonObject(MemberSerialization.OptOut)]
    method Export (line 141) | public Export(UAsset asset, byte[] extras)
    method Export (line 147) | public Export()
    method Read (line 152) | public virtual void Read(AssetBinaryReader reader, int nextStarting = 0)
    method ResolveAncestries (line 160) | public virtual void ResolveAncestries(UAsset asset, AncestryInfo ances...
    method Write (line 165) | public virtual void Write(AssetBinaryWriter writer)
    method ReadBit (line 172) | private bool ReadBit(AssetBinaryReader reader)
    method WriteBit (line 177) | private void WriteBit(AssetBinaryWriter writer, bool b)
    method ReadExportMapEntry (line 182) | public void ReadExportMapEntry(AssetBinaryReader reader)
    method GetExportMapEntrySize (line 238) | public static long GetExportMapEntrySize(UAsset asset)
    method WriteExportMapEntry (line 248) | public void WriteExportMapEntry(AssetBinaryWriter writer)
    method InitAllFields (line 305) | private static void InitAllFields()
    method GetAllObjectExportFields (line 311) | public static MemberInfo[] GetAllObjectExportFields(UAsset asset)
    method GetAllFieldNames (line 327) | public static string[] GetAllFieldNames(UAsset asset)
    method GetExportClassType (line 340) | public FName GetExportClassType()
    method GetClassTypeForAncestry (line 345) | public FName GetClassTypeForAncestry(UAsset asset, out FName modulePath)
    method GetClassTypeForAncestry (line 351) | public static FName GetClassTypeForAncestry(FPackageIndex classIndex, ...
    method ToString (line 362) | public override string ToString()
    method Clone (line 379) | public object Clone()
    method ConvertToChildExport (line 396) | public T ConvertToChildExport<T>() where T : Export, new()

FILE: UAssetAPI/ExportTypes/FieldExport.cs
  class FieldExport (line 8) | public class FieldExport : NormalExport
    method FieldExport (line 12) | public FieldExport(Export super) : base(super)
    method FieldExport (line 17) | public FieldExport(UAsset asset, byte[] extras) : base(asset, extras)
    method FieldExport (line 22) | public FieldExport()
    method Read (line 27) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 35) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/FunctionExport.cs
  class FunctionExport (line 10) | public class FunctionExport : StructExport
    method FunctionExport (line 13) | public FunctionExport(Export super) : base(super)
    method FunctionExport (line 19) | public FunctionExport(UAsset asset, byte[] extras) : base(asset, extras)
    method FunctionExport (line 24) | public FunctionExport()
    method Read (line 29) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 36) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/LevelExport.cs
  type FURL (line 10) | public struct FURL
    method FURL (line 26) | public FURL(AssetBinaryReader reader)
    method Write (line 42) | public int Write(AssetBinaryWriter writer){
  class LevelExport (line 60) | public class LevelExport : NormalExport
    method LevelExport (line 74) | public LevelExport(Export super) : base(super) { }
    method LevelExport (line 76) | public LevelExport(UAsset asset, byte[] extras) : base(asset, extras) { }
    method LevelExport (line 78) | public LevelExport(){ }
    method Read (line 80) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 112) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/MetaDataExport.cs
  type ObjectMetaDataEntry (line 9) | public struct ObjectMetaDataEntry
    method ObjectMetaDataEntry (line 15) | public ObjectMetaDataEntry(int import, TMap<FName, FString> metaData)
  class MetaDataExport (line 22) | public class MetaDataExport : NormalExport
    method MetaDataExport (line 28) | public MetaDataExport(Export super) : base(super)
    method MetaDataExport (line 33) | public MetaDataExport(UAsset asset, byte[] extras) : base(asset, extras)
    method MetaDataExport (line 38) | public MetaDataExport()
    method Read (line 42) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 77) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/NormalExport.cs
  type EClassSerializationControlExtension (line 13) | public enum EClassSerializationControlExtension
  class NormalExport (line 30) | public class NormalExport : Export
    method NormalExport (line 102) | public NormalExport(Export super)
    method NormalExport (line 108) | public NormalExport(UAsset asset, byte[] extras) : base(asset, extras)
    method NormalExport (line 113) | public NormalExport(List<PropertyData> data, UAsset asset, byte[] extr...
    method NormalExport (line 118) | public NormalExport()
    method Read (line 123) | public override void Read(AssetBinaryReader reader, int nextStarting = 0)
    method ResolveAncestries (line 163) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 175) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/PropertyExport.cs
  class PropertyExport (line 11) | public class PropertyExport : NormalExport
    method PropertyExport (line 15) | public PropertyExport(Export super) : base(super)
    method PropertyExport (line 20) | public PropertyExport(UAsset asset, byte[] extras) : base(asset, extras)
    method PropertyExport (line 25) | public PropertyExport()
    method Read (line 30) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 38) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/RawExport.cs
  class RawExport (line 10) | public class RawExport : Export
    method RawExport (line 14) | public RawExport(Export super)
    method RawExport (line 20) | public RawExport(byte[] data, UAsset asset, byte[] extras) : base(asse...
    method RawExport (line 25) | public RawExport()
    method Write (line 30) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/StringTableExport.cs
  class FStringTable (line 11) | public class FStringTable : TMap<FString, FString>
    method FStringTable (line 16) | public FStringTable(FString tableNamespace) : base()
    method FStringTable (line 21) | public FStringTable() : base()
  class StringTableExport (line 30) | public class StringTableExport : NormalExport
    method StringTableExport (line 35) | public StringTableExport(Export super) : base(super)
    method StringTableExport (line 40) | public StringTableExport(FStringTable data, UAsset asset, byte[] extra...
    method StringTableExport (line 45) | public StringTableExport()
    method Read (line 50) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 63) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/StructExport.cs
  class StructExport (line 18) | public class StructExport : FieldExport
    method StructExport (line 50) | public StructExport(Export super) : base(super)
    method StructExport (line 55) | public StructExport(UAsset asset, byte[] extras) : base(asset, extras)
    method StructExport (line 60) | public StructExport()
    method Read (line 65) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method Write (line 135) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/ExportTypes/UserDefinedStructExport.cs
  class UserDefinedStructExport (line 10) | public class UserDefinedStructExport : StructExport
    method UserDefinedStructExport (line 17) | public UserDefinedStructExport(Export super) : base(super) { }
    method UserDefinedStructExport (line 19) | public UserDefinedStructExport(UAsset asset, byte[] extras) : base(ass...
    method UserDefinedStructExport (line 21) | public UserDefinedStructExport() { }
    method Read (line 23) | public override void Read(AssetBinaryReader reader, int nextStarting)
    method ResolveAncestries (line 49) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 61) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/FieldTypes/EArrayDim.cs
  type EArrayDim (line 14) | public enum EArrayDim : int

FILE: UAssetAPI/FieldTypes/ELifetimeCondition.cs
  type ELifetimeCondition (line 12) | public enum ELifetimeCondition : byte

FILE: UAssetAPI/FieldTypes/FField.cs
  class FField (line 12) | public class FField
    method Read (line 19) | public virtual void Read(AssetBinaryReader reader)
    method Write (line 41) | public virtual void Write(AssetBinaryWriter writer)
    method FField (line 63) | public FField()
  class FProperty (line 72) | public abstract class FProperty : FField
    method SetObject (line 83) | public void SetObject(object value)
    method GetObject (line 88) | public T GetObject<T>()
    method GetUsmapPropertyType (line 101) | public EPropertyType GetUsmapPropertyType()
    method Read (line 109) | public override void Read(AssetBinaryReader reader)
    method Write (line 120) | public override void Write(AssetBinaryWriter writer)
    method FProperty (line 131) | public FProperty()
  class FEnumProperty (line 137) | public class FEnumProperty : FProperty
    method Read (line 144) | public override void Read(AssetBinaryReader reader)
    method Write (line 152) | public override void Write(AssetBinaryWriter writer)
  class FArrayProperty (line 161) | public class FArrayProperty : FProperty
    method Read (line 165) | public override void Read(AssetBinaryReader reader)
    method Write (line 171) | public override void Write(AssetBinaryWriter writer)
  class FSetProperty (line 178) | public class FSetProperty : FProperty
    method Read (line 182) | public override void Read(AssetBinaryReader reader)
    method Write (line 188) | public override void Write(AssetBinaryWriter writer)
  class FObjectProperty (line 195) | public class FObjectProperty : FProperty
    method Read (line 200) | public override void Read(AssetBinaryReader reader)
    method Write (line 206) | public override void Write(AssetBinaryWriter writer)
  class FSoftObjectProperty (line 213) | public class FSoftObjectProperty : FObjectProperty
  class FWeakObjectProperty (line 218) | public class FWeakObjectProperty : FObjectProperty
  class FClassProperty (line 223) | public class FClassProperty : FObjectProperty
    method Read (line 228) | public override void Read(AssetBinaryReader reader)
    method Write (line 234) | public override void Write(AssetBinaryWriter writer)
  class FSoftClassProperty (line 241) | public class FSoftClassProperty : FObjectProperty
    method Read (line 246) | public override void Read(AssetBinaryReader reader)
    method Write (line 252) | public override void Write(AssetBinaryWriter writer)
  class FDelegateProperty (line 259) | public class FDelegateProperty : FProperty
    method Read (line 264) | public override void Read(AssetBinaryReader reader)
    method Write (line 270) | public override void Write(AssetBinaryWriter writer)
  class FMulticastDelegateProperty (line 277) | public class FMulticastDelegateProperty : FDelegateProperty
  class FMulticastInlineDelegateProperty (line 282) | public class FMulticastInlineDelegateProperty : FMulticastDelegateProperty
  class FInterfaceProperty (line 287) | public class FInterfaceProperty : FProperty
    method Read (line 292) | public override void Read(AssetBinaryReader reader)
    method Write (line 298) | public override void Write(AssetBinaryWriter writer)
  class FMapProperty (line 305) | public class FMapProperty : FProperty
    method Read (line 310) | public override void Read(AssetBinaryReader reader)
    method Write (line 317) | public override void Write(AssetBinaryWriter writer)
  class FBoolProperty (line 325) | public class FBoolProperty : FProperty
    method Read (line 339) | public override void Read(AssetBinaryReader reader)
    method Write (line 352) | public override void Write(AssetBinaryWriter writer)
  class FByteProperty (line 364) | public class FByteProperty : FProperty
    method Read (line 369) | public override void Read(AssetBinaryReader reader)
    method Write (line 375) | public override void Write(AssetBinaryWriter writer)
  class FStructProperty (line 382) | public class FStructProperty : FProperty
    method Read (line 387) | public override void Read(AssetBinaryReader reader)
    method Write (line 393) | public override void Write(AssetBinaryWriter writer)
  class FNumericProperty (line 400) | public class FNumericProperty : FProperty
    method Read (line 402) | public override void Read(AssetBinaryReader reader)
    method Write (line 407) | public override void Write(AssetBinaryWriter writer)
  class FGenericProperty (line 416) | public class FGenericProperty : FProperty
    method Read (line 418) | public override void Read(AssetBinaryReader reader)
    method Write (line 423) | public override void Write(AssetBinaryWriter writer)
  class FOptionalProperty (line 429) | public class FOptionalProperty : FProperty
    method Read (line 433) | public override void Read(AssetBinaryReader reader)
    method Write (line 439) | public override void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/FieldTypes/UField.cs
  class UField (line 11) | public class UField
    method Read (line 19) | public virtual void Read(AssetBinaryReader reader)
    method Write (line 27) | public virtual void Write(AssetBinaryWriter writer)
    method UField (line 35) | public UField() { }
  class UProperty (line 41) | public abstract class UProperty : UField
    method SetObject (line 56) | public void SetObject(object value)
    method GetObject (line 61) | public T GetObject<T>()
    method Read (line 66) | public override void Read(AssetBinaryReader reader)
    method Write (line 79) | public override void Write(AssetBinaryWriter writer)
    method UProperty (line 92) | public UProperty() { }
    method GetUsmapPropertyType (line 94) | public EPropertyType GetUsmapPropertyType()
  class UEnumProperty (line 139) | public class UEnumProperty : UProperty
    method Read (line 148) | public override void Read(AssetBinaryReader reader)
    method Write (line 156) | public override void Write(AssetBinaryWriter writer)
  class UArrayProperty (line 165) | public class UArrayProperty : UProperty
    method Read (line 170) | public override void Read(AssetBinaryReader reader)
    method Write (line 176) | public override void Write(AssetBinaryWriter writer)
  class USetProperty (line 183) | public class USetProperty : UProperty
    method Read (line 188) | public override void Read(AssetBinaryReader reader)
    method Write (line 194) | public override void Write(AssetBinaryWriter writer)
  class UObjectProperty (line 201) | public class UObjectProperty : UProperty
    method Read (line 207) | public override void Read(AssetBinaryReader reader)
    method Write (line 213) | public override void Write(AssetBinaryWriter writer)
  class UWeakObjectProperty (line 220) | public class UWeakObjectProperty : UObjectProperty { }
  class USoftObjectProperty (line 222) | public class USoftObjectProperty : UObjectProperty { }
  class ULazyObjectProperty (line 224) | public class ULazyObjectProperty : UObjectProperty { }
  class UAssetObjectProperty (line 226) | public class UAssetObjectProperty : UObjectProperty { }
  class UClassProperty (line 228) | public class UClassProperty : UObjectProperty
    method Read (line 234) | public override void Read(AssetBinaryReader reader)
    method Write (line 240) | public override void Write(AssetBinaryWriter writer)
  class UAssetClassProperty (line 247) | public class UAssetClassProperty : UObjectProperty
    method Read (line 253) | public override void Read(AssetBinaryReader reader)
    method Write (line 259) | public override void Write(AssetBinaryWriter writer)
  class USoftClassProperty (line 266) | public class USoftClassProperty : UObjectProperty
    method Read (line 272) | public override void Read(AssetBinaryReader reader)
    method Write (line 278) | public override void Write(AssetBinaryWriter writer)
  class UDelegateProperty (line 285) | public class UDelegateProperty : UProperty
    method Read (line 291) | public override void Read(AssetBinaryReader reader)
    method Write (line 297) | public override void Write(AssetBinaryWriter writer)
  class UMulticastDelegateProperty (line 304) | public class UMulticastDelegateProperty : UDelegateProperty { }
  class UMulticastInlineDelegateProperty (line 306) | public class UMulticastInlineDelegateProperty : UMulticastDelegateProper...
  class UMulticastSparseDelegateProperty (line 308) | public class UMulticastSparseDelegateProperty : UMulticastDelegateProper...
  class UInterfaceProperty (line 310) | public class UInterfaceProperty : UProperty
    method Read (line 316) | public override void Read(AssetBinaryReader reader)
    method Write (line 322) | public override void Write(AssetBinaryWriter writer)
  class UMapProperty (line 329) | public class UMapProperty : UProperty
    method Read (line 336) | public override void Read(AssetBinaryReader reader)
    method Write (line 343) | public override void Write(AssetBinaryWriter writer)
  class UBoolProperty (line 351) | public class UBoolProperty : UProperty
    method Read (line 356) | public override void Read(AssetBinaryReader reader)
    method Write (line 364) | public override void Write(AssetBinaryWriter writer)
  class UByteProperty (line 372) | public class UByteProperty : UProperty
    method Read (line 378) | public override void Read(AssetBinaryReader reader)
    method Write (line 384) | public override void Write(AssetBinaryWriter writer)
  class UStructProperty (line 391) | public class UStructProperty : UProperty
    method Read (line 397) | public override void Read(AssetBinaryReader reader)
    method Write (line 403) | public override void Write(AssetBinaryWriter writer)
  class UNameProperty (line 410) | public class UNameProperty : UProperty { }
  class UStrProperty (line 412) | public class UStrProperty : UProperty { }
  class UTextProperty (line 414) | public class UTextProperty : UProperty { }
  class UNumericProperty (line 416) | public class UNumericProperty : UProperty { }
  class UDoubleProperty (line 418) | public class UDoubleProperty : UNumericProperty { }
  class UFloatProperty (line 420) | public class UFloatProperty : UNumericProperty { }
  class UIntProperty (line 422) | public class UIntProperty : UNumericProperty { }
  class UInt8Property (line 424) | public class UInt8Property : UNumericProperty { }
  class UInt16Property (line 426) | public class UInt16Property : UNumericProperty { }
  class UInt64Property (line 428) | public class UInt64Property : UNumericProperty { }
  class UUInt16Property (line 430) | public class UUInt16Property : UNumericProperty { }
  class UUInt32Property (line 432) | public class UUInt32Property : UNumericProperty { }
  class UUInt64Property (line 434) | public class UUInt64Property : UNumericProperty { }
  class UGenericProperty (line 439) | public class UGenericProperty : UProperty { }

FILE: UAssetAPI/Import.cs
  class Import (line 8) | public class Import
    method Import (line 23) | public Import(string classPackage, string className, FPackageIndex out...
    method Import (line 32) | public Import(FName classPackage, FName className, FPackageIndex outer...
    method Import (line 41) | public Import(AssetBinaryReader reader)
    method Import (line 55) | public Import()

FILE: UAssetAPI/JSON/ByteArrayJsonConverter.cs
  class ByteArrayJsonConverter (line 7) | public class ByteArrayJsonConverter : JsonConverter
    method CanConvert (line 9) | public override bool CanConvert(Type objectType)
    method WriteJson (line 14) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 24) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/FNameJsonConverter.cs
  class FNameJsonConverter (line 10) | public class FNameJsonConverter : JsonConverter
    method CanConvert (line 15) | public override bool CanConvert(Type objectType)
    method WriteJson (line 20) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 31) | public override object ReadJson(JsonReader reader, Type objectType, ob...
    method FNameJsonConverter (line 39) | public FNameJsonConverter(Dictionary<FName, string> dict) : base()

FILE: UAssetAPI/JSON/FPackageIndexJsonConverter.cs
  class FPackageIndexJsonConverter (line 8) | public class FPackageIndexJsonConverter : JsonConverter
    method CanConvert (line 10) | public override bool CanConvert(Type objectType)
    method WriteJson (line 15) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 25) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/FSignedZeroJsonConverter.cs
  class FSignedZeroJsonConverter (line 9) | public class FSignedZeroJsonConverter : JsonConverter
    method IsNegativeZero (line 13) | private static bool IsNegativeZero(double x)
    method CanConvert (line 18) | public override bool CanConvert(Type objectType)
    method WriteJson (line 23) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 41) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/FStringJsonConverter.cs
  class FStringJsonConverter (line 8) | public class FStringJsonConverter : JsonConverter
    method CanConvert (line 10) | public override bool CanConvert(Type objectType)
    method WriteJson (line 15) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 25) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/FStringTableJsonConverter.cs
  class FStringTableJsonConverter (line 11) | public class FStringTableJsonConverter : JsonConverter
    method CanConvert (line 13) | public override bool CanConvert(Type objectType)
    method WriteJson (line 18) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 49) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/GuidJsonConverter.cs
  class GuidJsonConverter (line 6) | public class GuidJsonConverter : JsonConverter
    method CanConvert (line 8) | public override bool CanConvert(Type objectType)
    method WriteJson (line 13) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 23) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/TMapJsonConverter.cs
  class TMapJsonConverter (line 37) | public class TMapJsonConverter<TKey, TValue> : JsonConverter
    method CanConvert (line 39) | public override bool CanConvert(Type objectType)
    method WriteJson (line 44) | public override void WriteJson(JsonWriter writer, object value, JsonSe...
    method ReadJson (line 68) | public override object ReadJson(JsonReader reader, Type objectType, ob...

FILE: UAssetAPI/JSON/UAssetContractResolver.cs
  class UAssetContractResolver (line 10) | public class UAssetContractResolver : DefaultContractResolver
    method ResolveContractConverter (line 14) | protected override JsonConverter ResolveContractConverter(Type objectT...
    method UAssetContractResolver (line 23) | public UAssetContractResolver(Dictionary<FName, string> toBeFilled) : ...

FILE: UAssetAPI/Kismet/Bytecode/EBlueprintTextLiteralType.cs
  type EBlueprintTextLiteralType (line 6) | public enum EBlueprintTextLiteralType : byte

FILE: UAssetAPI/Kismet/Bytecode/EExprToken.cs
  type EExprToken (line 6) | public enum EExprToken
  type ECastToken (line 200) | public enum ECastToken {

FILE: UAssetAPI/Kismet/Bytecode/EScriptInstrumentationType.cs
  type EScriptInstrumentationType (line 3) | public enum EScriptInstrumentationType : byte {

FILE: UAssetAPI/Kismet/Bytecode/ExpressionSerializer.cs
  class ExpressionSerializer (line 8) | public static class ExpressionSerializer
    method ReadExpression (line 10) | public static KismetExpression ReadExpression(AssetBinaryReader reader)
    method WriteExpression (line 318) | public static int WriteExpression(KismetExpression expr, AssetBinaryWr...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_AddMulticastDelegate.cs
  class EX_AddMulticastDelegate (line 11) | public class EX_AddMulticastDelegate : KismetExpression
    method EX_AddMulticastDelegate (line 30) | public EX_AddMulticastDelegate()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ArrayConst.cs
  class EX_ArrayConst (line 11) | public class EX_ArrayConst : KismetExpression<KismetExpression[]>
    method EX_ArrayConst (line 30) | public EX_ArrayConst()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 51) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 64) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ArrayGetByRef.cs
  class EX_ArrayGetByRef (line 11) | public class EX_ArrayGetByRef : KismetExpression
    method EX_ArrayGetByRef (line 30) | public EX_ArrayGetByRef()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Assert.cs
  class EX_Assert (line 11) | public class EX_Assert : KismetExpression
    method EX_Assert (line 36) | public EX_Assert()
    method Read (line 45) | public override void Read(AssetBinaryReader reader)
    method Write (line 57) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 66) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_BindDelegate.cs
  class EX_BindDelegate (line 11) | public class EX_BindDelegate : KismetExpression
    method EX_BindDelegate (line 36) | public EX_BindDelegate()
    method Read (line 45) | public override void Read(AssetBinaryReader reader)
    method Write (line 57) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 66) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_BitFieldConst.cs
  class EX_BitFieldConst (line 12) | public class EX_BitFieldConst : KismetExpression
    method EX_BitFieldConst (line 31) | public EX_BitFieldConst()
    method Read (line 40) | public override void Read(AssetBinaryReader reader)
    method Write (line 51) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Breakpoint.cs
  class EX_Breakpoint (line 6) | public class EX_Breakpoint : KismetExpression
    method EX_Breakpoint (line 13) | public EX_Breakpoint()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ByteConst.cs
  class EX_ByteConst (line 9) | public class EX_ByteConst : KismetExpression<byte>
    method EX_ByteConst (line 16) | public EX_ByteConst()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 41) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_CallMath.cs
  class EX_CallMath (line 6) | public class EX_CallMath : EX_FinalFunction
    method EX_CallMath (line 13) | public EX_CallMath() : base()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_CallMulticastDelegate.cs
  class EX_CallMulticastDelegate (line 11) | public class EX_CallMulticastDelegate : EX_FinalFunction
    method EX_CallMulticastDelegate (line 24) | public EX_CallMulticastDelegate()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 46) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 60) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_CastBase.cs
  class EX_CastBase (line 11) | public abstract class EX_CastBase : KismetExpression
    method Read (line 29) | public override void Read(AssetBinaryReader reader)
    method Write (line 40) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ClassContext.cs
  class EX_ClassContext (line 6) | public class EX_ClassContext : EX_Context
    method EX_ClassContext (line 13) | public EX_ClassContext()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ClassSparseDataVariable.cs
  class EX_ClassSparseDataVariable (line 10) | public class EX_ClassSparseDataVariable : EX_VariableBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ClearMulticastDelegate.cs
  class EX_ClearMulticastDelegate (line 11) | public class EX_ClearMulticastDelegate : KismetExpression
    method EX_ClearMulticastDelegate (line 24) | public EX_ClearMulticastDelegate()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ComputedJump.cs
  class EX_ComputedJump (line 11) | public class EX_ComputedJump : KismetExpression
    method EX_ComputedJump (line 24) | public EX_ComputedJump()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Context.cs
  class EX_Context (line 11) | public class EX_Context : KismetExpression
    method EX_Context (line 48) | public EX_Context()
    method Read (line 57) | public override void Read(AssetBinaryReader reader)
    method Write (line 74) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 89) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Context_FailSilent.cs
  class EX_Context_FailSilent (line 6) | public class EX_Context_FailSilent : EX_Context
    method EX_Context_FailSilent (line 13) | public EX_Context_FailSilent()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_CrossInterfaceCast.cs
  class EX_CrossInterfaceCast (line 10) | public class EX_CrossInterfaceCast : EX_CastBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_DefaultVariable.cs
  class EX_DefaultVariable (line 10) | public class EX_DefaultVariable : EX_VariableBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_DeprecatedOp4A.cs
  class EX_DeprecatedOp4A (line 6) | public class EX_DeprecatedOp4A : KismetExpression
    method EX_DeprecatedOp4A (line 13) | public EX_DeprecatedOp4A()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_DoubleConst.cs
  class EX_DoubleConst (line 12) | public class EX_DoubleConst : KismetExpression
    method EX_DoubleConst (line 26) | public EX_DoubleConst()
    method Read (line 35) | public override void Read(AssetBinaryReader reader)
    method Write (line 45) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 51) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_DynamicCast.cs
  class EX_DynamicCast (line 10) | public class EX_DynamicCast : EX_CastBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndArray.cs
  class EX_EndArray (line 6) | public class EX_EndArray : KismetExpression
    method EX_EndArray (line 13) | public EX_EndArray()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndArrayConst.cs
  class EX_EndArrayConst (line 6) | public class EX_EndArrayConst : KismetExpression
    method EX_EndArrayConst (line 13) | public EX_EndArrayConst()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndFunctionParms.cs
  class EX_EndFunctionParms (line 6) | public class EX_EndFunctionParms : KismetExpression
    method EX_EndFunctionParms (line 13) | public EX_EndFunctionParms()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndMap.cs
  class EX_EndMap (line 6) | public class EX_EndMap : KismetExpression
    method EX_EndMap (line 13) | public EX_EndMap()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndMapConst.cs
  class EX_EndMapConst (line 6) | public class EX_EndMapConst : KismetExpression
    method EX_EndMapConst (line 13) | public EX_EndMapConst()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndOfScript.cs
  class EX_EndOfScript (line 6) | public class EX_EndOfScript : KismetExpression
    method EX_EndOfScript (line 13) | public EX_EndOfScript()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndParmValue.cs
  class EX_EndParmValue (line 6) | public class EX_EndParmValue : KismetExpression
    method EX_EndParmValue (line 13) | public EX_EndParmValue()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndSet.cs
  class EX_EndSet (line 6) | public class EX_EndSet : KismetExpression
    method EX_EndSet (line 13) | public EX_EndSet()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndSetConst.cs
  class EX_EndSetConst (line 6) | public class EX_EndSetConst : KismetExpression
    method EX_EndSetConst (line 13) | public EX_EndSetConst()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_EndStructConst.cs
  class EX_EndStructConst (line 6) | public class EX_EndStructConst : KismetExpression
    method EX_EndStructConst (line 13) | public EX_EndStructConst()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_False.cs
  class EX_False (line 6) | public class EX_False : KismetExpression
    method EX_False (line 13) | public EX_False()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_FieldPathConst.cs
  class EX_FieldPathConst (line 9) | public class EX_FieldPathConst : KismetExpression<KismetExpression>
    method EX_FieldPathConst (line 16) | public EX_FieldPathConst()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 40) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_FinalFunction.cs
  class EX_FinalFunction (line 12) | public class EX_FinalFunction : KismetExpression
    method EX_FinalFunction (line 31) | public EX_FinalFunction()
    method Read (line 40) | public override void Read(AssetBinaryReader reader)
    method Write (line 52) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 65) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_FloatConst.cs
  class EX_FloatConst (line 12) | public class EX_FloatConst : KismetExpression
    method EX_FloatConst (line 26) | public EX_FloatConst()
    method Read (line 35) | public override void Read(AssetBinaryReader reader)
    method Write (line 45) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 51) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_InstanceDelegate.cs
  class EX_InstanceDelegate (line 11) | public class EX_InstanceDelegate : KismetExpression
    method EX_InstanceDelegate (line 24) | public EX_InstanceDelegate()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_InstanceVariable.cs
  class EX_InstanceVariable (line 10) | public class EX_InstanceVariable : EX_VariableBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_InstrumentationEvent.cs
  class EX_InstrumentationEvent (line 12) | public class EX_InstrumentationEvent : KismetExpression
    method EX_InstrumentationEvent (line 24) | public EX_InstrumentationEvent()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 48) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 59) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Int64Const.cs
  class EX_Int64Const (line 9) | public class EX_Int64Const : KismetExpression<long>
    method EX_Int64Const (line 16) | public EX_Int64Const()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 41) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_IntConst.cs
  class EX_IntConst (line 9) | public class EX_IntConst : KismetExpression<int>
    method EX_IntConst (line 16) | public EX_IntConst()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 41) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_IntConstByte.cs
  class EX_IntConstByte (line 6) | public class EX_IntConstByte : KismetExpression<byte>
    method EX_IntConstByte (line 13) | public EX_IntConstByte()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_IntOne.cs
  class EX_IntOne (line 6) | public class EX_IntOne : KismetExpression
    method EX_IntOne (line 13) | public EX_IntOne()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_IntZero.cs
  class EX_IntZero (line 6) | public class EX_IntZero : KismetExpression
    method EX_IntZero (line 13) | public EX_IntZero()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_InterfaceContext.cs
  class EX_InterfaceContext (line 11) | public class EX_InterfaceContext : KismetExpression
    method EX_InterfaceContext (line 24) | public EX_InterfaceContext()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_InterfaceToObjCast.cs
  class EX_InterfaceToObjCast (line 10) | public class EX_InterfaceToObjCast : EX_CastBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Jump.cs
  class EX_Jump (line 11) | public class EX_Jump : KismetExpression
    method EX_Jump (line 24) | public EX_Jump()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 49) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_JumpIfNot.cs
  class EX_JumpIfNot (line 12) | public class EX_JumpIfNot : KismetExpression
    method EX_JumpIfNot (line 31) | public EX_JumpIfNot()
    method Read (line 40) | public override void Read(AssetBinaryReader reader)
    method Write (line 51) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 59) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Let.cs
  class EX_Let (line 11) | public class EX_Let : KismetExpression
    method EX_Let (line 28) | public EX_Let()
    method Read (line 37) | public override void Read(AssetBinaryReader reader)
    method Write (line 52) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 64) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetBase.cs
  class EX_LetBase (line 11) | public abstract class EX_LetBase : KismetExpression
    method Read (line 34) | public override void Read(AssetBinaryReader reader)
    method Write (line 45) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 53) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetBool.cs
  class EX_LetBool (line 10) | public class EX_LetBool : EX_LetBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetDelegate.cs
  class EX_LetDelegate (line 10) | public class EX_LetDelegate : EX_LetBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetMulticastDelegate.cs
  class EX_LetMulticastDelegate (line 10) | public class EX_LetMulticastDelegate : EX_LetBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetObj.cs
  class EX_LetObj (line 10) | public class EX_LetObj : EX_LetBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetValueOnPersistentFrame.cs
  class EX_LetValueOnPersistentFrame (line 11) | public class EX_LetValueOnPersistentFrame : KismetExpression
    method EX_LetValueOnPersistentFrame (line 30) | public EX_LetValueOnPersistentFrame()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LetWeakObjPtr.cs
  class EX_LetWeakObjPtr (line 10) | public class EX_LetWeakObjPtr : EX_LetBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalFinalFunction.cs
  class EX_LocalFinalFunction (line 6) | public class EX_LocalFinalFunction : EX_FinalFunction
    method EX_LocalFinalFunction (line 13) | public EX_LocalFinalFunction() : base()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalOutVariable.cs
  class EX_LocalOutVariable (line 10) | public class EX_LocalOutVariable : EX_VariableBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalVariable.cs
  class EX_LocalVariable (line 10) | public class EX_LocalVariable : EX_VariableBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalVirtualFunction.cs
  class EX_LocalVirtualFunction (line 6) | public class EX_LocalVirtualFunction : EX_VirtualFunction
    method EX_LocalVirtualFunction (line 13) | public EX_LocalVirtualFunction() : base()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_MapConst.cs
  class EX_MapConst (line 11) | public class EX_MapConst : KismetExpression
    method EX_MapConst (line 36) | public EX_MapConst()
    method Read (line 45) | public override void Read(AssetBinaryReader reader)
    method Write (line 58) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 72) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_MetaCast.cs
  class EX_MetaCast (line 10) | public class EX_MetaCast : EX_CastBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_NameConst.cs
  class EX_NameConst (line 10) | public class EX_NameConst : KismetExpression<FName>
    method EX_NameConst (line 17) | public EX_NameConst()
    method Read (line 26) | public override void Read(AssetBinaryReader reader)
    method Write (line 36) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 41) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_NoInterface.cs
  class EX_NoInterface (line 6) | public class EX_NoInterface : KismetExpression
    method EX_NoInterface (line 13) | public EX_NoInterface()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_NoObject.cs
  class EX_NoObject (line 6) | public class EX_NoObject : KismetExpression
    method EX_NoObject (line 13) | public EX_NoObject()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Nothing.cs
  class EX_Nothing (line 7) | public class EX_Nothing : KismetExpression
    method EX_Nothing (line 14) | public EX_Nothing()
    method Read (line 23) | public override void Read(AssetBinaryReader reader)
    method Write (line 33) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_NothingInt32.cs
  class EX_NothingInt32 (line 10) | public class EX_NothingInt32 : KismetExpression<int>
    method EX_NothingInt32 (line 17) | public EX_NothingInt32()
    method Read (line 26) | public override void Read(AssetBinaryReader reader)
    method Write (line 36) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 42) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ObjToInterfaceCast.cs
  class EX_ObjToInterfaceCast (line 11) | public class EX_ObjToInterfaceCast : EX_CastBase

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_ObjectConst.cs
  class EX_ObjectConst (line 10) | public class EX_ObjectConst : KismetExpression<FPackageIndex>
    method EX_ObjectConst (line 17) | public EX_ObjectConst()
    method Read (line 26) | public override void Read(AssetBinaryReader reader)
    method Write (line 36) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 41) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_PopExecutionFlow.cs
  class EX_PopExecutionFlow (line 6) | public class EX_PopExecutionFlow : KismetExpression
    method EX_PopExecutionFlow (line 13) | public EX_PopExecutionFlow()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_PopExecutionFlowIfNot.cs
  class EX_PopExecutionFlowIfNot (line 12) | public class EX_PopExecutionFlowIfNot : KismetExpression
    method EX_PopExecutionFlowIfNot (line 25) | public EX_PopExecutionFlowIfNot()
    method Read (line 34) | public override void Read(AssetBinaryReader reader)
    method Write (line 44) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 49) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_PrimitiveCast.cs
  class EX_PrimitiveCast (line 11) | public class EX_PrimitiveCast : KismetExpression
    method EX_PrimitiveCast (line 30) | public EX_PrimitiveCast()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_PropertyConst.cs
  class EX_PropertyConst (line 11) | public class EX_PropertyConst : KismetExpression
    method EX_PropertyConst (line 24) | public EX_PropertyConst()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_PushExecutionFlow.cs
  class EX_PushExecutionFlow (line 11) | public class EX_PushExecutionFlow : KismetExpression
    method EX_PushExecutionFlow (line 24) | public EX_PushExecutionFlow()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 49) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_RemoveMulticastDelegate.cs
  class EX_RemoveMulticastDelegate (line 11) | public class EX_RemoveMulticastDelegate : KismetExpression
    method EX_RemoveMulticastDelegate (line 30) | public EX_RemoveMulticastDelegate()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Return.cs
  class EX_Return (line 11) | public class EX_Return : KismetExpression
    method EX_Return (line 24) | public EX_Return()
    method Read (line 33) | public override void Read(AssetBinaryReader reader)
    method Write (line 43) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 48) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_RotationConst.cs
  class EX_RotationConst (line 11) | public class EX_RotationConst : KismetExpression
    method EX_RotationConst (line 21) | public EX_RotationConst()
    method Read (line 30) | public override void Read(AssetBinaryReader reader)
    method Write (line 47) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 65) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Self.cs
  class EX_Self (line 6) | public class EX_Self : KismetExpression
    method EX_Self (line 13) | public EX_Self()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SetArray.cs
  class EX_SetArray (line 11) | public class EX_SetArray : KismetExpression
    method EX_SetArray (line 37) | public EX_SetArray()
    method Read (line 46) | public override void Read(AssetBinaryReader reader)
    method Write (line 65) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 85) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SetConst.cs
  class EX_SetConst (line 11) | public class EX_SetConst : KismetExpression
    method EX_SetConst (line 30) | public EX_SetConst()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 51) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 64) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SetMap.cs
  class EX_SetMap (line 11) | public class EX_SetMap : KismetExpression
    method EX_SetMap (line 30) | public EX_SetMap()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 51) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 65) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SetSet.cs
  class EX_SetSet (line 11) | public class EX_SetSet : KismetExpression
    method EX_SetSet (line 30) | public EX_SetSet()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 51) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 64) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Skip.cs
  class EX_Skip (line 11) | public class EX_Skip : KismetExpression
    method EX_Skip (line 30) | public EX_Skip()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SkipOffsetConst.cs
  class EX_SkipOffsetConst (line 10) | public class EX_SkipOffsetConst : KismetExpression<uint>
    method EX_SkipOffsetConst (line 17) | public EX_SkipOffsetConst()
    method Read (line 26) | public override void Read(AssetBinaryReader reader)
    method Write (line 36) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 42) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SoftObjectConst.cs
  class EX_SoftObjectConst (line 9) | public class EX_SoftObjectConst : KismetExpression<KismetExpression>
    method EX_SoftObjectConst (line 16) | public EX_SoftObjectConst()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 40) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_StringConst.cs
  class EX_StringConst (line 9) | public class EX_StringConst : KismetExpression<string>
    method EX_StringConst (line 16) | public EX_StringConst()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 40) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_StructConst.cs
  class EX_StructConst (line 13) | public class EX_StructConst : KismetExpression<KismetExpression[]>
    method EX_StructConst (line 32) | public EX_StructConst()
    method Read (line 41) | public override void Read(AssetBinaryReader reader)
    method Write (line 53) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 69) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_StructMemberContext.cs
  class EX_StructMemberContext (line 11) | public class EX_StructMemberContext : KismetExpression
    method EX_StructMemberContext (line 30) | public EX_StructMemberContext()
    method Read (line 39) | public override void Read(AssetBinaryReader reader)
    method Write (line 50) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 58) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_SwitchValue.cs
  type FKismetSwitchCase (line 11) | [JsonObject(MemberSerialization.OptIn)]
    method FKismetSwitchCase (line 32) | public FKismetSwitchCase(KismetExpression caseIndexValueTerm, uint nex...
  class EX_SwitchValue (line 43) | public class EX_SwitchValue : KismetExpression
    method EX_SwitchValue (line 74) | public EX_SwitchValue()
    method Read (line 83) | public override void Read(AssetBinaryReader reader)
    method Write (line 106) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 122) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_TextConst.cs
  class EX_TextConst (line 10) | public class EX_TextConst : KismetExpression<FScriptText>
    method EX_TextConst (line 17) | public EX_TextConst()
    method Read (line 26) | public override void Read(AssetBinaryReader reader)
    method Write (line 37) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 42) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Tracepoint.cs
  class EX_Tracepoint (line 6) | public class EX_Tracepoint : KismetExpression
    method EX_Tracepoint (line 13) | public EX_Tracepoint()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_TransformConst.cs
  class EX_TransformConst (line 9) | public class EX_TransformConst : KismetExpression<FTransform>
    method EX_TransformConst (line 16) | public EX_TransformConst() { Value = new(); }
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 37) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_True.cs
  class EX_True (line 6) | public class EX_True : KismetExpression
    method EX_True (line 13) | public EX_True()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_UInt64Const.cs
  class EX_UInt64Const (line 9) | public class EX_UInt64Const : KismetExpression<ulong>
    method EX_UInt64Const (line 16) | public EX_UInt64Const()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 41) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_UnicodeStringConst.cs
  class EX_UnicodeStringConst (line 9) | public class EX_UnicodeStringConst : KismetExpression<string>
    method EX_UnicodeStringConst (line 16) | public EX_UnicodeStringConst()
    method Read (line 25) | public override void Read(AssetBinaryReader reader)
    method Write (line 35) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 40) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_VariableBase.cs
  class EX_VariableBase (line 11) | public abstract class EX_VariableBase : KismetExpression
    method Read (line 28) | public override void Read(AssetBinaryReader reader)
    method Write (line 38) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 43) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_Vector3fConst.cs
  class EX_Vector3fConst (line 12) | public class EX_Vector3fConst : KismetExpression
    method EX_Vector3fConst (line 28) | public EX_Vector3fConst()
    method Read (line 37) | public override void Read(AssetBinaryReader reader)
    method Write (line 49) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 57) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_VectorConst.cs
  class EX_VectorConst (line 11) | public class EX_VectorConst : KismetExpression
    method EX_VectorConst (line 21) | public EX_VectorConst()
    method Read (line 30) | public override void Read(AssetBinaryReader reader)
    method Write (line 47) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 65) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_VirtualFunction.cs
  class EX_VirtualFunction (line 12) | public class EX_VirtualFunction : KismetExpression
    method EX_VirtualFunction (line 31) | public EX_VirtualFunction()
    method Read (line 40) | public override void Read(AssetBinaryReader reader)
    method Write (line 52) | public override int Write(AssetBinaryWriter writer)
    method Visit (line 65) | public override void Visit(UAsset asset, ref uint offset, Action<Kisme...

FILE: UAssetAPI/Kismet/Bytecode/Expressions/EX_WireTracepoint.cs
  class EX_WireTracepoint (line 6) | public class EX_WireTracepoint : KismetExpression
    method EX_WireTracepoint (line 13) | public EX_WireTracepoint()
    method Read (line 22) | public override void Read(AssetBinaryReader reader)
    method Write (line 32) | public override int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/FScriptText.cs
  class FScriptText (line 11) | [JsonObject(MemberSerialization.OptIn)]
    method Read (line 69) | public virtual void Read(AssetBinaryReader reader)
    method Write (line 103) | public virtual int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/Kismet/Bytecode/KismetExpression.cs
  class KismetExpression (line 11) | [JsonObject(MemberSerialization.OptIn)]
    method SetObject (line 31) | public void SetObject(object value)
    method GetObject (line 36) | public T GetObject<T>()
    method KismetExpression (line 41) | public KismetExpression()
    method Read (line 50) | public virtual void Read(AssetBinaryReader reader)
    method Write (line 60) | public virtual int Write(AssetBinaryWriter writer)
    method Visit (line 72) | public virtual void Visit(UAsset asset, ref uint offset, Action<Kismet...
    method GetSize (line 83) | public uint GetSize(UAsset asset)
    method KismetExpression (line 103) | public KismetExpression() : base()
  class KismetExpression (line 91) | public abstract class KismetExpression<T> : KismetExpression
    method SetObject (line 31) | public void SetObject(object value)
    method GetObject (line 36) | public T GetObject<T>()
    method KismetExpression (line 41) | public KismetExpression()
    method Read (line 50) | public virtual void Read(AssetBinaryReader reader)
    method Write (line 60) | public virtual int Write(AssetBinaryWriter writer)
    method Visit (line 72) | public virtual void Visit(UAsset asset, ref uint offset, Action<Kismet...
    method GetSize (line 83) | public uint GetSize(UAsset asset)
    method KismetExpression (line 103) | public KismetExpression() : base()

FILE: UAssetAPI/Kismet/Bytecode/KismetPropertyPointer.cs
  class KismetPropertyPointer (line 11) | [JsonObject(MemberSerialization.OptIn)]
    method ShouldSerializeOld (line 28) | public bool ShouldSerializeOld()
    method ShouldSerializeNew (line 33) | public bool ShouldSerializeNew()
    method KismetPropertyPointer (line 38) | public KismetPropertyPointer(FPackageIndex older)
    method KismetPropertyPointer (line 43) | public KismetPropertyPointer(FFieldPath newer)
    method KismetPropertyPointer (line 48) | public KismetPropertyPointer()

FILE: UAssetAPI/Kismet/KismetSerializer.cs
  class KismetSerializer (line 12) | public static class KismetSerializer
    type FSimpleMemberReference (line 15) | public struct FSimpleMemberReference
    type FEdGraphTerminalType (line 22) | public struct FEdGraphTerminalType
    type FEdGraphPinType (line 32) | public struct FEdGraphPinType
    type EPinContainerType (line 47) | public enum EPinContainerType : byte
    method SerializeScript (line 75) | public static JArray SerializeScript(KismetExpression[] code)
    method GetName (line 87) | public static string GetName(int index)
    method GetClassIndex (line 103) | public static int GetClassIndex()
    method GetFullName (line 115) | public static string GetFullName(int index, bool alt = false)
    method GetParentName (line 151) | public static string GetParentName(int index)
    method FindProperty (line 186) | public static bool FindProperty(int index, FName propname, out FProper...
    method GetPropertyCategoryInfo (line 211) | public static FEdGraphPinType GetPropertyCategoryInfo(FProperty prop)
    method FillSimpleMemberReference (line 329) | public static FSimpleMemberReference FillSimpleMemberReference(int index)
    method SerializeGraphPinType (line 349) | public static JObject SerializeGraphPinType(FEdGraphPinType pin)
    method ConvertPropertyToPinType (line 424) | public static FEdGraphPinType ConvertPropertyToPinType(FProperty prope...
    method SerializePropertyPointer (line 480) | public static JProperty[] SerializePropertyPointer(KismetPropertyPoint...
    method FindProperty (line 543) | private static bool FindProperty(int index, FPackageIndex old, out FPr...
    method SerializeExpression (line 548) | public static JObject SerializeExpression(KismetExpression expression,...
    method ReadString (line 1366) | public static string ReadString(KismetExpression expr, ref int index)

FILE: UAssetAPI/MainSerializer.cs
  class RegistryEntry (line 25) | internal class RegistryEntry
    method RegistryEntry (line 31) | public RegistryEntry()
  class MainSerializer (line 40) | public static class MainSerializer
    method MainSerializer (line 58) | static MainSerializer()
    method GetDependentAssemblies (line 63) | private static IEnumerable<Assembly> GetDependentAssemblies(Assembly a...
    method GetNamesOfAssembliesReferencedBy (line 68) | public static IEnumerable<string> GetNamesOfAssembliesReferencedBy(Ass...
    method InitializePropertyTypeRegistry (line 78) | private static void InitializePropertyTypeRegistry()
    method GenerateUnversionedHeader (line 143) | public static FUnversionedHeader GenerateUnversionedHeader(ref List<Pr...
    method TypeToClass (line 290) | public static PropertyData TypeToClass(FName type, FName name, Ancestr...
    method Read (line 393) | public static PropertyData Read(AssetBinaryReader reader, AncestryInfo...
    method ReadFProperty (line 496) | public static FProperty ReadFProperty(AssetBinaryReader reader)
    method WriteFProperty (line 512) | public static void WriteFProperty(FProperty prop, AssetBinaryWriter wr...
    method ReadUProperty (line 524) | public static UProperty ReadUProperty(AssetBinaryReader reader, FName ...
    method ReadUProperty (line 535) | public static UProperty ReadUProperty(AssetBinaryReader reader, Type r...
    method ReadUProperty (line 548) | public static T ReadUProperty<T>(AssetBinaryReader reader) where T : U...
    method WriteUProperty (line 560) | public static void WriteUProperty(UProperty prop, AssetBinaryWriter wr...
    method Write (line 572) | public static int Write(PropertyData property, AssetBinaryWriter write...

FILE: UAssetAPI/Pak/Interop.cs
  class RePakInterop (line 30) | public static class RePakInterop
    method pak_setup_allocator (line 34) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_teardown_allocator (line 36) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_builder_new (line 39) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_builder_drop (line 42) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_reader_drop (line 44) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_writer_drop (line 46) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_buffer_drop (line 48) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_cstring_drop (line 50) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_builder_key (line 53) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_builder_compression (line 55) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_builder_reader (line 57) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_builder_writer (line 59) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_reader_version (line 62) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_reader_mount_point (line 64) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_reader_get (line 66) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_reader_files (line 68) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_drop_files (line 70) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_writer_write_file (line 73) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    method pak_writer_write_index (line 75) | [DllImport(NativeLib, CallingConvention = CallingConvention.Cdecl)]
    type StreamCallbacks (line 87) | [StructLayout(LayoutKind.Sequential)]

FILE: UAssetAPI/Pak/RePak.cs
  type PakVersion (line 36) | public enum PakVersion : byte
  type PakCompression (line 53) | public enum PakCompression : byte
  class PakBuilder (line 61) | public class PakBuilder : SafeHandleZeroOrMinusOneIsInvalid
    method PakBuilder (line 63) | public PakBuilder() : base(true)
    method ReleaseHandle (line 104) | protected override bool ReleaseHandle()
    method Key (line 110) | public PakBuilder Key(byte[] key)
    method Compression (line 117) | public PakBuilder Compression(PakCompression[] compressions)
    method Writer (line 123) | public PakWriter Writer(Stream stream, PakVersion version = PakVersion...
    method Reader (line 138) | public PakReader Reader(Stream stream)
  class PakWriter (line 156) | public class PakWriter : SafeHandleZeroOrMinusOneIsInvalid
    method PakWriter (line 160) | public PakWriter(IntPtr handle, IntPtr streamCtx) : base(true)
    method ReleaseHandle (line 165) | protected override bool ReleaseHandle()
    method WriteFile (line 172) | public void WriteFile(string path, byte[] data)
    method WriteIndex (line 179) | public void WriteIndex()
  class PakReader (line 192) | public class PakReader : SafeHandleZeroOrMinusOneIsInvalid
    method PakReader (line 194) | public PakReader(IntPtr handle, Stream stream) : base(true)
    method ReleaseHandle (line 199) | protected override bool ReleaseHandle()
    method GetMountPoint (line 205) | public string GetMountPoint()
    method GetVersion (line 217) | public PakVersion GetVersion()
    method Get (line 224) | public byte[] Get(Stream stream, string path)
    method Files (line 246) | public string[] Files()
  class StreamCallbacks (line 264) | public static class StreamCallbacks
    method Create (line 266) | public static RePakInterop.StreamCallbacks Create(Stream stream)
    method Free (line 277) | public static void Free(IntPtr streamCtx)
    method ReadCallback (line 282) | public static long ReadCallback(IntPtr context, IntPtr buffer, ulong b...
    method WriteCallback (line 299) | public static int WriteCallback(IntPtr context, IntPtr buffer, int buf...
    method SeekCallback (line 317) | public static ulong SeekCallback(IntPtr context, long offset, int origin)
    method FlushCallback (line 332) | public static int FlushCallback(IntPtr context)

FILE: UAssetAPI/Properties/Resources.Designer.cs
  class Resources (line 23) | [global::System.CodeDom.Compiler.GeneratedCodeAttribute("System.Resource...
    method Resources (line 32) | [global::System.Diagnostics.CodeAnalysis.SuppressMessageAttribute("Mic...

FILE: UAssetAPI/PropertyTypes/Objects/ArrayPropertyData.cs
  class ArrayPropertyData (line 13) | public class ArrayPropertyData : PropertyData<PropertyData[]>
    method ShouldSerializeDummyStruct (line 22) | public bool ShouldSerializeDummyStruct()
    method ArrayPropertyData (line 27) | public ArrayPropertyData(FName name) : base(name)
    method ArrayPropertyData (line 32) | public ArrayPropertyData()
    method Read (line 40) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 174) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 186) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 294) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 299) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/BoolPropertyData.cs
  class BoolPropertyData (line 9) | public class BoolPropertyData : PropertyData<bool>
    method BoolPropertyData (line 11) | public BoolPropertyData(FName name) : base(name) { }
    method BoolPropertyData (line 13) | public BoolPropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 38) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 56) | public override string ToString()
    method FromString (line 61) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/BytePropertyData.cs
  type BytePropertyType (line 9) | public enum BytePropertyType
  class BytePropertyData (line 18) | public class BytePropertyData : PropertyData
    method ShouldSerializeValue (line 31) | public bool ShouldSerializeValue()
    method ShouldSerializeEnumValue (line 36) | public bool ShouldSerializeEnumValue()
    method BytePropertyData (line 41) | public BytePropertyData(FName name) : base(name) { }
    method BytePropertyData (line 43) | public BytePropertyData() { }
    method Read (line 48) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ReadCustom (line 53) | private void ReadCustom(AssetBinaryReader reader, bool includeHeader, ...
    method Write (line 133) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method GetEnumBase (line 157) | public FName GetEnumBase()
    method GetEnumFull (line 162) | public FName GetEnumFull()
    method ToString (line 167) | public override string ToString()
    method FromString (line 174) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/DelegatePropertyData.cs
  class FDelegate (line 9) | [JsonObject(MemberSerialization.OptIn)]
    method FDelegate (line 23) | public FDelegate(FPackageIndex _object, FName @delegate)
    method FDelegate (line 29) | public FDelegate() { }
    method FDelegate (line 31) | public FDelegate(AssetBinaryReader reader)
    method Write (line 37) | public int Write(AssetBinaryWriter writer)
  class DelegatePropertyData (line 50) | public class DelegatePropertyData : PropertyData<FDelegate>
    method DelegatePropertyData (line 52) | public DelegatePropertyData(FName name) : base(name) { }
    method DelegatePropertyData (line 54) | public DelegatePropertyData() { }
    method Read (line 59) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 69) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 80) | public override string ToString()
    method FromString (line 85) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 90) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/DoublePropertyData.cs
  class DoublePropertyData (line 11) | public class DoublePropertyData : PropertyData
    method DoublePropertyData (line 24) | public DoublePropertyData(FName name) : base(name) { }
    method DoublePropertyData (line 26) | public DoublePropertyData() { }
    method Read (line 32) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 42) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 53) | public override string ToString()
    method FromString (line 58) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/EnumPropertyData.cs
  class EnumPropertyData (line 13) | public class EnumPropertyData : PropertyData<FName>
    method EnumPropertyData (line 23) | public EnumPropertyData(FName name) : base(name) { }
    method EnumPropertyData (line 25) | public EnumPropertyData() { }
    method Read (line 34) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 130) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method InitializeZero (line 207) | internal override void InitializeZero(AssetBinaryReader reader)
    method ToString (line 236) | public override string ToString()
    method FromString (line 242) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 263) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/FieldPathPropertyData.cs
  class FieldPathPropertyData (line 8) | public class FieldPathPropertyData : BasePropertyData<FFieldPath>
    method FieldPathPropertyData (line 10) | public FieldPathPropertyData(FName name) : base(name) { }
    method FieldPathPropertyData (line 12) | public FieldPathPropertyData() { }
    method ToString (line 19) | public override string ToString()
    method FromString (line 25) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/FloatPropertyData.cs
  class FloatPropertyData (line 11) | public class FloatPropertyData : PropertyData
    method FloatPropertyData (line 24) | public FloatPropertyData(FName name) : base(name) { }
    method FloatPropertyData (line 26) | public FloatPropertyData() { }
    method Read (line 33) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 43) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 54) | public override string ToString()
    method FromString (line 59) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/Int16PropertyData.cs
  class Int16PropertyData (line 9) | public class Int16PropertyData : PropertyData<short>
    method Int16PropertyData (line 11) | public Int16PropertyData(FName name) : base(name) { }
    method Int16PropertyData (line 13) | public Int16PropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 46) | public override string ToString()
    method FromString (line 51) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/Int64PropertyData.cs
  class Int64PropertyData (line 9) | public class Int64PropertyData : PropertyData<long>
    method Int64PropertyData (line 11) | public Int64PropertyData(FName name) : base(name) { }
    method Int64PropertyData (line 13) | public Int64PropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 40) | public override string ToString()
    method FromString (line 45) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/Int8PropertyData.cs
  class Int8PropertyData (line 9) | public class Int8PropertyData : PropertyData<sbyte>
    method Int8PropertyData (line 11) | public Int8PropertyData(FName name) : base(name) { }
    method Int8PropertyData (line 13) | public Int8PropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 40) | public override string ToString()
    method FromString (line 45) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/IntPropertyData.cs
  class IntPropertyData (line 9) | public class IntPropertyData : PropertyData<int>
    method IntPropertyData (line 11) | public IntPropertyData(FName name) : base(name) { }
    method IntPropertyData (line 13) | public IntPropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 40) | public override string ToString()
    method FromString (line 45) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/InterfacePropertyData.cs
  class InterfacePropertyData (line 8) | public class InterfacePropertyData : ObjectPropertyData
    method InterfacePropertyData (line 10) | public InterfacePropertyData(FName name) : base(name) { }
    method InterfacePropertyData (line 12) | public InterfacePropertyData() { }

FILE: UAssetAPI/PropertyTypes/Objects/MapPropertyData.cs
  class MapPropertyData (line 14) | public class MapPropertyData : PropertyData
    method ShouldSerializeKeyType (line 35) | public bool ShouldSerializeKeyType() => Value.Count == 0;
    method ShouldSerializeValueType (line 37) | public bool ShouldSerializeValueType() => Value.Count == 0;
    method MapPropertyData (line 42) | public MapPropertyData(FName name) : base(name)
    method MapPropertyData (line 47) | public MapPropertyData()
    method MapTypeToClass (line 55) | private PropertyData MapTypeToClass(FName type, FName name, AssetBinar...
    method ReadRawMap (line 107) | private TMap<PropertyData, PropertyData> ReadRawMap(AssetBinaryReader ...
    method Read (line 124) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 167) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method WriteRawMap (line 183) | private void WriteRawMap(AssetBinaryWriter writer, TMap<PropertyData, ...
    method Write (line 195) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method HandleCloned (line 232) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/MulticastDelegatePropertyData.cs
  class MulticastDelegatePropertyData (line 9) | public class MulticastDelegatePropertyData : PropertyData<FDelegate[]>
    method MulticastDelegatePropertyData (line 11) | public MulticastDelegatePropertyData(FName name) : base(name) { }
    method MulticastDelegatePropertyData (line 13) | public MulticastDelegatePropertyData() { }
    method Read (line 18) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 28) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 45) | public override string ToString()
    method FromString (line 55) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 60) | protected override void HandleCloned(PropertyData res)
  class MulticastSparseDelegatePropertyData (line 85) | public class MulticastSparseDelegatePropertyData : MulticastDelegateProp...
    method MulticastSparseDelegatePropertyData (line 87) | public MulticastSparseDelegatePropertyData(FName name) : base(name) { }
    method MulticastSparseDelegatePropertyData (line 89) | public MulticastSparseDelegatePropertyData() { }
  class MulticastInlineDelegatePropertyData (line 99) | public class MulticastInlineDelegatePropertyData : MulticastDelegateProp...
    method MulticastInlineDelegatePropertyData (line 101) | public MulticastInlineDelegatePropertyData(FName name) : base(name) { }
    method MulticastInlineDelegatePropertyData (line 103) | public MulticastInlineDelegatePropertyData() { }

FILE: UAssetAPI/PropertyTypes/Objects/NamePropertyData.cs
  class NamePropertyData (line 8) | public class NamePropertyData : PropertyData<FName>
    method NamePropertyData (line 10) | public NamePropertyData(FName name) : base(name) { }
    method NamePropertyData (line 12) | public NamePropertyData() { }
    method Read (line 17) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 27) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method CanBeZero (line 38) | public override bool CanBeZero(UAsset asset)
    method ToString (line 43) | public override string ToString()
    method FromString (line 48) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/ObjectPropertyData.cs
  class ObjectPropertyData (line 9) | public class ObjectPropertyData : PropertyData<FPackageIndex>
    method ObjectPropertyData (line 11) | public ObjectPropertyData(FName name) : base(name) { }
    method ObjectPropertyData (line 13) | public ObjectPropertyData() { }
    method IsImport (line 23) | public bool IsImport() => Value.IsImport();
    method IsExport (line 29) | public bool IsExport() => Value.IsExport();
    method IsNull (line 35) | public bool IsNull() => Value.IsNull();
    method ToImport (line 42) | public Import ToImport(UAsset asset) => Value.ToImport(asset);
    method ToExport (line 49) | public Export ToExport(UAsset asset) => Value.ToExport(asset);
    method Read (line 51) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 61) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 72) | public override string ToString()
    method FromString (line 77) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/PropertyData.cs
  type PropertySerializationContext (line 9) | public enum PropertySerializationContext
  type EPropertyTagFlags (line 17) | [Flags]
  type EPropertyTagExtension (line 29) | [Flags]
  type EOverriddenPropertyOperation (line 37) | public enum EOverriddenPropertyOperation
  class AncestryInfo (line 61) | public class AncestryInfo : ICloneable
    method Clone (line 77) | public object Clone() // shallow
    method CloneWithoutParent (line 84) | public AncestryInfo CloneWithoutParent()
    method Initialize (line 91) | public void Initialize(AncestryInfo ancestors, FName dad, FName module...
    method SetAsParent (line 98) | public void SetAsParent(FName dad, FName modulePath = null)
  class PropertyData (line 107) | [JsonObject(MemberSerialization.OptIn)]
    method ShouldSerializeOverrideOperation (line 156) | public bool ShouldSerializeOverrideOperation()
    method ShouldSerializebExperimentalOverridableLogic (line 160) | public bool ShouldSerializebExperimentalOverridableLogic()
    method SetObject (line 190) | public void SetObject(object value)
    method GetObject (line 195) | public T GetObject<T>()
    method PropertyData (line 201) | public PropertyData(FName name)
    method PropertyData (line 206) | public PropertyData()
    method Read (line 237) | public virtual void Read(AssetBinaryReader reader, bool includeHeader,...
    method ResolveAncestries (line 245) | public virtual void ResolveAncestries(UAsset asset, AncestryInfo ances...
    method ReadEndPropertyTag (line 253) | protected virtual void ReadEndPropertyTag(AssetBinaryReader reader)
    method Write (line 288) | public virtual int Write(AssetBinaryWriter writer, bool includeHeader,...
    method InitializeZero (line 297) | internal virtual void InitializeZero(AssetBinaryReader reader)
    method WriteEndPropertyTag (line 305) | protected virtual void WriteEndPropertyTag(AssetBinaryWriter writer)
    method CanBeZero (line 331) | public virtual bool CanBeZero(UAsset asset)
    method FromString (line 346) | public virtual void FromString(string[] d, UAsset asset)
    method Clone (line 355) | public object Clone()
    method HandleCloned (line 365) | protected virtual void HandleCloned(PropertyData res)
    method PropertyData (line 383) | public PropertyData(FName name) : base(name) { }
    method PropertyData (line 385) | public PropertyData() : base() { }
  class PropertyData (line 371) | public abstract class PropertyData<T> : PropertyData
    method ShouldSerializeOverrideOperation (line 156) | public bool ShouldSerializeOverrideOperation()
    method ShouldSerializebExperimentalOverridableLogic (line 160) | public bool ShouldSerializebExperimentalOverridableLogic()
    method SetObject (line 190) | public void SetObject(object value)
    method GetObject (line 195) | public T GetObject<T>()
    method PropertyData (line 201) | public PropertyData(FName name)
    method PropertyData (line 206) | public PropertyData()
    method Read (line 237) | public virtual void Read(AssetBinaryReader reader, bool includeHeader,...
    method ResolveAncestries (line 245) | public virtual void ResolveAncestries(UAsset asset, AncestryInfo ances...
    method ReadEndPropertyTag (line 253) | protected virtual void ReadEndPropertyTag(AssetBinaryReader reader)
    method Write (line 288) | public virtual int Write(AssetBinaryWriter writer, bool includeHeader,...
    method InitializeZero (line 297) | internal virtual void InitializeZero(AssetBinaryReader reader)
    method WriteEndPropertyTag (line 305) | protected virtual void WriteEndPropertyTag(AssetBinaryWriter writer)
    method CanBeZero (line 331) | public virtual bool CanBeZero(UAsset asset)
    method FromString (line 346) | public virtual void FromString(string[] d, UAsset asset)
    method Clone (line 355) | public object Clone()
    method HandleCloned (line 365) | protected virtual void HandleCloned(PropertyData res)
    method PropertyData (line 383) | public PropertyData(FName name) : base(name) { }
    method PropertyData (line 385) | public PropertyData() : base() { }
  type IStruct (line 388) | public interface IStruct<T>
    method Read (line 390) | abstract static T Read(AssetBinaryReader reader);
    method FromString (line 391) | abstract static T FromString(string[] d, UAsset asset);
    method Write (line 393) | int Write(AssetBinaryWriter writer);
  class BasePropertyData (line 396) | public abstract class BasePropertyData<T> : PropertyData<T> where T : IS...
    method BasePropertyData (line 398) | public BasePropertyData(FName name) : base(name) { }
    method BasePropertyData (line 400) | public BasePropertyData() : base() { }
    method Read (line 404) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 414) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 426) | public override string ToString()
    method FromString (line 431) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/SetPropertyData.cs
  class SetPropertyData (line 10) | public class SetPropertyData : ArrayPropertyData
    method SetPropertyData (line 14) | public SetPropertyData(FName name) : base(name)
    method SetPropertyData (line 20) | public SetPropertyData()
    method Read (line 29) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 68) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method HandleCloned (line 92) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/SoftObjectPropertyData.cs
  class AssetObjectPropertyData (line 10) | public class AssetObjectPropertyData : PropertyData<FString>
    method AssetObjectPropertyData (line 14) | public AssetObjectPropertyData(FName name) : base(name) { }
    method AssetObjectPropertyData (line 16) | public AssetObjectPropertyData() { }
    method Read (line 21) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 31) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 41) | public override string ToString()
    method FromString (line 46) | public override void FromString(string[] d, UAsset asset)
  type FTopLevelAssetPath (line 53) | public struct FTopLevelAssetPath
    method FTopLevelAssetPath (line 66) | public FTopLevelAssetPath(FName packageName, FName assetName)
  type FSoftObjectPath (line 76) | public struct FSoftObjectPath : IEquatable<FSoftObjectPath>, IStruct<FSo...
    method FSoftObjectPath (line 87) | public FSoftObjectPath(FName packageName, FName assetName, FString sub...
    method FSoftObjectPath (line 93) | public FSoftObjectPath(FTopLevelAssetPath assetPath, FString subPathSt...
    method FSoftObjectPath (line 99) | public FSoftObjectPath(AssetBinaryReader reader, bool allowIndex = true)
    method Read (line 130) | public static FSoftObjectPath Read(AssetBinaryReader reader) => new FS...
    method Write (line 132) | public int Write(AssetBinaryWriter writer, bool allowIndex = true)
    method Write (line 168) | public int Write(AssetBinaryWriter writer) => Write(writer, true);
    method Equals (line 180) | public bool Equals(FSoftObjectPath other)
    method Equals (line 187) | public override bool Equals(object obj)
    method GetHashCode (line 192) | public override int GetHashCode()
    method ToString (line 197) | public override string ToString()
    method FromString (line 202) | public static FSoftObjectPath FromString(string[] d, UAsset asset)
  class SoftObjectPropertyData (line 215) | public class SoftObjectPropertyData : BasePropertyData<FSoftObjectPath>
    method SoftObjectPropertyData (line 217) | public SoftObjectPropertyData(FName name) : base(name) { }
    method SoftObjectPropertyData (line 219) | public SoftObjectPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Objects/StrPropertyData.cs
  class StrPropertyData (line 9) | public class StrPropertyData : PropertyData<FString>
    method StrPropertyData (line 11) | public StrPropertyData(FName name) : base(name) { }
    method StrPropertyData (line 13) | public StrPropertyData() { }
    method Read (line 18) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 28) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 40) | public override string ToString()
    method FromString (line 45) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/TextHistoryType.cs
  type TextHistoryType (line 3) | public enum TextHistoryType

FILE: UAssetAPI/PropertyTypes/Objects/TextPropertyData.cs
  type ETextFlag (line 10) | [Flags]
  type ETransformType (line 20) | public enum ETransformType : byte
  class FNumberFormattingOptions (line 26) | public class FNumberFormattingOptions
    method FNumberFormattingOptions (line 36) | public FNumberFormattingOptions()
    method FNumberFormattingOptions (line 47) | public FNumberFormattingOptions(AssetBinaryReader reader)
    method Write (line 59) | public void Write(AssetBinaryWriter writer)
  class FFormatArgumentValue (line 73) | public class FFormatArgumentValue
    method FFormatArgumentValue (line 78) | public FFormatArgumentValue() { }
    method FFormatArgumentValue (line 80) | public FFormatArgumentValue(EFormatArgumentType type, object value)
    method FFormatArgumentValue (line 86) | public FFormatArgumentValue(AssetBinaryReader reader, bool isArgumentD...
    method Write (line 113) | public int Write(AssetBinaryWriter writer, bool isArgumentData = false)
  class FFormatArgumentData (line 157) | public class FFormatArgumentData
    method FFormatArgumentData (line 162) | public FFormatArgumentData() { }
    method FFormatArgumentData (line 164) | public FFormatArgumentData(FString name, FFormatArgumentValue value)
    method FFormatArgumentData (line 170) | public FFormatArgumentData(AssetBinaryReader reader)
    method Read (line 175) | public void Read(AssetBinaryReader reader)
    method Write (line 181) | public int Write(AssetBinaryWriter writer)
  class TextPropertyData (line 192) | public class TextPropertyData : PropertyData<FString>
    method ShouldSerializeTableId (line 230) | public bool ShouldSerializeTableId()
    method TextPropertyData (line 235) | public TextPropertyData(FName name) : base(name) { }
    method TextPropertyData (line 237) | public TextPropertyData() { }
    method Read (line 242) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 334) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 432) | public override string ToString()
    method FromString (line 449) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 454) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/UInt16PropertyData.cs
  class UInt16PropertyData (line 9) | public class UInt16PropertyData : PropertyData<ushort>
    method UInt16PropertyData (line 11) | public UInt16PropertyData(FName name) : base(name) { }
    method UInt16PropertyData (line 13) | public UInt16PropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 45) | public override string ToString()
    method FromString (line 50) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/UInt32PropertyData.cs
  class UInt32PropertyData (line 9) | public class UInt32PropertyData : PropertyData<uint>
    method UInt32PropertyData (line 11) | public UInt32PropertyData(FName name) : base(name) { }
    method UInt32PropertyData (line 13) | public UInt32PropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 40) | public override string ToString()
    method FromString (line 45) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/UInt64PropertyData.cs
  class UInt64PropertyData (line 9) | public class UInt64PropertyData : PropertyData<ulong>
    method UInt64PropertyData (line 11) | public UInt64PropertyData(FName name) : base(name) { }
    method UInt64PropertyData (line 13) | public UInt64PropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 29) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 40) | public override string ToString()
    method FromString (line 45) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Objects/UnknownPropertyData.cs
  class UnknownPropertyData (line 10) | public class UnknownPropertyData : PropertyData<byte[]>
    method UnknownPropertyData (line 15) | public UnknownPropertyData(FName name) : base(name) { }
    method UnknownPropertyData (line 17) | public UnknownPropertyData() { }
    method SetSerializingPropertyType (line 22) | public void SetSerializingPropertyType(FString newType)
    method Read (line 27) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 37) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 48) | public override string ToString()
    method HandleCloned (line 53) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Objects/WeakObjectPropertyData.cs
  class WeakObjectPropertyData (line 5) | public class WeakObjectPropertyData : ObjectPropertyData
    method WeakObjectPropertyData (line 7) | public WeakObjectPropertyData(FName name) : base(name)
    method WeakObjectPropertyData (line 12) | public WeakObjectPropertyData()

FILE: UAssetAPI/PropertyTypes/Structs/ClothLODDataPropertyData.cs
  class FMeshToMeshVertData (line 9) | public class FMeshToMeshVertData
    method Read (line 45) | public void Read(AssetBinaryReader reader)
    method Write (line 70) | public int Write(AssetBinaryWriter writer)
    method FMeshToMeshVertData (line 88) | public FMeshToMeshVertData(AssetBinaryReader reader)
    method FMeshToMeshVertData (line 93) | public FMeshToMeshVertData(Vector4fPropertyData positionBaryCoordsAndD...
    method FMeshToMeshVertData (line 103) | public FMeshToMeshVertData() { }
  class ClothLODDataPropertyData (line 109) | public class ClothLODDataPropertyData : StructPropertyData
    method ClothLODDataPropertyData (line 121) | public ClothLODDataPropertyData(FName name, FName forcedType) : base(n...
    method ClothLODDataPropertyData (line 122) | public ClothLODDataPropertyData(FName name) : base(name) { }
    method ClothLODDataPropertyData (line 123) | public ClothLODDataPropertyData() { }
    method Read (line 129) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 149) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 171) | public override string ToString()
    method FromString (line 176) | public override void FromString(string[] d, UAsset asset)
  class ClothLODDataCommonPropertyData (line 182) | public class ClothLODDataCommonPropertyData : ClothLODDataPropertyData
    method ClothLODDataCommonPropertyData (line 184) | public ClothLODDataCommonPropertyData(FName name, FName forcedType) : ...
    method ClothLODDataCommonPropertyData (line 185) | public ClothLODDataCommonPropertyData(FName name) : base(name) { }
    method ClothLODDataCommonPropertyData (line 186) | public ClothLODDataCommonPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/ClothTetherDataPropertyData.cs
  class ClothTetherDataPropertyData (line 9) | public class ClothTetherDataPropertyData : StructPropertyData
    method ClothTetherDataPropertyData (line 13) | public ClothTetherDataPropertyData(FName name, FName forcedType) : bas...
    method ClothTetherDataPropertyData (line 14) | public ClothTetherDataPropertyData(FName name) : base(name) { }
    method ClothTetherDataPropertyData (line 15) | public ClothTetherDataPropertyData() { }
    method Read (line 22) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 45) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Core/ColorPropertyData.cs
  class ColorPropertyData (line 10) | public class ColorPropertyData : PropertyData<Color> // R, G, B, A
    method ColorPropertyData (line 12) | public ColorPropertyData(FName name) : base(name) { }
    method ColorPropertyData (line 14) | public ColorPropertyData() { }
    method Read (line 20) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 30) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 41) | public override string ToString()
    method FromString (line 46) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 55) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Structs/Core/DateTimePropertyData.cs
  class DateTimePropertyData (line 18) | public class DateTimePropertyData : PropertyData<DateTime>
    method DateTimePropertyData (line 20) | public DateTimePropertyData(FName name) : base(name) { }
    method DateTimePropertyData (line 22) | public DateTimePropertyData() { }
    method Read (line 28) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 38) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 49) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 54) | public override string ToString()
    method HandleCloned (line 59) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Structs/Core/GuidPropertyData.cs
  class GuidPropertyData (line 10) | public class GuidPropertyData : PropertyData<Guid>
    method GuidPropertyData (line 12) | public GuidPropertyData(FName name) : base(name) { }
    method GuidPropertyData (line 14) | public GuidPropertyData() { }
    method Read (line 20) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 30) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 41) | public override string ToString()
    method FromString (line 46) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 51) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Structs/Core/TimespanPropertyData.cs
  class TimespanPropertyData (line 18) | public class TimespanPropertyData : PropertyData<TimeSpan>
    method TimespanPropertyData (line 20) | public TimespanPropertyData(FName name) : base(name) { }
    method TimespanPropertyData (line 22) | public TimespanPropertyData() { }
    method Read (line 28) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 38) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 49) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 54) | public override string ToString()
    method HandleCloned (line 59) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Structs/Engine/FontCharacterPropertyData.cs
  class FontCharacterPropertyData (line 6) | public class FontCharacterPropertyData : PropertyData<FFontCharacter>
    method FontCharacterPropertyData (line 8) | public FontCharacterPropertyData(FName name) : base(name) { }
    method FontCharacterPropertyData (line 10) | public FontCharacterPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Engine/KeyHandleMapPropertyData.cs
  class KeyHandleMapPropertyData (line 6) | public class KeyHandleMapPropertyData : PropertyData
    method KeyHandleMapPropertyData (line 8) | public KeyHandleMapPropertyData(FName name) : base(name) { }
    method KeyHandleMapPropertyData (line 10) | public KeyHandleMapPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 27) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 38) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Structs/Engine/MaterialInputProperties.cs
  class MaterialInputPropertyData (line 7) | public abstract class MaterialInputPropertyData<T> : PropertyData<T>
    method MaterialInputPropertyData (line 20) | public MaterialInputPropertyData() { }
    method MaterialInputPropertyData (line 22) | public MaterialInputPropertyData(FName name) : base(name) { }
    method Read (line 24) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 51) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method WriteExpressionInput (line 61) | protected int WriteExpressionInput(AssetBinaryWriter writer, bool incl...
    method HandleCloned (line 97) | protected override void HandleCloned(PropertyData res)
  class ExpressionInputPropertyData (line 106) | public class ExpressionInputPropertyData : MaterialInputPropertyData<int>
    method ExpressionInputPropertyData (line 108) | public ExpressionInputPropertyData(FName name) : base(name) { }
    method ExpressionInputPropertyData (line 110) | public ExpressionInputPropertyData() { }
  class MaterialAttributesInputPropertyData (line 117) | public class MaterialAttributesInputPropertyData : MaterialInputProperty...
    method MaterialAttributesInputPropertyData (line 119) | public MaterialAttributesInputPropertyData(FName name) : base(name) { }
    method MaterialAttributesInputPropertyData (line 121) | public MaterialAttributesInputPropertyData() { }
  class ColorMaterialInputPropertyData (line 128) | public class ColorMaterialInputPropertyData : MaterialInputPropertyData<...
    method ColorMaterialInputPropertyData (line 130) | public ColorMaterialInputPropertyData(FName name) : base(name) { }
    method ColorMaterialInputPropertyData (line 132) | public ColorMaterialInputPropertyData() { }
    method Read (line 138) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 148) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 157) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class ScalarMaterialInputPropertyData (line 165) | public class ScalarMaterialInputPropertyData : MaterialInputPropertyData...
    method ScalarMaterialInputPropertyData (line 167) | public ScalarMaterialInputPropertyData(FName name) : base(name) { }
    method ScalarMaterialInputPropertyData (line 169) | public ScalarMaterialInputPropertyData() { }
    method Read (line 175) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 183) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class VectorMaterialInputPropertyData (line 197) | public class VectorMaterialInputPropertyData : MaterialInputPropertyData...
    method VectorMaterialInputPropertyData (line 199) | public VectorMaterialInputPropertyData(FName name) : base(name) { }
    method VectorMaterialInputPropertyData (line 201) | public VectorMaterialInputPropertyData() { }
    method Read (line 207) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 217) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 226) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class Vector2MaterialInputPropertyData (line 239) | public class Vector2MaterialInputPropertyData : MaterialInputPropertyDat...
    method Vector2MaterialInputPropertyData (line 241) | public Vector2MaterialInputPropertyData(FName name) : base(name) { }
    method Vector2MaterialInputPropertyData (line 243) | public Vector2MaterialInputPropertyData() { }
    method Read (line 249) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 259) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 268) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Engine/MaterialOverrideNanitePropertyData.cs
  class MaterialOverrideNanitePropertyData (line 7) | public class MaterialOverrideNanitePropertyData : StructPropertyData
    method MaterialOverrideNanitePropertyData (line 14) | public MaterialOverrideNanitePropertyData(FName name, FName forcedType...
    method MaterialOverrideNanitePropertyData (line 15) | public MaterialOverrideNanitePropertyData(FName name) : base(name) { }
    method MaterialOverrideNanitePropertyData (line 16) | public MaterialOverrideNanitePropertyData() { }
    method Read (line 22) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 44) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 69) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Structs/Engine/NavAgentSelectorPropertyData.cs
  type FNavAgentSelector (line 6) | public struct FNavAgentSelector : IStruct<FNavAgentSelector>
    method FNavAgentSelector (line 10) | public FNavAgentSelector(uint packedBits)
    method FNavAgentSelector (line 15) | public FNavAgentSelector(AssetBinaryReader reader)
    method Read (line 20) | public static FNavAgentSelector Read(AssetBinaryReader reader) => new ...
    method Write (line 22) | public int Write(AssetBinaryWriter writer)
    method ToString (line 28) | public override string ToString()
    method FromString (line 33) | public static FNavAgentSelector FromString(string[] d, UAsset asset)
  class NavAgentSelectorPropertyData (line 40) | public class NavAgentSelectorPropertyData : BasePropertyData<FNavAgentSe...
    method NavAgentSelectorPropertyData (line 42) | public NavAgentSelectorPropertyData(FName name) : base(name) { }
    method NavAgentSelectorPropertyData (line 44) | public NavAgentSelectorPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Engine/PerPlatformProperties.cs
  class TPerPlatformPropertyData (line 8) | public abstract class TPerPlatformPropertyData<T> : PropertyData<T[]>
    method TPerPlatformPropertyData (line 10) | public TPerPlatformPropertyData(FName name) : base(name)
    method TPerPlatformPropertyData (line 15) | public TPerPlatformPropertyData()
  class PerPlatformBoolPropertyData (line 24) | public class PerPlatformBoolPropertyData : TPerPlatformPropertyData<bool>
    method PerPlatformBoolPropertyData (line 26) | public PerPlatformBoolPropertyData(FName name) : base(name) { }
    method PerPlatformBoolPropertyData (line 28) | public PerPlatformBoolPropertyData() { }
    method Read (line 34) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 49) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 64) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 74) | public override string ToString()
  class PerPlatformFloatPropertyData (line 88) | public class PerPlatformFloatPropertyData : TPerPlatformPropertyData<float>
    method PerPlatformFloatPropertyData (line 90) | public PerPlatformFloatPropertyData(FName name) : base(name) { }
    method PerPlatformFloatPropertyData (line 92) | public PerPlatformFloatPropertyData() { }
    method Read (line 98) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 113) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 128) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 138) | public override string ToString()
  class PerPlatformIntPropertyData (line 152) | public class PerPlatformIntPropertyData : TPerPlatformPropertyData<int>
    method PerPlatformIntPropertyData (line 154) | public PerPlatformIntPropertyData(FName name) : base(name) { }
    method PerPlatformIntPropertyData (line 156) | public PerPlatformIntPropertyData() { }
    method Read (line 162) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 177) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 192) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 202) | public override string ToString()
  class PerPlatformFrameRatePropertyData (line 216) | public class PerPlatformFrameRatePropertyData : TPerPlatformPropertyData...
    method PerPlatformFrameRatePropertyData (line 218) | public PerPlatformFrameRatePropertyData(FName name) : base(name) { }
    method PerPlatformFrameRatePropertyData (line 220) | public PerPlatformFrameRatePropertyData() { }
    method Read (line 226) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 241) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 257) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 267) | public override string ToString()

FILE: UAssetAPI/PropertyTypes/Structs/Engine/PerQualityProperties.cs
  class TPerQualityLevelPropertyData (line 6) | public abstract class TPerQualityLevelPropertyData<T> : PropertyData<TPe...
    method TPerQualityLevelPropertyData (line 8) | public TPerQualityLevelPropertyData(FName name) : base(name) { }
    method TPerQualityLevelPropertyData (line 10) | public TPerQualityLevelPropertyData() { }
  class PerQualityLevelFloatPropertyData (line 13) | public class PerQualityLevelFloatPropertyData : TPerQualityLevelProperty...
    method PerQualityLevelFloatPropertyData (line 15) | public PerQualityLevelFloatPropertyData(FName name) : base(name) { }
    method PerQualityLevelFloatPropertyData (line 17) | public PerQualityLevelFloatPropertyData() { }
    method Read (line 23) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 33) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class PerQualityLevelIntPropertyData (line 44) | public class PerQualityLevelIntPropertyData : TPerQualityLevelPropertyDa...
    method PerQualityLevelIntPropertyData (line 46) | public PerQualityLevelIntPropertyData(FName name) : base(name) { }
    method PerQualityLevelIntPropertyData (line 48) | public PerQualityLevelIntPropertyData() { }
    method Read (line 54) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 64) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Engine/RichCurveKeyPropertyData.cs
  class RichCurveKeyPropertyData (line 6) | public class RichCurveKeyPropertyData : BasePropertyData<FRichCurveKey>
    method RichCurveKeyPropertyData (line 8) | public RichCurveKeyPropertyData(FName name) : base(name) { }
    method RichCurveKeyPropertyData (line 10) | public RichCurveKeyPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Engine/SkeletalMeshSamplingLODBuiltDataPropertyData.cs
  class SkeletalMeshSamplingLODBuiltDataPropertyData (line 6) | public class SkeletalMeshSamplingLODBuiltDataPropertyData : PropertyData...
    method SkeletalMeshSamplingLODBuiltDataPropertyData (line 8) | public SkeletalMeshSamplingLODBuiltDataPropertyData(FName name) : base...
    method SkeletalMeshSamplingLODBuiltDataPropertyData (line 10) | public SkeletalMeshSamplingLODBuiltDataPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 28) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method Write (line 38) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 49) | public override string ToString()

FILE: UAssetAPI/PropertyTypes/Structs/Engine/SkeletalMeshSamplingRegionBuiltDataPropertyData.cs
  class SkeletalMeshSamplingRegionBuiltDataPropertyData (line 6) | public class SkeletalMeshSamplingRegionBuiltDataPropertyData : BasePrope...
    method SkeletalMeshSamplingRegionBuiltDataPropertyData (line 8) | public SkeletalMeshSamplingRegionBuiltDataPropertyData(FName name) : b...
    method SkeletalMeshSamplingRegionBuiltDataPropertyData (line 10) | public SkeletalMeshSamplingRegionBuiltDataPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Engine/SmartNamePropertyData.cs
  class SmartNamePropertyData (line 11) | public class SmartNamePropertyData : PropertyData
    method SmartNamePropertyData (line 28) | public SmartNamePropertyData(FName name) : base(name) { }
    method SmartNamePropertyData (line 30) | public SmartNamePropertyData() { }
    method Read (line 36) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 54) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 76) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 83) | public override string ToString()

FILE: UAssetAPI/PropertyTypes/Structs/Engine/StringCurveKeyPropertyData.cs
  type FStringCurveKey (line 6) | public struct FStringCurveKey : IStruct<FStringCurveKey>
    method FStringCurveKey (line 11) | public FStringCurveKey(float time, FString value)
    method FStringCurveKey (line 17) | public FStringCurveKey(AssetBinaryReader reader)
    method Read (line 23) | public static FStringCurveKey Read(AssetBinaryReader reader) => new FS...
    method Write (line 25) | public int Write(AssetBinaryWriter writer)
    method ToString (line 35) | public override string ToString() => $"({Time}, {Value})";
    method FromString (line 37) | public static FStringCurveKey FromString(string[] d, UAsset asset)
  class StringCurveKeyPropertyData (line 45) | public class StringCurveKeyPropertyData : BasePropertyData<FStringCurveKey>
    method StringCurveKeyPropertyData (line 47) | public StringCurveKeyPropertyData(FName name) : base(name) { }
    method StringCurveKeyPropertyData (line 48) | public StringCurveKeyPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Engine/ViewTargetBlendParamsPropertyData.cs
  type ViewTargetBlendFunction (line 12) | public enum ViewTargetBlendFunction
  class ViewTargetBlendParamsPropertyData (line 31) | public class ViewTargetBlendParamsPropertyData : PropertyData
    method ViewTargetBlendParamsPropertyData (line 43) | public ViewTargetBlendParamsPropertyData(FName name) : base(name) { }
    method ViewTargetBlendParamsPropertyData (line 45) | public ViewTargetBlendParamsPropertyData() { }
    method Read (line 51) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 64) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 78) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 86) | public override string ToString()

FILE: UAssetAPI/PropertyTypes/Structs/Engine/WeightedRandomSamplerPropertyData.cs
  class WeightedRandomSamplerPropertyData (line 6) | public class WeightedRandomSamplerPropertyData : BasePropertyData<FWeigh...
    method WeightedRandomSamplerPropertyData (line 8) | public WeightedRandomSamplerPropertyData(FName name) : base(name) { }
    method WeightedRandomSamplerPropertyData (line 10) | public WeightedRandomSamplerPropertyData() { }
  class SkeletalMeshAreaWeightedTriangleSamplerPropertyData (line 16) | public class SkeletalMeshAreaWeightedTriangleSamplerPropertyData : Weigh...
    method SkeletalMeshAreaWeightedTriangleSamplerPropertyData (line 18) | public SkeletalMeshAreaWeightedTriangleSamplerPropertyData(FName name)...
    method SkeletalMeshAreaWeightedTriangleSamplerPropertyData (line 20) | public SkeletalMeshAreaWeightedTriangleSamplerPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/GameplayTagContainerPropertyData.cs
  class GameplayTagContainerPropertyData (line 7) | public class GameplayTagContainerPropertyData : PropertyData<FName[]>
    method GameplayTagContainerPropertyData (line 9) | public GameplayTagContainerPropertyData(FName name) : base(name)
    method GameplayTagContainerPropertyData (line 14) | public GameplayTagContainerPropertyData()
    method Read (line 23) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 38) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 56) | public override string ToString()
    method HandleCloned (line 66) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/PropertyTypes/Structs/LevelSequenceObjectReferenceMapPropertyData.cs
  class FLevelSequenceLegacyObjectReference (line 7) | public class FLevelSequenceLegacyObjectReference
    method FLevelSequenceLegacyObjectReference (line 12) | public FLevelSequenceLegacyObjectReference(Guid objectId, FString obje...
    method FLevelSequenceLegacyObjectReference (line 18) | public FLevelSequenceLegacyObjectReference(AssetBinaryReader reader)
    method Write (line 24) | public int Write(AssetBinaryWriter writer)
  class LevelSequenceObjectReferenceMapPropertyData (line 33) | public class LevelSequenceObjectReferenceMapPropertyData : PropertyData<...
    method LevelSequenceObjectReferenceMapPropertyData (line 35) | public LevelSequenceObjectReferenceMapPropertyData(FName name) : base(...
    method LevelSequenceObjectReferenceMapPropertyData (line 37) | public LevelSequenceObjectReferenceMapPropertyData() { }
    method Read (line 44) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 59) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Math/BoxPropertyData.cs
  class TBoxPropertyData (line 6) | public abstract class TBoxPropertyData<T> : PropertyData<TBox<T>>
    method TBoxPropertyData (line 8) | public TBoxPropertyData(FName name) : base(name) { }
    method TBoxPropertyData (line 10) | public TBoxPropertyData() { }
  class BoxPropertyData (line 13) | public class BoxPropertyData : TBoxPropertyData<FVector>
    method BoxPropertyData (line 15) | public BoxPropertyData(FName name) : base(name) { }
    method BoxPropertyData (line 17) | public BoxPropertyData() { }
    method Read (line 23) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 33) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class Box2fPropertyData (line 44) | public class Box2fPropertyData : TBoxPropertyData<FVector2f>
    method Box2fPropertyData (line 46) | public Box2fPropertyData(FName name) : base(name) { }
    method Box2fPropertyData (line 48) | public Box2fPropertyData() { }
    method Read (line 54) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 64) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class Box2DPropertyData (line 75) | public class Box2DPropertyData : TBoxPropertyData<FVector2D>
    method Box2DPropertyData (line 77) | public Box2DPropertyData(FName name) : base(name) { }
    method Box2DPropertyData (line 79) | public Box2DPropertyData() { }
    method Read (line 85) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 95) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Math/IntPointPropertyData.cs
  class IntPointPropertyData (line 7) | public class IntPointPropertyData : PropertyData<int[]> // X, Y
    method IntPointPropertyData (line 9) | public IntPointPropertyData(FName name) : base(name) { }
    method IntPointPropertyData (line 11) | public IntPointPropertyData() { }
    method Read (line 17) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 31) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 46) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 53) | public override string ToString()

FILE: UAssetAPI/PropertyTypes/Structs/Math/IntVector2PropertyData.cs
  class IntVector2PropertyData (line 6) | public class IntVector2PropertyData : BasePropertyData<FIntVector2>
    method IntVector2PropertyData (line 8) | public IntVector2PropertyData(FName name) : base(name) { }
    method IntVector2PropertyData (line 10) | public IntVector2PropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/IntVectorPropertyData.cs
  class IntVectorPropertyData (line 6) | public class IntVectorPropertyData : BasePropertyData<FIntVector>
    method IntVectorPropertyData (line 8) | public IntVectorPropertyData(FName name) : base(name) { }
    method IntVectorPropertyData (line 10) | public IntVectorPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/LinearColorPropertyData.cs
  class LinearColorPropertyData (line 6) | public class LinearColorPropertyData : BasePropertyData<FLinearColor> //...
    method LinearColorPropertyData (line 8) | public LinearColorPropertyData(FName name) : base(name) { }
    method LinearColorPropertyData (line 10) | public LinearColorPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/MatrixPropertyData.cs
  class MatrixPropertyData (line 6) | public class MatrixPropertyData : BasePropertyData<FMatrix>
    method MatrixPropertyData (line 8) | public MatrixPropertyData(FName name) : base(name) { }
    method MatrixPropertyData (line 10) | public MatrixPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/PlanePropertyData.cs
  class PlanePropertyData (line 9) | public class PlanePropertyData : BasePropertyData<FPlane>
    method PlanePropertyData (line 11) | public PlanePropertyData(FName name) : base(name) { }
    method PlanePropertyData (line 13) | public PlanePropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/QuatPropertyData.cs
  class QuatPropertyData (line 10) | public class QuatPropertyData : BasePropertyData<FQuat>
    method QuatPropertyData (line 12) | public QuatPropertyData(FName name) : base(name) { }
    method QuatPropertyData (line 14) | public QuatPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/RotatorPropertyData.cs
  class RotatorPropertyData (line 10) | public class RotatorPropertyData : BasePropertyData<FRotator>
    method RotatorPropertyData (line 12) | public RotatorPropertyData(FName name) : base(name) { }
    method RotatorPropertyData (line 14) | public RotatorPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/TwoVectorsPropertyData.cs
  class TwoVectorsPropertyData (line 6) | public class TwoVectorsPropertyData : BasePropertyData<FTwoVectors>
    method TwoVectorsPropertyData (line 8) | public TwoVectorsPropertyData(FName name) : base(name) { }
    method TwoVectorsPropertyData (line 10) | public TwoVectorsPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/Vector2DPropertyData.cs
  class Vector2DPropertyData (line 9) | public class Vector2DPropertyData : BasePropertyData<FVector2D>
    method Vector2DPropertyData (line 11) | public Vector2DPropertyData(FName name) : base(name) { }
    method Vector2DPropertyData (line 13) | public Vector2DPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/Vector2fPropertyData.cs
  class Vector2fPropertyData (line 9) | public class Vector2fPropertyData : BasePropertyData<FVector2f>
    method Vector2fPropertyData (line 11) | public Vector2fPropertyData(FName name) : base(name) { }
    method Vector2fPropertyData (line 13) | public Vector2fPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/Vector3fPropertyData.cs
  class Vector3fPropertyData (line 9) | public class Vector3fPropertyData : BasePropertyData<FVector3f>
    method Vector3fPropertyData (line 11) | public Vector3fPropertyData(FName name) : base(name) { }
    method Vector3fPropertyData (line 13) | public Vector3fPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/Vector4PropertyData.cs
  class Vector4PropertyData (line 9) | public class Vector4PropertyData : BasePropertyData<FVector4>
    method Vector4PropertyData (line 11) | public Vector4PropertyData(FName name) : base(name) { }
    method Vector4PropertyData (line 13) | public Vector4PropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/Vector4fPropertyData.cs
  class Vector4fPropertyData (line 9) | public class Vector4fPropertyData : BasePropertyData<FVector4f>
    method Vector4fPropertyData (line 11) | public Vector4fPropertyData(FName name) : base(name) { }
    method Vector4fPropertyData (line 13) | public Vector4fPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/VectorNetQuantizePropertyData.cs
  class VectorNetQuantizePropertyData (line 8) | public class VectorNetQuantizePropertyData : StructPropertyData
    method VectorNetQuantizePropertyData (line 10) | public VectorNetQuantizePropertyData(FName name, FName forcedType) : b...
    method VectorNetQuantizePropertyData (line 15) | public VectorNetQuantizePropertyData(FName name) : base(name)
    method VectorNetQuantizePropertyData (line 20) | public VectorNetQuantizePropertyData() { }
    method Read (line 26) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 43) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class VectorNetQuantizeNormalPropertyData (line 67) | public class VectorNetQuantizeNormalPropertyData : VectorNetQuantizeProp...
    method VectorNetQuantizeNormalPropertyData (line 69) | public VectorNetQuantizeNormalPropertyData(FName name) : base(name) { }
    method VectorNetQuantizeNormalPropertyData (line 71) | public VectorNetQuantizeNormalPropertyData() { }
  class VectorNetQuantize10PropertyData (line 78) | public class VectorNetQuantize10PropertyData : VectorNetQuantizeProperty...
    method VectorNetQuantize10PropertyData (line 80) | public VectorNetQuantize10PropertyData(FName name) : base(name) { }
    method VectorNetQuantize10PropertyData (line 82) | public VectorNetQuantize10PropertyData() { }
  class VectorNetQuantize100PropertyData (line 89) | public class VectorNetQuantize100PropertyData : VectorNetQuantizePropert...
    method VectorNetQuantize100PropertyData (line 91) | public VectorNetQuantize100PropertyData(FName name) : base(name) { }
    method VectorNetQuantize100PropertyData (line 93) | public VectorNetQuantize100PropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Math/VectorPropertyData.cs
  class VectorPropertyData (line 9) | public class VectorPropertyData : BasePropertyData<FVector>
    method VectorPropertyData (line 11) | public VectorPropertyData(FName name) : base(name) { }
    method VectorPropertyData (line 13) | public VectorPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Movies/FrameNumberPropertyData.cs
  class FrameNumberPropertyData (line 6) | public class FrameNumberPropertyData : BasePropertyData<FFrameNumber>
    method FrameNumberPropertyData (line 8) | public FrameNumberPropertyData(FName name) : base(name) { }
    method FrameNumberPropertyData (line 10) | public FrameNumberPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieScene.cs
  type ESectionEvaluationFlags (line 8) | public enum ESectionEvaluationFlags : byte {
  type FMovieSceneEvaluationKey (line 19) | public struct FMovieSceneEvaluationKey
    method FMovieSceneEvaluationKey (line 28) | public FMovieSceneEvaluationKey(uint _SequenceID, uint _TrackIdentifie...
    method FMovieSceneEvaluationKey (line 35) | public FMovieSceneEvaluationKey(AssetBinaryReader reader)
    method Write (line 45) | public int Write(AssetBinaryWriter writer)
  type FMovieSceneSubSectionData (line 57) | public struct FMovieSceneSubSectionData
    method FMovieSceneSubSectionData (line 66) | public FMovieSceneSubSectionData(FPackageIndex section, Guid objectBin...
    method FMovieSceneSubSectionData (line 73) | public FMovieSceneSubSectionData(AssetBinaryReader reader)
    method Write (line 83) | public int Write(AssetBinaryWriter writer)
  type FEntityAndMetaDataIndex (line 92) | public struct FEntityAndMetaDataIndex
    method FEntityAndMetaDataIndex (line 97) | public FEntityAndMetaDataIndex(int entityIndex, int metaDataIndex)
    method FEntityAndMetaDataIndex (line 103) | public FEntityAndMetaDataIndex(AssetBinaryReader reader)
    method Write (line 112) | public void Write(AssetBinaryWriter writer)
  type FMovieSceneSubSequenceTreeEntry (line 119) | public struct FMovieSceneSubSequenceTreeEntry
    method FMovieSceneSubSequenceTreeEntry (line 125) | public FMovieSceneSubSequenceTreeEntry(uint sequenceID, byte flags, St...
    method FMovieSceneSubSequenceTreeEntry (line 132) | public FMovieSceneSubSequenceTreeEntry(AssetBinaryReader reader)
    method Write (line 148) | public void Write(AssetBinaryWriter writer)
  type FMovieSceneSubSectionFieldData (line 160) | public struct FMovieSceneSubSectionFieldData(AssetBinaryReader reader)
    method Write (line 164) | public int Write(AssetBinaryWriter writer)
  type FMovieSceneEvaluationFieldEntityTree (line 174) | public struct FMovieSceneEvaluationFieldEntityTree(AssetBinaryReader rea...
    method Write (line 178) | public int Write(AssetBinaryWriter writer)
  type FMovieSceneSubSequenceTree (line 188) | public struct FMovieSceneSubSequenceTree(AssetBinaryReader reader)
    method Write (line 192) | public int Write(AssetBinaryWriter writer)
  type FSectionEvaluationDataTree (line 202) | public struct FSectionEvaluationDataTree
    method FSectionEvaluationDataTree (line 206) | public FSectionEvaluationDataTree(AssetBinaryReader reader)
    method Write (line 221) | public int Write(AssetBinaryWriter writer)
  type FMovieSceneTrackFieldData (line 238) | public struct FMovieSceneTrackFieldData(AssetBinaryReader reader)
    method Write (line 242) | public int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneChannel.cs
  class FMovieSceneChannel (line 8) | public class FMovieSceneChannel<T>
    method FMovieSceneChannel (line 21) | public FMovieSceneChannel()
    method FMovieSceneChannel (line 33) | public FMovieSceneChannel(AssetBinaryReader reader, Func<T> valueReader)
    method Write (line 53) | public void Write(AssetBinaryWriter writer, Action<T> valueWriter)
  class FMovieSceneFloatChannel (line 80) | public class FMovieSceneFloatChannel(AssetBinaryReader reader) : FMovieS...
  class FMovieSceneDoubleChannel (line 82) | public class FMovieSceneDoubleChannel(AssetBinaryReader reader) : FMovie...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneDoubleChannelPropertyData.cs
  class MovieSceneDoubleChannelPropertyData (line 6) | public class MovieSceneDoubleChannelPropertyData : PropertyData<FMovieSc...
    method MovieSceneDoubleChannelPropertyData (line 8) | public MovieSceneDoubleChannelPropertyData(FName name) : base(name) { }
    method MovieSceneDoubleChannelPropertyData (line 10) | public MovieSceneDoubleChannelPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneEvalTemplatePtrPropertyData.cs
  class MovieSceneTemplatePropertyData (line 8) | public class MovieSceneTemplatePropertyData : StructPropertyData
    method MovieSceneTemplatePropertyData (line 10) | public MovieSceneTemplatePropertyData(FName name, FName forcedType) : ...
    method MovieSceneTemplatePropertyData (line 11) | public MovieSceneTemplatePropertyData(FName name) : base(name) { }
    method MovieSceneTemplatePropertyData (line 12) | public MovieSceneTemplatePropertyData() { }
    method Read (line 14) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 34) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneEvalTemplatePtrPropertyData (line 65) | public class MovieSceneEvalTemplatePtrPropertyData : MovieSceneTemplateP...
    method MovieSceneEvalTemplatePtrPropertyData (line 67) | public MovieSceneEvalTemplatePtrPropertyData(FName name, FName forcedT...
    method MovieSceneEvalTemplatePtrPropertyData (line 68) | public MovieSceneEvalTemplatePtrPropertyData(FName name) : base(name) { }
    method MovieSceneEvalTemplatePtrPropertyData (line 69) | public MovieSceneEvalTemplatePtrPropertyData() { }
  class MovieSceneTrackImplementationPtrPropertyData (line 76) | public class MovieSceneTrackImplementationPtrPropertyData : MovieSceneTe...
    method MovieSceneTrackImplementationPtrPropertyData (line 78) | public MovieSceneTrackImplementationPtrPropertyData(FName name, FName ...
    method MovieSceneTrackImplementationPtrPropertyData (line 79) | public MovieSceneTrackImplementationPtrPropertyData(FName name) : base...
    method MovieSceneTrackImplementationPtrPropertyData (line 80) | public MovieSceneTrackImplementationPtrPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneEvaluationFieldEntityTreePropertyData.cs
  class MovieSceneSubSectionFieldDataPropertyData (line 6) | public class MovieSceneSubSectionFieldDataPropertyData : PropertyData<FM...
    method MovieSceneSubSectionFieldDataPropertyData (line 8) | public MovieSceneSubSectionFieldDataPropertyData(FName name) : base(na...
    method MovieSceneSubSectionFieldDataPropertyData (line 10) | public MovieSceneSubSectionFieldDataPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneEvaluationFieldEntityTreePropertyData (line 37) | public class MovieSceneEvaluationFieldEntityTreePropertyData : PropertyD...
    method MovieSceneEvaluationFieldEntityTreePropertyData (line 39) | public MovieSceneEvaluationFieldEntityTreePropertyData(FName name) : b...
    method MovieSceneEvaluationFieldEntityTreePropertyData (line 41) | public MovieSceneEvaluationFieldEntityTreePropertyData() { }
    method Read (line 47) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 57) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneSubSequenceTreePropertyData (line 68) | public class MovieSceneSubSequenceTreePropertyData : PropertyData<FMovie...
    method MovieSceneSubSequenceTreePropertyData (line 70) | public MovieSceneSubSequenceTreePropertyData(FName name) : base(name) { }
    method MovieSceneSubSequenceTreePropertyData (line 72) | public MovieSceneSubSequenceTreePropertyData() { }
    method Read (line 78) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 88) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneSequenceInstanceDataPtrPropertyData (line 98) | public class MovieSceneSequenceInstanceDataPtrPropertyData : PropertyDat...
    method MovieSceneSequenceInstanceDataPtrPropertyData (line 100) | public MovieSceneSequenceInstanceDataPtrPropertyData(FName name) : bas...
    method MovieSceneSequenceInstanceDataPtrPropertyData (line 102) | public MovieSceneSequenceInstanceDataPtrPropertyData() { }
    method Read (line 108) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 117) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class SectionEvaluationDataTreePropertyData (line 129) | public class SectionEvaluationDataTreePropertyData : PropertyData<FSecti...
    method SectionEvaluationDataTreePropertyData (line 131) | public SectionEvaluationDataTreePropertyData(FName name) : base(name) { }
    method SectionEvaluationDataTreePropertyData (line 133) | public SectionEvaluationDataTreePropertyData() { }
    method Read (line 139) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 149) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneTrackFieldDataPropertyData (line 160) | public class MovieSceneTrackFieldDataPropertyData : PropertyData<FMovieS...
    method MovieSceneTrackFieldDataPropertyData (line 162) | public MovieSceneTrackFieldDataPropertyData(FName name) : base(name) { }
    method MovieSceneTrackFieldDataPropertyData (line 164) | public MovieSceneTrackFieldDataPropertyData() { }
    method Read (line 170) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 180) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneEvaluationTree.cs
  type FEntry (line 5) | public struct FEntry
    method FEntry (line 20) | public FEntry(int startIndex, int size, int capacity)
    method FEntry (line 27) | public FEntry(AssetBinaryReader reader)
    method Write (line 37) | public void Write(AssetBinaryWriter writer)
  type TEvaluationTreeEntryContainer (line 45) | public struct TEvaluationTreeEntryContainer<T>
    method TEvaluationTreeEntryContainer (line 56) | public TEvaluationTreeEntryContainer(FEntry[] entries, T[] items)
    method TEvaluationTreeEntryContainer (line 62) | public TEvaluationTreeEntryContainer(AssetBinaryReader reader, Func<T>...
    method Write (line 82) | public void Write(AssetBinaryWriter writer, Action<T> valueWriter)
  class FMovieSceneEvaluationTree (line 98) | public class FMovieSceneEvaluationTree(AssetBinaryReader reader)
    method Write (line 109) | public void Write(AssetBinaryWriter writer)
  class TMovieSceneEvaluationTree (line 116) | public class TMovieSceneEvaluationTree<T> : FMovieSceneEvaluationTree
    method TMovieSceneEvaluationTree (line 123) | public TMovieSceneEvaluationTree(AssetBinaryReader reader, Func<T> val...
    method Write (line 128) | public void Write(AssetBinaryWriter writer, Action<T> valueWriter)

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneEvaluationTreeNode.cs
  type FEvaluationTreeEntryHandle (line 8) | public struct FEvaluationTreeEntryHandle
    method FEvaluationTreeEntryHandle (line 15) | public FEvaluationTreeEntryHandle(int _EntryIndex)
    method FEvaluationTreeEntryHandle (line 20) | public FEvaluationTreeEntryHandle(AssetBinaryReader reader)
    method Write (line 25) | public void Write(AssetBinaryWriter writer)
  type FMovieSceneEvaluationTreeNodeHandle (line 34) | public struct FMovieSceneEvaluationTreeNodeHandle
    method FMovieSceneEvaluationTreeNodeHandle (line 45) | public FMovieSceneEvaluationTreeNodeHandle(int _ChildrenHandle, int _I...
    method FMovieSceneEvaluationTreeNodeHandle (line 51) | public FMovieSceneEvaluationTreeNodeHandle(AssetBinaryReader reader)
    method Write (line 57) | public void Write(AssetBinaryWriter writer)
  class FMovieSceneEvaluationTreeNode (line 64) | public class FMovieSceneEvaluationTreeNode
    method FMovieSceneEvaluationTreeNode (line 80) | public FMovieSceneEvaluationTreeNode(AssetBinaryReader reader)
    method Write (line 91) | public void Write(AssetBinaryWriter writer)

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneEventParametersPropertyData.cs
  type FMovieSceneEventParameters (line 6) | public struct FMovieSceneEventParameters
    method FMovieSceneEventParameters (line 14) | public FMovieSceneEventParameters(FSoftObjectPath structType, byte[] s...
    method FMovieSceneEventParameters (line 20) | public FMovieSceneEventParameters(AssetBinaryReader reader)
    method Write (line 30) | public int Write(AssetBinaryWriter writer)
  class MovieSceneEventParametersPropertyData (line 41) | public class MovieSceneEventParametersPropertyData : PropertyData<FMovie...
    method MovieSceneEventParametersPropertyData (line 43) | public MovieSceneEventParametersPropertyData(FName name) : base(name) { }
    method MovieSceneEventParametersPropertyData (line 45) | public MovieSceneEventParametersPropertyData() { }
    method Read (line 51) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 61) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneFloatChannelPropertyData.cs
  class MovieSceneFloatChannelPropertyData (line 6) | public class MovieSceneFloatChannelPropertyData : PropertyData<FMovieSce...
    method MovieSceneFloatChannelPropertyData (line 8) | public MovieSceneFloatChannelPropertyData(FName name) : base(name) { }
    method MovieSceneFloatChannelPropertyData (line 10) | public MovieSceneFloatChannelPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneFloatValuePropertyData.cs
  class MovieSceneFloatValuePropertyData (line 6) | public class MovieSceneFloatValuePropertyData : PropertyData<FMovieScene...
    method MovieSceneFloatValuePropertyData (line 8) | public MovieSceneFloatValuePropertyData(FName name) : base(name) { }
    method MovieSceneFloatValuePropertyData (line 10) | public MovieSceneFloatValuePropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneFrameRangePropertyData.cs
  class MovieSceneFrameRangePropertyData (line 6) | public class MovieSceneFrameRangePropertyData : PropertyData<TRange<FFra...
    method MovieSceneFrameRangePropertyData (line 8) | public MovieSceneFrameRangePropertyData(FName name) : base(name) { }
    method MovieSceneFrameRangePropertyData (line 10) | public MovieSceneFrameRangePropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneGenerationLedgerPropertyData.cs
  class MovieSceneGenerationLedgerPropertyData (line 7) | public class MovieSceneGenerationLedgerPropertyData : PropertyData
    method MovieSceneGenerationLedgerPropertyData (line 15) | public MovieSceneGenerationLedgerPropertyData(FName name) : base(name)...
    method MovieSceneGenerationLedgerPropertyData (line 16) | public MovieSceneGenerationLedgerPropertyData() { }
    method Read (line 22) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 53) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneSegment.cs
  class FMovieSceneSegment (line 10) | public class FMovieSceneSegment
    method FMovieSceneSegment (line 21) | public FMovieSceneSegment()
    method FMovieSceneSegment (line 26) | public FMovieSceneSegment(AssetBinaryReader reader)
    method Write (line 56) | public int Write(AssetBinaryWriter writer)

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneSegmentPropertyData.cs
  class MovieSceneSegmentPropertyData (line 6) | public class MovieSceneSegmentPropertyData : PropertyData<FMovieSceneSeg...
    method MovieSceneSegmentPropertyData (line 8) | public MovieSceneSegmentPropertyData(FName name) : base(name) { }
    method MovieSceneSegmentPropertyData (line 10) | public MovieSceneSegmentPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneSegmentIdentifierPropertyData (line 37) | public class MovieSceneSegmentIdentifierPropertyData : PropertyData<int>
    method MovieSceneSegmentIdentifierPropertyData (line 39) | public MovieSceneSegmentIdentifierPropertyData(FName name) : base(name...
    method MovieSceneSegmentIdentifierPropertyData (line 41) | public MovieSceneSegmentIdentifierPropertyData() { }
    method Read (line 47) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 57) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneTrackIdentifierPropertyData.cs
  class MovieSceneTrackIdentifierPropertyData (line 6) | public class MovieSceneTrackIdentifierPropertyData : PropertyData<uint>
    method MovieSceneTrackIdentifierPropertyData (line 8) | public MovieSceneTrackIdentifierPropertyData(FName name) : base(name) { }
    method MovieSceneTrackIdentifierPropertyData (line 10) | public MovieSceneTrackIdentifierPropertyData() { }
    method Read (line 16) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 26) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneSequenceIDPropertyData (line 38) | public class MovieSceneSequenceIDPropertyData : PropertyData<uint>
    method MovieSceneSequenceIDPropertyData (line 40) | public MovieSceneSequenceIDPropertyData(FName name) : base(name) { }
    method MovieSceneSequenceIDPropertyData (line 42) | public MovieSceneSequenceIDPropertyData() { }
    method Read (line 48) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 58) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
  class MovieSceneEvaluationKeyPropertyData (line 70) | public class MovieSceneEvaluationKeyPropertyData : PropertyData<FMovieSc...
    method MovieSceneEvaluationKeyPropertyData (line 72) | public MovieSceneEvaluationKeyPropertyData(FName name) : base(name) { }
    method MovieSceneEvaluationKeyPropertyData (line 74) | public MovieSceneEvaluationKeyPropertyData() { }
    method Read (line 80) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 90) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/MovieSceneValue.cs
  class FMovieSceneTangentData (line 7) | public class FMovieSceneTangentData
    method FMovieSceneTangentData (line 16) | public FMovieSceneTangentData()
    method FMovieSceneTangentData (line 21) | public FMovieSceneTangentData(AssetBinaryReader reader)
    method Write (line 44) | public void Write(AssetBinaryWriter writer)
  class FMovieSceneValue (line 64) | public class FMovieSceneValue<T>
    method FMovieSceneValue (line 72) | public FMovieSceneValue(AssetBinaryReader reader, T value)
    method Write (line 94) | public void Write(AssetBinaryWriter writer, Action<T> valueWriter)
  class FMovieSceneFloatValue (line 113) | public class FMovieSceneFloatValue(AssetBinaryReader reader) : FMovieSce...
  class FMovieSceneDoubleValue (line 115) | public class FMovieSceneDoubleValue(AssetBinaryReader reader) : FMovieSc...

FILE: UAssetAPI/PropertyTypes/Structs/Movies/NameCurveKeyPropertyData.cs
  type FNameCurveKey (line 6) | public struct FNameCurveKey : IStruct<FNameCurveKey>
    method FNameCurveKey (line 11) | public FNameCurveKey(float time, FName value)
    method FNameCurveKey (line 17) | public FNameCurveKey(AssetBinaryReader reader)
    method Read (line 23) | public static FNameCurveKey Read(AssetBinaryReader reader) => new FNam...
    method Write (line 25) | public int Write(AssetBinaryWriter writer)
    method ToString (line 35) | public override string ToString() => $"({Time}, {Value})";
    method FromString (line 37) | public static FNameCurveKey FromString(string[] d, UAsset asset)
  class NameCurveKeyPropertyData (line 45) | public class NameCurveKeyPropertyData : BasePropertyData<FNameCurveKey>
    method NameCurveKeyPropertyData (line 47) | public NameCurveKeyPropertyData(FName name) : base(name) { }
    method NameCurveKeyPropertyData (line 48) | public NameCurveKeyPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Niagara/NiagaraDataInterfaceGPUParamInfoPropertyData.cs
  class NiagaraDataInterfaceGPUParamInfoPropertyData (line 6) | public class NiagaraDataInterfaceGPUParamInfoPropertyData : BaseProperty...
    method NiagaraDataInterfaceGPUParamInfoPropertyData (line 8) | public NiagaraDataInterfaceGPUParamInfoPropertyData(FName name) : base...
    method NiagaraDataInterfaceGPUParamInfoPropertyData (line 10) | public NiagaraDataInterfaceGPUParamInfoPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Niagara/NiagaraVariablePropertyData.cs
  class NiagaraDataChannelVariablePropertyData (line 7) | public class NiagaraDataChannelVariablePropertyData : NiagaraVariableBas...
    method NiagaraDataChannelVariablePropertyData (line 9) | public NiagaraDataChannelVariablePropertyData(FName name, FName forced...
    method NiagaraDataChannelVariablePropertyData (line 10) | public NiagaraDataChannelVariablePropertyData(FName name) : base(name)...
    method NiagaraDataChannelVariablePropertyData (line 11) | public NiagaraDataChannelVariablePropertyData() { }
  class NiagaraVariableBasePropertyData (line 17) | public class NiagaraVariableBasePropertyData : StructPropertyData
    method NiagaraVariableBasePropertyData (line 22) | public NiagaraVariableBasePropertyData(FName name, FName forcedType) :...
    method NiagaraVariableBasePropertyData (line 23) | public NiagaraVariableBasePropertyData(FName name) : base(name) { }
    method NiagaraVariableBasePropertyData (line 24) | public NiagaraVariableBasePropertyData() { }
    method Read (line 30) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 44) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 59) | public override void FromString(string[] d, UAsset asset)
  class NiagaraVariablePropertyData (line 65) | public class NiagaraVariablePropertyData : NiagaraVariableBasePropertyData
    method NiagaraVariablePropertyData (line 69) | public NiagaraVariablePropertyData(FName name, FName forcedType) : bas...
    method NiagaraVariablePropertyData (line 70) | public NiagaraVariablePropertyData(FName name) : base(name) { }
    method NiagaraVariablePropertyData (line 71) | public NiagaraVariablePropertyData() { }
    method Read (line 77) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 88) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 100) | public override void FromString(string[] d, UAsset asset)
  class NiagaraVariableWithOffsetPropertyData (line 107) | public class NiagaraVariableWithOffsetPropertyData : NiagaraVariableBase...
    method NiagaraVariableWithOffsetPropertyData (line 111) | public NiagaraVariableWithOffsetPropertyData(FName name, FName forcedT...
    method NiagaraVariableWithOffsetPropertyData (line 112) | public NiagaraVariableWithOffsetPropertyData(FName name) : base(name) { }
    method NiagaraVariableWithOffsetPropertyData (line 113) | public NiagaraVariableWithOffsetPropertyData() { }
    method Read (line 119) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 127) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 138) | public override void FromString(string[] d, UAsset asset)

FILE: UAssetAPI/PropertyTypes/Structs/Ranges/FloatRangePropertyData.cs
  class FloatRangePropertyData (line 6) | public class FloatRangePropertyData : PropertyData
    method FloatRangePropertyData (line 11) | public FloatRangePropertyData(FName name) : base(name) { }
    method FloatRangePropertyData (line 13) | public FloatRangePropertyData() { }
    method Read (line 19) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 30) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 42) | public override void FromString(string[] d, UAsset asset)
    method ToString (line 48) | public override string ToString()

FILE: UAssetAPI/PropertyTypes/Structs/RawStructPropertyData.cs
  class RawStructPropertyData (line 8) | public class RawStructPropertyData : PropertyData<byte[]>
    method RawStructPropertyData (line 17) | public RawStructPropertyData(FName name) : base(name) { }
    method RawStructPropertyData (line 19) | public RawStructPropertyData() { }
    method Read (line 25) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 46) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/Slate/DeprecateSlateVector2DPropertyData.cs
  class DeprecateSlateVector2DPropertyData (line 6) | public class DeprecateSlateVector2DPropertyData : BasePropertyData<FVect...
    method DeprecateSlateVector2DPropertyData (line 8) | public DeprecateSlateVector2DPropertyData(FName name) : base(name) { }
    method DeprecateSlateVector2DPropertyData (line 10) | public DeprecateSlateVector2DPropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/Slate/FontDataPropertyData.cs
  class FontDataPropertyData (line 7) | public class FontDataPropertyData : PropertyData<FFontData>
    method FontDataPropertyData (line 9) | public FontDataPropertyData(FName name) : base(name) { }
    method FontDataPropertyData (line 11) | public FontDataPropertyData() { }
    method Read (line 17) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 27) | public override int Write(AssetBinaryWriter writer, bool includeHeader...

FILE: UAssetAPI/PropertyTypes/Structs/SoftObjectPathPropertyData.cs
  class SoftObjectPathPropertyData (line 12) | public class SoftObjectPathPropertyData : PropertyData<FSoftObjectPath>
    method SoftObjectPathPropertyData (line 18) | public SoftObjectPathPropertyData(FName name) : base(name) { }
    method SoftObjectPathPropertyData (line 20) | public SoftObjectPathPropertyData() { }
    method Read (line 26) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method Write (line 43) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method ToString (line 64) | public override string ToString()
    method FromString (line 69) | public override void FromString(string[] d, UAsset asset)
  class SoftClassPathPropertyData (line 90) | public class SoftClassPathPropertyData : SoftObjectPathPropertyData
    method SoftClassPathPropertyData (line 92) | public SoftClassPathPropertyData(FName name) : base(name) { }
    method SoftClassPathPropertyData (line 94) | public SoftClassPathPropertyData() { }
  class SoftAssetPathPropertyData (line 102) | public class SoftAssetPathPropertyData : SoftObjectPathPropertyData
    method SoftAssetPathPropertyData (line 104) | public SoftAssetPathPropertyData(FName name) : base(name) { }
    method SoftAssetPathPropertyData (line 106) | public SoftAssetPathPropertyData() { }
  class StringAssetReferencePropertyData (line 116) | public class StringAssetReferencePropertyData : SoftObjectPathPropertyData
    method StringAssetReferencePropertyData (line 118) | public StringAssetReferencePropertyData(FName name) : base(name) { }
    method StringAssetReferencePropertyData (line 120) | public StringAssetReferencePropertyData() { }
  class StringClassReferencePropertyData (line 127) | public class StringClassReferencePropertyData : SoftObjectPathPropertyData
    method StringClassReferencePropertyData (line 129) | public StringClassReferencePropertyData(FName name) : base(name) { }
    method StringClassReferencePropertyData (line 131) | public StringClassReferencePropertyData() { }

FILE: UAssetAPI/PropertyTypes/Structs/StructPropertyData.cs
  class StructPropertyData (line 12) | public class StructPropertyData : PropertyData<List<PropertyData>>
    method StructPropertyData (line 75) | public StructPropertyData(FName name) : base(name)
    method StructPropertyData (line 80) | public StructPropertyData(FName name, FName forcedType) : base(name)
    method StructPropertyData (line 86) | public StructPropertyData() { }
    method ReadOnce (line 91) | private void ReadOnce(AssetBinaryReader reader, Type T, long offset, l...
    method ReadNTPL (line 102) | private void ReadNTPL(AssetBinaryReader reader, bool resetValue = true)
    method Read (line 116) | public override void Read(AssetBinaryReader reader, bool includeHeader...
    method ResolveAncestries (line 182) | public override void ResolveAncestries(UAsset asset, AncestryInfo ance...
    method WriteOnce (line 194) | private int WriteOnce(AssetBinaryWriter writer)
    method WriteNTPL (line 209) | private int WriteNTPL(AssetBinaryWriter writer)
    method DetermineIfSerializeWithCustomStructSerialization (line 223) | internal bool DetermineIfSerializeWithCustomStructSerialization(UAsset...
    method Write (line 240) | public override int Write(AssetBinaryWriter writer, bool includeHeader...
    method FromString (line 278) | public override void FromString(string[] d, UAsset asset)
    method HandleCloned (line 284) | protected override void HandleCloned(PropertyData res)

FILE: UAssetAPI/UAPUtils.cs
  class UAPUtils (line 15) | public static class UAPUtils
    method SerializeJson (line 19) | public static string SerializeJson(object obj, bool isFormatted)
    method FindAllInstances (line 24) | public static List<T> FindAllInstances<T>(object parent) where T : class
    method FindAllInstances (line 34) | private static void FindAllInstances<T>(object value, HashSet<object> ...
    method Clamp (line 68) | public static T Clamp<T>(T val, T min, T max) where T : IComparable<T>
    method GetOrderedFields (line 75) | public static FieldInfo[] GetOrderedFields<T>()
    method GetOrderedFields (line 80) | public static FieldInfo[] GetOrderedFields(Type t)
    method GetOrderedMembers (line 85) | public static MemberInfo[] GetOrderedMembers<T>()
    method GetOrderedMembers (line 90) | public static MemberInfo[] GetOrderedMembers(Type t)
    method GetValue (line 96) | public static object GetValue(this MemberInfo memberInfo, object forOb...
    method SetValue (line 109) | public static void SetValue(this MemberInfo memberInfo, object forObje...
    method GetImportNameReferenceWithoutZero (line 125) | public static FString GetImportNameReferenceWithoutZero(int j, UAsset ...
    method InterpretAsGuidAndConvertToUnsignedInts (line 132) | public static uint[] InterpretAsGuidAndConvertToUnsignedInts(this stri...
    method ConvertStringToByteArray (line 139) | public static byte[] ConvertStringToByteArray(this string val)
    method ToUnsignedInts (line 148) | public static uint[] ToUnsignedInts(this Guid value)
    method GUID (line 159) | public static Guid GUID(uint value1, uint value2, uint value3, uint va...
    method ConvertToGUID (line 169) | public static Guid ConvertToGUID(this string GuidString)
    method ConvertToString (line 189) | public static string ConvertToString(this Guid val)
    method ConvertHexStringToByteArray (line 197) | public static byte[] ConvertHexStringToByteArray(string hexString)
    method AlignPadding (line 211) | public static long AlignPadding(long pos, int align)
    method AlignPadding (line 217) | public static int AlignPadding(int pos, int align)
    method DivideAndRoundUp (line 222) | public static int DivideAndRoundUp(int a, int b)
    method FixDirectorySeparatorsForDisk (line 227) | public static string FixDirectorySeparatorsForDisk(this string path)
    method SortByDependencies (line 232) | public static List<T> SortByDependencies<T>(this IEnumerable<T> allExp...
    method SortByDependenciesVisit (line 242) | private static void SortByDependenciesVisit<T>(T item, HashSet<T> visi...

FILE: UAssetAPI/UAsset.cs
  type INameMap (line 24) | public interface INameMap
    method GetNameMapIndexList (line 26) | IReadOnlyList<FString> GetNameMapIndexList();
    method ClearNameIndexList (line 27) | void ClearNameIndexList();
    method SetNameReference (line 28) | void SetNameReference(int index, FString value);
    method GetNameReference (line 29) | FString GetNameReference(int index);
    method ContainsNameReference (line 30) | bool ContainsNameReference(FString search);
    method SearchNameReference (line 31) | int SearchNameReference(FString search);
    method AddNameReference (line 32) | int AddNameReference(FString name, bool forceAddDuplicates = false, bo...
    method CanCreateDummies (line 33) | bool CanCreateDummies();
  type CustomSerializationFlags (line 36) | [Flags]
  class NameMapOutOfRangeException (line 71) | public class NameMapOutOfRangeException : FormatException
    method NameMapOutOfRangeException (line 75) | public NameMapOutOfRangeException(FString requiredName) : base("Reques...
  class InvalidMappingsException (line 81) | public class InvalidMappingsException : InvalidOperationException
    method InvalidMappingsException (line 83) | public InvalidMappingsException(string message = "Unversioned properti...
  class UnknownEngineVersionException (line 89) | public class UnknownEngineVersionException : InvalidOperationException
    method UnknownEngineVersionException (line 91) | public UnknownEngineVersionException(string message) : base(message)
  type FEngineVersion (line 100) | public struct FEngineVersion
    method Write (line 113) | public void Write(UnrealBinaryWriter writer)
    method FEngineVersion (line 122) | public FEngineVersion(UnrealBinaryReader reader)
    method FEngineVersion (line 131) | public FEngineVersion(ushort major, ushort minor, ushort patch, uint c...
  class FGenerationInfo (line 144) | public class FGenerationInfo
    method FGenerationInfo (line 151) | public FGenerationInfo(int exportCount, int nameCount)
  class FAssetRegistryRecord (line 158) | public class FAssetRegistryRecord
  class UAsset (line 171) | public class UAsset : INameMap
    method FixNameMapLookupIfNeeded (line 358) | internal void FixNameMapLookupIfNeeded()
    method GetNameMapIndexList (line 373) | public IReadOnlyList<FString> GetNameMapIndexList()
    method ClearNameIndexList (line 382) | public void ClearNameIndexList()
    method SetNameReference (line 393) | public void SetNameReference(int index, FString value)
    method GetNameReference (line 405) | public FString GetNameReference(int index)
    method GetNameReferenceWithoutZero (line 418) | public FString GetNameReferenceWithoutZero(int index)
    method ContainsNameReference (line 431) | public bool ContainsNameReference(FString search)
    method SearchNameReference (line 443) | public int SearchNameReference(FString search)
    method AddNameReference (line 458) | public int AddNameReference(FString name, bool forceAddDuplicates = fa...
    method CanCreateDummies (line 480) | public virtual bool CanCreateDummies()
    method PathToStream (line 492) | public MemoryStream PathToStream(string p, bool loadUEXP = true)
    method PathToReader (line 530) | public AssetBinaryReader PathToReader(string p, bool loadUEXP = true)
    method GetClassExport (line 585) | public ClassExport GetClassExport()
    method ResolveAncestries (line 597) | public virtual void ResolveAncestries()
    method FindAssetOnDiskFromPath (line 611) | public virtual string FindAssetOnDiskFromPath(string path)
    method SetEngineVersion (line 650) | public void SetEngineVersion(EngineVersion newVersion)
    method GetEngineVersion (line 661) | public static EngineVersion GetEngineVersion(ObjectVersion objectVersi...
    method GetEngineVersion (line 715) | public EngineVersion GetEngineVersion()
    method GetIntroducedFromCustomVersionValue (line 731) | private static EngineVersion GetIntroducedFromCustomVersionValue(Type ...
    method GetCustomVersion (line 745) | public int GetCustomVersion(Guid key)
    method GetCustomVersion (line 764) | public int GetCustomVersion(string friendlyName)
    method GetCustomVersion (line 784) | public T GetCustomVersion<T>()
    method GuessCustomVersionFromTypeAndEngineVersion (line 802) | public static int GuessCustomVersionFromTypeAndEngineVersion(EngineVer...
    method GetDefaultCustomVersionContainer (line 846) | public static List<CustomVersion> GetDefaultCustomVersionContainer(Eng...
    method ParseExport (line 886) | public void ParseExport(AssetBinaryReader reader, int i, bool read = t...
    method ConvertExportToChildExportAndRead (line 892) | public void ConvertExportToChildExportAndRead(AssetBinaryReader reader...
    method VerifyBinaryEquality (line 1067) | public bool VerifyBinaryEquality()
    method GetParentClass (line 1096) | public virtual void GetParentClass(out FName parentClassPath, out FNam...
    method GetParentClassExportName (line 1116) | internal virtual FName GetParentClassExportName(out FName modulePath)
    method AddImport (line 1133) | public FPackageIndex AddImport(Import li)
    method SearchForImport (line 1147) | public int SearchForImport(FName classPackage, FName className, FPacka...
    method SearchForImport (line 1173) | public int SearchForImport(FName classPackage, FName className, FName ...
    method SearchForImport (line 1196) | public int SearchForImport(FName objectName)
    method PullSchemasFromAnotherAsset (line 1210) | public virtual bool PullSchemasFromAnotherAsset(FName path)
    method LoadDependencies (line 1582) | private Dictionary<int, IList<int>> LoadDependencies()
    method CopySplitUp (line 1638) | internal static void CopySplitUp(Stream input, Stream output, int star...
    method ReadHeader (line 1668) | private void ReadHeader(AssetBinaryReader reader)
    method Read (line 1899) | public virtual void Read(AssetBinaryReader reader, int[] manualSkips =...
    method ReadBitArray (line 2305) | private static BitArray ReadBitArray(AssetBinaryReader reader, out int...
    method BitsToNumWords (line 2311) | private static int BitsToNumWords(int bitCount)
    method ComputeBitArrayDataLenth (line 2316) | private static int ComputeBitArrayDataLenth(int bitCount)
    method MakeHeader (line 2325) | private byte[] MakeHeader()
    method WriteData (line 2550) | public virtual MemoryStream WriteData()
    method WriteBitArray (line 2958) | private static void WriteBitArray(AssetBinaryWriter writer, int count,...
    method Write (line 2975) | public virtual void Write(out MemoryStream uassetStream, out MemoryStr...
    method Write (line 3002) | public virtual void Write(string outputPath)
    method SerializeJson (line 3035) | public string SerializeJson(bool isFormatted = false)
    method SerializeJson (line 3045) | public string SerializeJson(Formatting jsonFormatting)
    method SerializeJsonObject (line 3057) | public string SerializeJsonObject(object value, bool isFormatted = false)
    method SerializeJsonObject (line 3068) | public string SerializeJsonObject(object value, Formatting jsonFormatt...
    method DeserializeJsonObject (line 3077) | public T DeserializeJsonObject<T>(string json)
    method DeserializeJson (line 3125) | public static UAsset DeserializeJson(string json)
    method DeserializeJson (line 3176) | public static UAsset DeserializeJson(Stream stream)
    method UAsset (line 3240) | public UAsset(string path, EngineVersion engineVersion = EngineVersion...
    method UAsset (line 3260) | public UAsset(string path, bool loadUexp, EngineVersion engineVersion ...
    method UAsset (line 3280) | public UAsset(AssetBinaryReader reader, EngineVersion engineVersion = ...
    method UAsset (line 3295) | public UAsset(EngineVersion engineVersion = EngineVersion.UNKNOWN, Usm...
    method UAsset (line 3313) | public UAsset(string path, ObjectVersion objectVersion, ObjectVersionU...
    method UAsset (line 3337) | public UAsset(AssetBinaryReader reader, ObjectVersion objectVersion, O...
    method UAsset (line 3357) | public UAsset(ObjectVersion objectVersion, ObjectVersionUE5 objectVers...
    method UAsset (line 3369) | public UAsset()
  class TraceStream (line 3378) | public class TraceStream : Stream
    method TraceStream (line 3385) | public TraceStream(Stream BaseStream, string pathOnDisk = null)
    method Flush (line 3404) | public override void Flush()
    method Read (line 3409) | public override int Read(byte[] buffer, int offset, int count)
    method Seek (line 3415) | public override long Seek(long offset, SeekOrigin origin)
    method SetLength (line 3422) | public override void SetLength(long value)
    method Write (line 3427) | public override void Write(byte[] buffer, int offset, int count)
  class LoggingAspect (line 3433) | [PSerializable]
    class ActionRead (line 3436) | public class ActionRead : IAction {
    class ActionSeek (line 3439) | public class ActionSeek : IAction {
    class ActionSpan (line 3442) | public class ActionSpan : IAction {
    type IAction (line 3446) | public interface IAction {}
    class Span (line 3448) | public class Span
    class Trace (line 3458) | public class Trace
    class VersionConverter (line 3466) | public class VersionConverter : JsonConverter<IAction>
      method WriteJson (line 3468) | public override void WriteJson(JsonWriter writer, IAction value, Jso...
      method ReadJson (line 3495) | public override IAction ReadJson(JsonReader reader, Type objectType,...
    class LogContext (line 3501) | public class LogContext
      method LogContext (line 3508) | public LogContext(TraceStream stream) {
      method Stop (line 3522) | public string Stop()
      method OnEntry (line 3541) | public void OnEntry(MethodExecutionArgs args) {
      method OnExit (line 3550) | public void OnExit(MethodExecutionArgs args) {
      method OnRead (line 3553) | public void OnRead(long size) {
      method OnSeek (line 3558) | public void OnSeek(long position) {
    method OnEntry (line 3567) | public override void OnEntry(MethodExecutionArgs args) {
    method OnSuccess (line 3570) | public override void OnSuccess(MethodExecutionArgs args) {}
    method OnExit (line 3571) | public override void OnExit(MethodExecutionArgs args) {
    method OnException (line 3574) | public override void OnException(MethodExecutionArgs args) {}
    method Start (line 3576) | public static void Start(TraceStream stream) {
    method Stop (line 3584) | public static string Stop()

FILE: UAssetAPI/UnrealTypes/EngineVersion.cs
  type EngineVersion (line 6) | public enum EngineVersion

FILE: UAssetAPI/UnrealTypes/FFieldPath.cs
  class FFieldPath (line 7) | [JsonObject(MemberSerialization.OptIn)]
    method FFieldPath (line 22) | public FFieldPath(FName[] path, FPackageIndex resolvedOwner, int numEx...
    method FFieldPath (line 31) | public FFieldPath()
    method FFieldPath (line 37) | public FFieldPath(AssetBinaryReader reader)
    method Read (line 43) | public static FField
Condensed preview — 1498 files, each showing path, character count, and a content snippet. Download the .json file or copy for the full structured content (4,112K chars).
[
  {
    "path": ".github/ISSUE_TEMPLATE/bug_report.md",
    "chars": 1209,
    "preview": "---\nname: Bug report\nabout: Create a report to help us improve\ntitle: ''\nlabels: ''\nassignees: ''\n\n---\n\n**Describe the b"
  },
  {
    "path": ".github/ISSUE_TEMPLATE/config.yml",
    "chars": 27,
    "preview": "blank_issues_enabled: false"
  },
  {
    "path": ".github/ISSUE_TEMPLATE/feature_request.md",
    "chars": 595,
    "preview": "---\nname: Feature request\nabout: Suggest an idea for this project\ntitle: ''\nlabels: ''\nassignees: ''\n\n---\n\n**Is your fea"
  },
  {
    "path": ".github/pull_request_template.md",
    "chars": 1201,
    "preview": "# Pull Request\n\n## Description\n\n<!-- Please include a summary of the change(s) you have made.\n\nIf this pull request is i"
  },
  {
    "path": ".github/workflows/build.yml",
    "chars": 568,
    "preview": "name: CI\r\non:\r\n  push:\r\n    branches:\r\n      - master\r\n\r\njobs:\r\n  build:\r\n    runs-on: windows-latest\r\n    steps:\r\n     "
  },
  {
    "path": ".github/workflows/main.yml",
    "chars": 897,
    "preview": "name: Deploy\r\non:\r\n  push:\r\n    branches:\r\n      - master\r\n\r\njobs:\r\n  deploy:\r\n    runs-on: ubuntu-latest\r\n    steps:\r\n "
  },
  {
    "path": ".gitignore",
    "chars": 209,
    "preview": ".vs\r\ndocs/book\r\ndocs/XMLDoc2Markdown\r\npackages\r\nTestResults\r\nUAssetAPI/git_commit.txt\r\nUAssetAPI/bin\r\nUAssetAPI/obj\r\nUAs"
  },
  {
    "path": "LICENSE",
    "chars": 1092,
    "preview": "MIT License\r\n\r\nCopyright (c) 2020 - 2026 atenfyr\r\n\r\nPermission is hereby granted, free of charge, to any person obtainin"
  },
  {
    "path": "NOTICE.md",
    "chars": 19523,
    "preview": "# Notices\r\nThe following is a list of applicable licensing information for all the third-party material used, in whole o"
  },
  {
    "path": "README.md",
    "chars": 2581,
    "preview": "# UAssetAPI\r\n[![CI Status](https://img.shields.io/github/actions/workflow/status/atenfyr/UAssetAPI/build.yml?label=CI)]("
  },
  {
    "path": "UAssetAPI/AC7Decrypt.cs",
    "chars": 7137,
    "preview": "using System;\r\nusing System.Diagnostics;\r\nusing System.IO;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI\r\n{\r\n   "
  },
  {
    "path": "UAssetAPI/AssetBinaryReader.cs",
    "chars": 11131,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing System.Text;\r\nusing UAssetAPI.CustomVersions;\r"
  },
  {
    "path": "UAssetAPI/AssetBinaryWriter.cs",
    "chars": 11141,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing System.Text;\r\nusing UAssetAPI.CustomVersions;\r"
  },
  {
    "path": "UAssetAPI/CRCGenerator.cs",
    "chars": 33578,
    "preview": "using System;\r\nusing System.Text;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI;\r\n\r\npublic static class CRCGener"
  },
  {
    "path": "UAssetAPI/CustomVersion.cs",
    "chars": 8707,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI;\r\n\r\n/// <summary>"
  },
  {
    "path": "UAssetAPI/CustomVersions/CustomVersions.cs",
    "chars": 116543,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.CustomVersions\r\n{\r\n    /// <summary>\r\n    /// Represe"
  },
  {
    "path": "UAssetAPI/ExportTypes/AssetImportDataExport.cs",
    "chars": 752,
    "preview": "using UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.ExportTypes\n{\n    public class AssetImportDataExport : NormalExport\n  "
  },
  {
    "path": "UAssetAPI/ExportTypes/ClassExport.cs",
    "chars": 7749,
    "preview": "using Newtonsoft.Json;\r\nusing System.IO;\r\nusing System.Linq;\r\nusing UAssetAPI.JSON;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnam"
  },
  {
    "path": "UAssetAPI/ExportTypes/DataTableExport.cs",
    "chars": 7558,
    "preview": "using System.Collections.Generic;\r\nusing UAssetAPI.PropertyTypes.Objects;\r\nusing UAssetAPI.PropertyTypes.Structs;\r\nusing"
  },
  {
    "path": "UAssetAPI/ExportTypes/EnumExport.cs",
    "chars": 4882,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnames"
  },
  {
    "path": "UAssetAPI/ExportTypes/Export.cs",
    "chars": 18851,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing System.Linq;\r\nusing S"
  },
  {
    "path": "UAssetAPI/ExportTypes/FieldExport.cs",
    "chars": 864,
    "preview": "using UAssetAPI.FieldTypes;\r\n\r\nnamespace UAssetAPI.ExportTypes\r\n{\r\n    /// <summary>\r\n    /// Export data for a <see cre"
  },
  {
    "path": "UAssetAPI/ExportTypes/FunctionExport.cs",
    "chars": 1055,
    "preview": "using System.IO;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.ExportTypes\r\n{\r\n    "
  },
  {
    "path": "UAssetAPI/ExportTypes/LevelExport.cs",
    "chars": 4213,
    "preview": "using System.Collections.Generic;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI."
  },
  {
    "path": "UAssetAPI/ExportTypes/MetaDataExport.cs",
    "chars": 3297,
    "preview": "using Newtonsoft.Json;\nusing System.Collections.Generic;\nusing UAssetAPI.CustomVersions;\nusing UAssetAPI.JSON;\nusing UAs"
  },
  {
    "path": "UAssetAPI/ExportTypes/NormalExport.cs",
    "chars": 8084,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing UAssetAPI.PropertyTypes.Objects;\r\nusing UAssetAPI.UnrealTypes;\r\n"
  },
  {
    "path": "UAssetAPI/ExportTypes/PropertyExport.cs",
    "chars": 1068,
    "preview": "using System.Linq;\r\nusing UAssetAPI.FieldTypes;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace"
  },
  {
    "path": "UAssetAPI/ExportTypes/RawExport.cs",
    "chars": 815,
    "preview": "using System.IO;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.ExportTypes\r\n{\r\n    "
  },
  {
    "path": "UAssetAPI/ExportTypes/StringTableExport.cs",
    "chars": 1928,
    "preview": "using Newtonsoft.Json;\r\nusing System.Linq;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAss"
  },
  {
    "path": "UAssetAPI/ExportTypes/StructExport.cs",
    "chars": 7170,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetAPI.Fie"
  },
  {
    "path": "UAssetAPI/ExportTypes/UserDefinedStructExport.cs",
    "chars": 3384,
    "preview": "using System.Collections.Generic;\r\nusing System.Linq;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetAPI.PropertyTypes.Ob"
  },
  {
    "path": "UAssetAPI/FieldTypes/EArrayDim.cs",
    "chars": 478,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing System.Linq;\r\nusing System.Text;\r\nusing System.Threading.Tasks;"
  },
  {
    "path": "UAssetAPI/FieldTypes/ELifetimeCondition.cs",
    "chars": 2343,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing System.Linq;\r\nusing System.Text;\r\nusing System.Threading.Tasks;"
  },
  {
    "path": "UAssetAPI/FieldTypes/FField.cs",
    "chars": 13239,
    "preview": "using System;\r\nusing System.Collections.Generic;\r\nusing System.Text.Json.Serialization;\r\nusing UAssetAPI.UnrealTypes;\r\n"
  },
  {
    "path": "UAssetAPI/FieldTypes/UField.cs",
    "chars": 12289,
    "preview": "using UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetAPI.Unversione"
  },
  {
    "path": "UAssetAPI/Import.cs",
    "chars": 2358,
    "preview": "using UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI\r\n{\r\n    /// <summary>\r\n    /// UObject resource type for objects th"
  },
  {
    "path": "UAssetAPI/JSON/ByteArrayJsonConverter.cs",
    "chars": 1671,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\n\r\nnamespace UAssetAPI.JSON\r\n{\r\n    public cla"
  },
  {
    "path": "UAssetAPI/JSON/FNameJsonConverter.cs",
    "chars": 1375,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing System.Diagnostics;\r\nusing UAssetAPI.Un"
  },
  {
    "path": "UAssetAPI/JSON/FPackageIndexJsonConverter.cs",
    "chars": 850,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/JSON/FSignedZeroJsonConverter.cs",
    "chars": 1774,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Diagnostics;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportT"
  },
  {
    "path": "UAssetAPI/JSON/FStringJsonConverter.cs",
    "chars": 880,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/JSON/FStringTableJsonConverter.cs",
    "chars": 2287,
    "preview": "using Newtonsoft.Json;\r\nusing Newtonsoft.Json.Linq;\r\nusing System;\r\nusing System.Collections;\r\nusing System.Collections"
  },
  {
    "path": "UAssetAPI/JSON/GuidJsonConverter.cs",
    "chars": 772,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\n\r\nnamespace UAssetAPI.JSON\r\n{\r\n    public class GuidJsonConverter : JsonConverte"
  },
  {
    "path": "UAssetAPI/JSON/TMapJsonConverter.cs",
    "chars": 3193,
    "preview": "using Newtonsoft.Json;\r\nusing Newtonsoft.Json.Linq;\r\nusing System;\r\nusing System.Collections;\r\nusing System.Collections"
  },
  {
    "path": "UAssetAPI/JSON/UAssetContractResolver.cs",
    "chars": 812,
    "preview": "using Newtonsoft.Json;\r\nusing Newtonsoft.Json.Serialization;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing U"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/EBlueprintTextLiteralType.cs",
    "chars": 1187,
    "preview": "namespace UAssetAPI.Kismet.Bytecode\r\n{\r\n    /// <summary>\r\n    /// Kinds of text literals\r\n    /// </summary>\r\n    publ"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/EExprToken.cs",
    "chars": 8771,
    "preview": "namespace UAssetAPI.Kismet.Bytecode\r\n{\r\n    /// <summary>\r\n    /// Evaluatable expression item types.\r\n    /// </summar"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/EScriptInstrumentationType.cs",
    "chars": 351,
    "preview": "namespace UAssetAPI.Kismet.Bytecode\r\n{\r\n\tpublic enum EScriptInstrumentationType : byte {\r\n\t\tClass = 0,\r\n\t\tClassScope,\r\n"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/ExpressionSerializer.cs",
    "chars": 13393,
    "preview": "using System;\r\nusing UAssetAPI.Kismet.Bytecode.Expressions;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_AddMulticastDelegate.cs",
    "chars": 2270,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ArrayConst.cs",
    "chars": 2684,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ArrayGetByRef.cs",
    "chars": 2222,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Assert.cs",
    "chars": 2413,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_BindDelegate.cs",
    "chars": 2526,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_BitFieldConst.cs",
    "chars": 2052,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Breakpoint.cs",
    "chars": 1143,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ByteConst.cs",
    "chars": 1494,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_CallMath.cs",
    "chars": 1191,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_CallMulticastDelegate.cs",
    "chars": 2564,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_CastBase.cs",
    "chars": 1784,
    "preview": "using Newtonsoft.Json;\nusing System;\nusing UAssetAPI.UnrealTypes;\nusing UAssetAPI.ExportTypes;\n\nnamespace UAssetAPI.Kis"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ClassContext.cs",
    "chars": 1192,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ClassSparseDataVariable.cs",
    "chars": 577,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ClearMulticastDelegate.cs",
    "chars": 1838,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ComputedJump.cs",
    "chars": 1852,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Context.cs",
    "chars": 3476,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Context_FailSilent.cs",
    "chars": 1216,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_CrossInterfaceCast.cs",
    "chars": 562,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_DefaultVariable.cs",
    "chars": 553,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_DeprecatedOp4A.cs",
    "chars": 1159,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_DoubleConst.cs",
    "chars": 1798,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.JSON;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_DynamicCast.cs",
    "chars": 541,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndArray.cs",
    "chars": 1135,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndArrayConst.cs",
    "chars": 1155,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndFunctionParms.cs",
    "chars": 1167,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndMap.cs",
    "chars": 1127,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndMapConst.cs",
    "chars": 1147,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndOfScript.cs",
    "chars": 1147,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndParmValue.cs",
    "chars": 1151,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndSet.cs",
    "chars": 1127,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndSetConst.cs",
    "chars": 1147,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_EndStructConst.cs",
    "chars": 1159,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_False.cs",
    "chars": 1123,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_FieldPathConst.cs",
    "chars": 1576,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_FinalFunction.cs",
    "chars": 2518,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_FloatConst.cs",
    "chars": 1791,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.JSON;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_InstanceDelegate.cs",
    "chars": 1761,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_InstanceVariable.cs",
    "chars": 556,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_InstrumentationEvent.cs",
    "chars": 2304,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Int64Const.cs",
    "chars": 1499,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_IntConst.cs",
    "chars": 1489,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_IntConstByte.cs",
    "chars": 1240,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_IntOne.cs",
    "chars": 1127,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_IntZero.cs",
    "chars": 1131,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_InterfaceContext.cs",
    "chars": 1799,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_InterfaceToObjCast.cs",
    "chars": 562,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Jump.cs",
    "chars": 1681,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_JumpIfNot.cs",
    "chars": 2331,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Let.cs",
    "chars": 2600,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetBase.cs",
    "chars": 2090,
    "preview": "using Newtonsoft.Json;\nusing System;\nusing UAssetAPI.UnrealTypes;\nusing UAssetAPI.ExportTypes;\n\nnamespace UAssetAPI.Kis"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetBool.cs",
    "chars": 524,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetDelegate.cs",
    "chars": 536,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetMulticastDelegate.cs",
    "chars": 563,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetObj.cs",
    "chars": 521,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetValueOnPersistentFrame.cs",
    "chars": 2286,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LetWeakObjPtr.cs",
    "chars": 542,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalFinalFunction.cs",
    "chars": 1231,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalOutVariable.cs",
    "chars": 556,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalVariable.cs",
    "chars": 551,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_LocalVirtualFunction.cs",
    "chars": 1241,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_MapConst.cs",
    "chars": 2934,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_MetaCast.cs",
    "chars": 528,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_NameConst.cs",
    "chars": 1523,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expres"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_NoInterface.cs",
    "chars": 1147,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_NoObject.cs",
    "chars": 1135,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Nothing.cs",
    "chars": 1160,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_NothingInt32.cs",
    "chars": 1592,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n  "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ObjToInterfaceCast.cs",
    "chars": 653,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Byteco"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_ObjectConst.cs",
    "chars": 1555,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expres"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_PopExecutionFlow.cs",
    "chars": 1167,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_PopExecutionFlowIfNot.cs",
    "chars": 1988,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_PrimitiveCast.cs",
    "chars": 2304,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_PropertyConst.cs",
    "chars": 1758,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_PushExecutionFlow.cs",
    "chars": 1777,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_RemoveMulticastDelegate.cs",
    "chars": 2282,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Return.cs",
    "chars": 1773,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_RotationConst.cs",
    "chars": 2480,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Self.cs",
    "chars": 1119,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SetArray.cs",
    "chars": 3271,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SetConst.cs",
    "chars": 2636,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SetMap.cs",
    "chars": 2702,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SetSet.cs",
    "chars": 2623,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Skip.cs",
    "chars": 2118,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SkipOffsetConst.cs",
    "chars": 1564,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SoftObjectConst.cs",
    "chars": 1580,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_StringConst.cs",
    "chars": 1524,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_StructConst.cs",
    "chars": 2695,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing UAssetAPI.UnrealTypes"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_StructMemberContext.cs",
    "chars": 2280,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_SwitchValue.cs",
    "chars": 4877,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_TextConst.cs",
    "chars": 2673,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expres"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Tracepoint.cs",
    "chars": 1143,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_TransformConst.cs",
    "chars": 1426,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions;\r\n\r\n/// <summary>\r\n/// A"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_True.cs",
    "chars": 1119,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_UInt64Const.cs",
    "chars": 1506,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_UnicodeStringConst.cs",
    "chars": 1599,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n "
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_VariableBase.cs",
    "chars": 1595,
    "preview": "using Newtonsoft.Json;\nusing System;\nusing UAssetAPI.UnrealTypes;\nusing UAssetAPI.ExportTypes;\n\nnamespace UAssetAPI.Kis"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_Vector3fConst.cs",
    "chars": 1920,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_VectorConst.cs",
    "chars": 2451,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_VirtualFunction.cs",
    "chars": 2565,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/Expressions/EX_WireTracepoint.cs",
    "chars": 1159,
    "preview": "namespace UAssetAPI.Kismet.Bytecode.Expressions\r\n{\r\n    /// <summary>\r\n    /// A single Kismet bytecode instruction, co"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/FScriptText.cs",
    "chars": 6295,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/KismetExpression.cs",
    "chars": 3495,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAP"
  },
  {
    "path": "UAssetAPI/Kismet/Bytecode/KismetPropertyPointer.cs",
    "chars": 1268,
    "preview": "using Newtonsoft.Json;\r\nusing System.ComponentModel;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.CustomVersions;\r\n\r\n"
  },
  {
    "path": "UAssetAPI/Kismet/KismetSerializer.cs",
    "chars": 60368,
    "preview": "using Newtonsoft.Json.Linq;\r\nusing UAssetAPI.FieldTypes;\r\nusing UAssetAPI.Kismet.Bytecode.Expressions;\r\nusing UAssetAPI."
  },
  {
    "path": "UAssetAPI/MainSerializer.cs",
    "chars": 32855,
    "preview": "using System;\r\nusing System.Collections;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing System.Linq;\r\nusing"
  },
  {
    "path": "UAssetAPI/Pak/Interop.cs",
    "chars": 5205,
    "preview": "/*\r\n    This code was written by @trumank as part of the repak crate: https://github.com/trumank/repak\r\n\r\n    MIT Licens"
  },
  {
    "path": "UAssetAPI/Pak/RePak.cs",
    "chars": 11005,
    "preview": "/*\r\n    This code has been slightly adapted from code written by @trumank as part of the repak crate: https://github.co"
  },
  {
    "path": "UAssetAPI/Properties/AssemblyInfo.cs",
    "chars": 775,
    "preview": "using System.Reflection;\r\nusing System.Runtime.CompilerServices;\r\nusing System.Runtime.InteropServices;\r\n\r\n#if DEBUGTRA"
  },
  {
    "path": "UAssetAPI/Properties/Resources.Designer.cs",
    "chars": 3211,
    "preview": "//------------------------------------------------------------------------------\r\n// <auto-generated>\r\n//     This code"
  },
  {
    "path": "UAssetAPI/Properties/Resources.resx",
    "chars": 6183,
    "preview": "<?xml version=\"1.0\" encoding=\"utf-8\"?>\r\n<root>\r\n  <!-- \r\n    Microsoft ResX Schema \r\n    \r\n    Version 2.0\r\n    \r\n    T"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/ArrayPropertyData.cs",
    "chars": 13284,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.IO;\r\nusing UAssetAPI.PropertyTypes.Structs;\r\nusing UAssetAPI.UnrealT"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/BoolPropertyData.cs",
    "chars": 2248,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/BytePropertyData.cs",
    "chars": 6274,
    "preview": "using Newtonsoft.Json;\r\nusing Newtonsoft.Json.Converters;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI."
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/DelegatePropertyData.cs",
    "chars": 2569,
    "preview": "using Newtonsoft.Json;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n///"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/DoublePropertyData.cs",
    "chars": 1841,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.JSON;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Proper"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/EnumPropertyData.cs",
    "chars": 11287,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing System.Linq;\r\nusing UAssetAPI.UnrealType"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/FieldPathPropertyData.cs",
    "chars": 1075,
    "preview": "using UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Objects;\n\n/// <summary>\n/// Describes a reference variab"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/FloatPropertyData.cs",
    "chars": 1925,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.JSON;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.Proper"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/Int16PropertyData.cs",
    "chars": 1852,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/Int64PropertyData.cs",
    "chars": 1532,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/Int8PropertyData.cs",
    "chars": 1502,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/IntPropertyData.cs",
    "chars": 1488,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/InterfacePropertyData.cs",
    "chars": 557,
    "preview": "using UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describes a reference v"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/MapPropertyData.cs",
    "chars": 9992,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Linq;\r\nusing UAssetAPI.JSON;\r\nusing UAssetAPI.PropertyTypes.Structs;"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/MulticastDelegatePropertyData.cs",
    "chars": 3383,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/NamePropertyData.cs",
    "chars": 1551,
    "preview": "using UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describes an <see cref="
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/ObjectPropertyData.cs",
    "chars": 3203,
    "preview": "using UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.ExportTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/PropertyData.cs",
    "chars": 16528,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing System.Collections.Generic;\r\nusing System.IO;\r\nusing UAssetAPI.UnrealTypes;"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/SetPropertyData.cs",
    "chars": 4348,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.Unversioned;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/SoftObjectPropertyData.cs",
    "chars": 8021,
    "preview": "using System;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Object"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/StrPropertyData.cs",
    "chars": 1621,
    "preview": "using System.Text;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Des"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/TextHistoryType.cs",
    "chars": 384,
    "preview": "namespace UAssetAPI.PropertyTypes.Objects;\r\n\r\npublic enum TextHistoryType\r\n{\r\n    None = -1,\r\n    Base = 0,\r\n    NamedFo"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/TextPropertyData.cs",
    "chars": 17350,
    "preview": "using Newtonsoft.Json;\r\nusing Newtonsoft.Json.Converters;\r\nusing System;\r\nusing UAssetAPI.CustomVersions;\r\nusing UAssetA"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/UInt16PropertyData.cs",
    "chars": 1864,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/UInt32PropertyData.cs",
    "chars": 1507,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/UInt64PropertyData.cs",
    "chars": 1545,
    "preview": "using System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n/// <summary>\r\n/// Describe"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/UnknownPropertyData.cs",
    "chars": 1874,
    "preview": "using Newtonsoft.Json;\r\nusing System;\r\nusing UAssetAPI.UnrealTypes;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Objects;\r\n\r\n///"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Objects/WeakObjectPropertyData.cs",
    "chars": 572,
    "preview": "using UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Objects\n{\n    public class WeakObjectPropertyData : Obj"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/ClothLODDataPropertyData.cs",
    "chars": 7524,
    "preview": "using UAssetAPI.UnrealTypes;\r\nusing UAssetAPI.PropertyTypes.Objects;\r\n\r\nnamespace UAssetAPI.PropertyTypes.Structs;\r\n\r\n/"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/ClothTetherDataPropertyData.cs",
    "chars": 2734,
    "preview": "using UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Structs;\n\n/// <s"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Core/ColorPropertyData.cs",
    "chars": 1947,
    "preview": "using System.Drawing;\nusing UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.Property"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Core/DateTimePropertyData.cs",
    "chars": 2246,
    "preview": "using System;\nusing UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.St"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Core/GuidPropertyData.cs",
    "chars": 1642,
    "preview": "using System;\nusing UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.St"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Core/TimespanPropertyData.cs",
    "chars": 2329,
    "preview": "using System;\nusing UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.St"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/FontCharacterPropertyData.cs",
    "chars": 1158,
    "preview": "using UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Structs;\n\npublic"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/KeyHandleMapPropertyData.cs",
    "chars": 1384,
    "preview": "using UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Structs;\n\npublic"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/MaterialInputProperties.cs",
    "chars": 11252,
    "preview": "using UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\nusing UAssetAPI.CustomVersions;\n\nnamespace UAssetAPI"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/MaterialOverrideNanitePropertyData.cs",
    "chars": 3017,
    "preview": "using UAssetAPI.CustomVersions;\nusing UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/NavAgentSelectorPropertyData.cs",
    "chars": 1251,
    "preview": "using UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Structs;\n\npublic "
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/PerPlatformProperties.cs",
    "chars": 9317,
    "preview": "using System;\nusing System.Collections.Generic;\nusing UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nna"
  },
  {
    "path": "UAssetAPI/PropertyTypes/Structs/Engine/PerQualityProperties.cs",
    "chars": 2524,
    "preview": "using UAssetAPI.PropertyTypes.Objects;\nusing UAssetAPI.UnrealTypes;\n\nnamespace UAssetAPI.PropertyTypes.Structs;\n\npublic"
  }
]

// ... and 1298 more files (download for full content)

About this extraction

This page contains the full source code of the atenfyr/UAssetAPI GitHub repository, extracted and formatted as plain text for AI agents and large language models (LLMs). The extraction includes 1498 files (90.0 MB), approximately 1.0M tokens, and a symbol index with 2915 extracted functions, classes, methods, constants, and types. Use this with OpenClaw, Claude, ChatGPT, Cursor, Windsurf, or any other AI tool that accepts text input. You can copy the full output to your clipboard or download it as a .txt file.

Extracted by GitExtract — free GitHub repo to text converter for AI. Built by Nikandr Surkov.

Copied to clipboard!